F476380

General Info

Members Datasets Scaffolds Average Seq Length
704 321 1408 166

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0392407|Ga0501033_0392407_213_800
Length 195
Sequence MPSPARARHPDPFRTAVFTGTFDPISLGHLDVIRRGRLLFDHLVVGIGVHPSKTSLFAIDERLSLARRVVEPFPNVSVESFEELTVQYVRRIGARVILRGLRTLTDMEYEFGMTLTNQRLDPEIETVFLMADSQYSHVSSSLIRQVARFGGRESLKPFVPELVIDPILAKLSVNRSADTAVDYDKRSVAVKLPEP

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
270 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
271 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
272 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
278 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
281 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
284 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
285 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
286 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
302 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
306 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
307 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
308 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
309 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
310 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
311 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
312 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
313 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
314 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
315 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
316 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
317 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
318 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
319 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
320 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
321 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 2.56
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0392407 3300049570 Bacteria 969
2 SwRhRL2b_contig_158587 2162886007 Bacteria 2633
3 SwRhRL2b_contig_3731301 2162886007 Bacteria 1169
4 JGI24736J21556_1035193 3300001904 Bacteria 773
5 JGI24741J21665_1019720 3300001915 Bacteria 1066
6 JGI24752J21851_1001534 3300001976 Bacteria 3108
7 JGI24740J21852_10000581 3300001979 Bacteria 15714
8 JGI24740J21852_10040944 3300001979 Bacteria 1400
9 JGI24740J21852_10082444 3300001979 Bacteria 840
10 JGI24739J22299_10000556 3300001989 Bacteria 13387
11 JGI24739J22299_10085242 3300001989 Bacteria 966
12 JGI24737J22298_10004950 3300001990 Bacteria 4616
13 JGI24737J22298_10018373 3300001990 Bacteria 2244
14 JGI24737J22298_10073671 3300001990 Bacteria 1018
15 JGI24735J21928_10000676 3300002067 Bacteria 12079
16 JGI24735J21928_10007951 3300002067 Bacteria 3444
17 JGI24735J21928_10010773 3300002067 Bacteria 2906
18 JGI24738J21930_10002503 3300002075 Bacteria 4786
19 JGI24749J21850_1022072 3300002076 Bacteria 902
20 JGI24034J26672_10009458 3300002239 Bacteria 1438
21 JGI25150J39212_1000711 3300002774 Bacteria 11968
22 JGI25151J46595_10023430 3300003187 Bacteria 2544
23 JGI25165J46597_1000024 3300003214 Bacteria 335150
24 JGI25153J46596_10000186 3300003215 Bacteria 60427
25 Ga0055526_1000503 3300003771 Bacteria 31087
26 Ga0055536_1026934 3300003781 Bacteria 1602
27 Ga0055540_1003332 3300003792 Bacteria 7820
28 Ga0055540_1006395 3300003792 Bacteria 4685
29 Ga0055543_1035427 3300004625 Bacteria 857
30 Ga0065704_10001990 3300005289 Bacteria 8995
31 Ga0065704_10004250 3300005289 Bacteria 5531
32 Ga0065704_10190368 3300005289 Bacteria 1192
33 Ga0065715_10000724 3300005293 Bacteria 9238
34 Ga0070658_10022607 3300005327 Bacteria 5045
35 Ga0070658_10135521 3300005327 Bacteria 2054
36 Ga0070658_10138794 3300005327 Bacteria 2030
37 Ga0070658_10295647 3300005327 Bacteria 1380
38 Ga0070658_10528128 3300005327 Bacteria 1020
39 Ga0070658_10779209 3300005327 Bacteria 831
40 Ga0070683_100836122 3300005329 Bacteria 883
41 Ga0070690_100026517 3300005330 Bacteria 3575
42 Ga0070670_100000964 3300005331 Bacteria 22587
43 Ga0070670_100001075 3300005331 Bacteria 21713
44 Ga0070670_100003439 3300005331 Bacteria 13136
45 Ga0070670_100055005 3300005331 Bacteria 3416
46 Ga0070670_100273307 3300005331 Bacteria 1475
47 Ga0070677_10000705 3300005333 Bacteria 11228
48 Ga0068869_100501048 3300005334 Bacteria 1014
49 Ga0070666_10000089 3300005335 Bacteria 64147
50 Ga0070666_10082589 3300005335 Bacteria 2197
51 Ga0070666_10111826 3300005335 Bacteria 1889
52 Ga0070680_100010145 3300005336 Bacteria 7262
53 Ga0070680_100061186 3300005336 Bacteria 3082
54 Ga0070680_100203329 3300005336 Bacteria 1671
55 Ga0070680_100381810 3300005336 Bacteria 1199
56 Ga0070680_100478403 3300005336 Bacteria 1064
57 Ga0070682_100327637 3300005337 Bacteria 1134
58 Ga0070682_100675763 3300005337 Bacteria 825
59 Ga0068868_100088300 3300005338 Bacteria 2495
60 Ga0070660_100051863 3300005339 Bacteria 3161
61 Ga0070660_100067208 3300005339 Bacteria 2792
62 Ga0070660_100285692 3300005339 Bacteria 1350
63 Ga0070660_100635435 3300005339 Bacteria 894
64 Ga0070660_100757531 3300005339 Bacteria 815
65 Ga0070660_101062951 3300005339 Bacteria 685
66 Ga0070660_101219995 3300005339 Bacteria 638
67 Ga0070691_10454621 3300005341 Bacteria 732
68 Ga0070661_100000014 3300005344 Bacteria 158652
69 Ga0070661_100056132 3300005344 Bacteria 2885
70 Ga0070661_100078489 3300005344 Bacteria 2435
71 Ga0070692_10006130 3300005345 Bacteria 5195
72 Ga0070668_100000014 3300005347 Bacteria 112374
73 Ga0070668_100035049 3300005347 Bacteria 3825
74 Ga0070668_100050210 3300005347 Bacteria 3211
75 Ga0070668_100078772 3300005347 Bacteria 2578
76 Ga0070668_100137456 3300005347 Bacteria 1966
77 Ga0070668_100576832 3300005347 Bacteria 982
78 Ga0070669_100000024 3300005353 Bacteria 173107
79 Ga0070669_100003409 3300005353 Bacteria 11441
80 Ga0070669_100018244 3300005353 Bacteria 5013
81 Ga0070669_100068114 3300005353 Bacteria 2627
82 Ga0070669_100390569 3300005353 Bacteria 1136
83 Ga0070669_100525624 3300005353 Bacteria 984
84 Ga0070675_100006846 3300005354 Bacteria 8752
85 Ga0070671_100000006 3300005355 Bacteria 250635
86 Ga0070671_100031481 3300005355 Bacteria 4382
87 Ga0070671_100051163 3300005355 Bacteria 3435
88 Ga0070671_100462840 3300005355 Bacteria 1088
89 Ga0070674_100010543 3300005356 Bacteria 5593
90 Ga0070673_100034866 3300005364 Bacteria 3812
91 Ga0070673_100038050 3300005364 Bacteria 3671
92 Ga0070659_100059544 3300005366 Bacteria 3015
93 Ga0070659_100060274 3300005366 Bacteria 2997
94 Ga0070659_100544125 3300005366 Bacteria 993
95 Ga0070659_100862008 3300005366 Bacteria 790
96 Ga0070667_100000051 3300005367 Bacteria 155117
97 Ga0070667_100056171 3300005367 Bacteria 3325
98 Ga0070667_100137672 3300005367 Bacteria 2135
99 Ga0070701_10088315 3300005438 Bacteria 1693
100 Ga0070700_100055816 3300005441 Bacteria 2473
101 Ga0070708_100039593 3300005445 Bacteria 4125
102 Ga0070663_100013235 3300005455 Bacteria 5251
103 Ga0070663_100095827 3300005455 Bacteria 2206
104 Ga0070663_100340925 3300005455 Bacteria 1211
105 Ga0070663_101366240 3300005455 Bacteria 626
106 Ga0070678_100006580 3300005456 Bacteria 6830
107 Ga0070662_100001528 3300005457 Bacteria 14251
108 Ga0070662_100019126 3300005457 Bacteria 4645
109 Ga0070662_100152991 3300005457 Bacteria 1798
110 Ga0070662_100240976 3300005457 Bacteria 1450
111 Ga0070662_100477549 3300005457 Bacteria 1037
112 Ga0070681_10069647 3300005458 Bacteria 3484
113 Ga0070681_10125533 3300005458 Bacteria 2499
114 Ga0070681_10302567 3300005458 Bacteria 1509
115 Ga0070681_10304875 3300005458 Bacteria 1502
116 Ga0070681_10503411 3300005458 Bacteria 1124
117 Ga0068867_100064156 3300005459 Bacteria 2731
118 Ga0070706_100618422 3300005467 Bacteria 1006
119 Ga0070679_100000003 3300005530 Bacteria 307836
120 Ga0070679_100033561 3300005530 Bacteria 5082
121 Ga0070679_100091875 3300005530 Bacteria 3023
122 Ga0070679_100205183 3300005530 Bacteria 1935
123 Ga0070679_100262730 3300005530 Bacteria 1681
124 Ga0070679_101170360 3300005530 Bacteria 714
125 Ga0070679_101188883 3300005530 Bacteria 708
126 Ga0070684_100274879 3300005535 Bacteria 1543
127 Ga0070684_101284704 3300005535 Bacteria 689
128 Ga0068853_100005871 3300005539 Bacteria 9677
129 Ga0068853_100024335 3300005539 Bacteria 5076
130 Ga0068853_100124119 3300005539 Bacteria 2305
131 Ga0068853_100235623 3300005539 Bacteria 1676
132 Ga0068853_100383723 3300005539 Bacteria 1312
133 Ga0070672_100005676 3300005543 Bacteria 8310
134 Ga0070686_101055559 3300005544 Bacteria 669
135 Ga0070665_100000471 3300005548 Bacteria 58097
136 Ga0070665_100095368 3300005548 Bacteria 2980
137 Ga0070665_100310719 3300005548 Bacteria 1580
138 Ga0070665_100822401 3300005548 Bacteria 942
139 Ga0070665_101837287 3300005548 Bacteria 612
140 Ga0068855_100055176 3300005563 Bacteria 4668
141 Ga0068855_100473645 3300005563 Bacteria 1364
142 Ga0068855_101277420 3300005563 Bacteria 761
143 Ga0070664_100061185 3300005564 Bacteria 3209
144 Ga0070664_100119688 3300005564 Bacteria 2304
145 Ga0070664_100194348 3300005564 Bacteria 1809
146 Ga0070664_100560586 3300005564 Bacteria 1057
147 Ga0068857_100005612 3300005577 Bacteria 10725
148 Ga0068857_100067854 3300005577 Bacteria 3174
149 Ga0068857_100102670 3300005577 Bacteria 2567
150 Ga0068857_100160563 3300005577 Bacteria 2039
151 Ga0068857_100693885 3300005577 Bacteria 967
152 Ga0068857_101286437 3300005577 Bacteria 709
153 Ga0068857_101286438 3300005577 Bacteria 709
154 Ga0068854_100119433 3300005578 Bacteria 1999
155 Ga0068854_100176768 3300005578 Bacteria 1665
156 Ga0068854_100182268 3300005578 Bacteria 1641
157 Ga0068854_100228496 3300005578 Bacteria 1476
158 Ga0068854_100264883 3300005578 Bacteria 1377
159 Ga0068854_100552740 3300005578 Bacteria 977
160 Ga0068856_100011736 3300005614 Bacteria 8498
161 Ga0068856_100290455 3300005614 Bacteria 1652
162 Ga0068852_100013294 3300005616 Bacteria 6296
163 Ga0068852_100051429 3300005616 Bacteria 3535
164 Ga0068852_100364779 3300005616 Bacteria 1414
165 Ga0068859_100000256 3300005617 Bacteria 52870
166 Ga0068859_100014519 3300005617 Bacteria 7909
167 Ga0068864_100001091 3300005618 Bacteria 22748
168 Ga0068864_100001437 3300005618 Bacteria 19648
169 Ga0068864_100012174 3300005618 Bacteria 7111
170 Ga0068864_100012452 3300005618 Bacteria 7033
171 Ga0068861_100000799 3300005719 Bacteria 18980
172 Ga0068861_100004837 3300005719 Bacteria 9057
173 Ga0068851_10019383 3300005834 Bacteria 3286
174 Ga0068851_10159714 3300005834 Bacteria 1237
175 Ga0068863_100000028 3300005841 Bacteria 181662
176 Ga0068863_100005179 3300005841 Bacteria 12862
177 Ga0068863_100009700 3300005841 Bacteria 9393
178 Ga0068863_100203058 3300005841 Bacteria 1907
179 Ga0068858_100000181 3300005842 Bacteria 66254
180 Ga0068858_100004139 3300005842 Bacteria 14270
181 Ga0068858_100047175 3300005842 Bacteria 3994
182 Ga0068858_100869672 3300005842 Bacteria 881
183 Ga0068860_100005743 3300005843 Bacteria 12515
184 Ga0068860_100041662 3300005843 Bacteria 4386
185 Ga0068860_100579424 3300005843 Bacteria 1126
186 Ga0068862_100000310 3300005844 Bacteria 53315
187 Ga0068862_100135043 3300005844 Bacteria 2186
188 Ga0068862_100190712 3300005844 Bacteria 1844
189 Ga0075368_10000166 3300006042 Bacteria 17785
190 Ga0075363_100154936 3300006048 Bacteria 1295
191 Ga0075367_10000165 3300006178 Bacteria 20961
192 Ga0075366_10017242 3300006195 Bacteria 4154
193 Ga0097621_100495776 3300006237 Bacteria 1106
194 Ga0075370_10100655 3300006353 Bacteria 1672
195 Ga0097620_100000256 3300006931 Bacteria 52870
196 Ga0097620_100014519 3300006931 Bacteria 7909
197 Ga0105251_10023016 3300009011 Bacteria 3223
198 Ga0105251_10107027 3300009011 Bacteria 1276
199 Ga0105250_10285979 3300009092 Bacteria 710
200 Ga0105240_10023003 3300009093 Bacteria 8254
201 Ga0111539_10267250 3300009094 Bacteria 1991
202 Ga0105245_10000853 3300009098 Bacteria 27630
203 Ga0105247_10000644 3300009101 Bacteria 27956
204 Ga0105247_10618861 3300009101 Bacteria 805
205 Ga0105243_10063765 3300009148 Bacteria 2954
206 Ga0105243_10181415 3300009148 Bacteria 1831
207 Ga0105243_10281670 3300009148 Bacteria 1498
208 Ga0105241_10008572 3300009174 Bacteria 7510
209 Ga0105241_10424314 3300009174 Bacteria 1171
210 Ga0105242_10201400 3300009176 Unclassified 1768
211 Ga0105248_10020230 3300009177 Bacteria 7372
212 Ga0105248_10232476 3300009177 Bacteria 2075
213 Ga0105237_10008645 3300009545 Bacteria 11003
214 Ga0105238_10374635 3300009551 Bacteria 1414
215 Ga0105238_11127583 3300009551 Bacteria 807
216 Ga0105249_10004911 3300009553 Bacteria 11538
217 Ga0105249_10157827 3300009553 Bacteria 2189
218 Ga0105249_11754747 3300009553 Bacteria 693
219 Ga0105148_100460 3300009978 Bacteria 3824
220 Ga0157373_10003521 3300013100 Bacteria 11836
221 Ga0157373_10004059 3300013100 Bacteria 11028
222 Ga0157373_10081951 3300013100 Bacteria 2274
223 Ga0157373_10162755 3300013100 Bacteria 1570
224 Ga0157373_10164707 3300013100 Bacteria 1560
225 Ga0157373_10340048 3300013100 Bacteria 1070
226 Ga0157371_10065105 3300013102 Bacteria 2581
227 Ga0157371_10097703 3300013102 Bacteria 2082
228 Ga0157371_10102209 3300013102 Bacteria 2033
229 Ga0157371_10175356 3300013102 Bacteria 1533
230 Ga0157371_10236991 3300013102 Bacteria 1312
231 Ga0157371_10416884 3300013102 Bacteria 984
232 Ga0157370_10053517 3300013104 Bacteria 3849
233 Ga0157370_10261661 3300013104 Bacteria 1599
234 Ga0157370_10393871 3300013104 Bacteria 1275
235 Ga0157369_10005483 3300013105 Bacteria 14744
236 Ga0157369_10008669 3300013105 Bacteria 11658
237 Ga0157369_10020246 3300013105 Bacteria 7437
238 Ga0157369_10068610 3300013105 Bacteria 3810
239 Ga0157369_10102893 3300013105 Bacteria 3042
240 Ga0157369_10217589 3300013105 Bacteria 2000
241 Ga0157374_10113648 3300013296 Bacteria 2606
242 Ga0157374_10538032 3300013296 Bacteria 1175
243 Ga0157378_10040072 3300013297 Bacteria 4154
244 Ga0157378_10081723 3300013297 Bacteria 2920
245 Ga0157378_10837975 3300013297 Bacteria 947
246 Ga0163162_10035439 3300013306 Bacteria 4971
247 Ga0163162_10041138 3300013306 Bacteria 4623
248 Ga0163162_10363831 3300013306 Bacteria 1579
249 Ga0163162_10383996 3300013306 Bacteria 1538
250 Ga0157372_10182330 3300013307 Bacteria 2431
251 Ga0157372_10202554 3300013307 Bacteria 2299
252 Ga0157372_11846898 3300013307 Bacteria 695
253 Ga0157372_12518700 3300013307 Bacteria 591
254 Ga0163163_10080992 3300014325 Bacteria 3248
255 Ga0163163_10082591 3300014325 Bacteria 3217
256 Ga0163163_10151215 3300014325 Bacteria 2365
257 Ga0157380_10001163 3300014326 Bacteria 17048
258 Ga0157380_10104065 3300014326 Bacteria 2370
259 Ga0182008_10288782 3300014497 Bacteria 855
260 Ga0157379_10081986 3300014968 Bacteria 2890
261 Ga0157379_10308399 3300014968 Bacteria 1443
262 Ga0183363_1007 3300015690 Bacteria 315687
263 Ga0163161_10009743 3300017792 Bacteria 6657
264 Ga0163161_10034019 3300017792 Bacteria 3644
265 Ga0213873_10000007 3300021358 Bacteria 309961
266 Ga0213873_10027588 3300021358 Bacteria 1386
267 Ga0213872_10126432 3300021361 Bacteria 1128
268 Ga0213876_10000005 3300021384 Bacteria 727326
269 Ga0213871_10003839 3300021441 Bacteria 2946
270 Ga0207672_1005086 3300025223 Bacteria 746
271 Ga0209437_101961 3300025233 Bacteria 4266
272 Ga0207425_1000049 3300025245 Bacteria 180735
273 Ga0209148_1026487 3300025254 Bacteria 899
274 Ga0209129_1004041 3300025258 Bacteria 5987
275 Ga0209233_1000084 3300025261 Bacteria 335222
276 Ga0209565_1000170 3300025263 Bacteria 84580
277 Ga0209673_1006861 3300025273 Bacteria 5398
278 Ga0209676_1004023 3300025292 Bacteria 8468
279 Ga0209025_1000068 3300025294 Bacteria 294129
280 Ga0209564_1000733 3300025295 Bacteria 46758
281 Ga0209758_1000019 3300025297 Bacteria 743682
282 Ga0209050_1000001 3300025298 Bacteria 3563507
283 Ga0209050_1000108 3300025298 Bacteria 222534
284 Ga0209050_1034129 3300025298 Bacteria 1529
285 Ga0209051_1000239 3300025303 Bacteria 92575
286 Ga0209257_1001303 3300025304 Bacteria 30370
287 Ga0209257_1001609 3300025304 Bacteria 25860
288 Ga0207697_10000419 3300025315 Bacteria 24002
289 Ga0207697_10008882 3300025315 Bacteria 4369
290 Ga0207697_10066668 3300025315 Bacteria 1504
291 Ga0207656_10014744 3300025321 Bacteria 3018
292 Ga0207713_1078990 3300025735 Bacteria 1189
293 Ga0207682_10003154 3300025893 Bacteria 7222
294 Ga0207682_10329151 3300025893 Bacteria 718
295 Ga0207710_10000700 3300025900 Bacteria 18794
296 Ga0207688_10117503 3300025901 Bacteria 1549
297 Ga0207680_10000481 3300025903 Bacteria 18900
298 Ga0207680_10052317 3300025903 Bacteria 2446
299 Ga0207647_10000848 3300025904 Bacteria 23724
300 Ga0207647_10002965 3300025904 Bacteria 12768
301 Ga0207647_10019937 3300025904 Bacteria 4503
302 Ga0207647_10351267 3300025904 Bacteria 835
303 Ga0207705_10057951 3300025909 Bacteria 2795
304 Ga0207705_10092403 3300025909 Bacteria 2217
305 Ga0207705_10103351 3300025909 Bacteria 2099
306 Ga0207705_10131355 3300025909 Bacteria 1864
307 Ga0207705_10140325 3300025909 Bacteria 1804
308 Ga0207705_10185314 3300025909 Bacteria 1572
309 Ga0207705_10246306 3300025909 Bacteria 1362
310 Ga0207705_10372644 3300025909 Bacteria 1102
311 Ga0207705_11095867 3300025909 Bacteria 613
312 Ga0207684_10215440 3300025910 Bacteria 1657
313 Ga0207654_10055457 3300025911 Bacteria 2295
314 Ga0207654_10155086 3300025911 Bacteria 1474
315 Ga0207707_10106419 3300025912 Bacteria 2452
316 Ga0207707_10173424 3300025912 Bacteria 1884
317 Ga0207707_10246896 3300025912 Bacteria 1551
318 Ga0207707_10401112 3300025912 Bacteria 1177
319 Ga0207695_10018286 3300025913 Bacteria 8108
320 Ga0207695_10029118 3300025913 Bacteria 6110
321 Ga0207671_10012474 3300025914 Bacteria 6828
322 Ga0207660_10002430 3300025917 Bacteria 12233
323 Ga0207660_10492475 3300025917 Bacteria 994
324 Ga0207660_10617513 3300025917 Bacteria 883
325 Ga0207657_10008341 3300025919 Bacteria 10530
326 Ga0207657_10013974 3300025919 Bacteria 7855
327 Ga0207657_10031828 3300025919 Bacteria 4771
328 Ga0207657_10073222 3300025919 Bacteria 2896
329 Ga0207657_10085802 3300025919 Bacteria 2636
330 Ga0207657_10225535 3300025919 Bacteria 1500
331 Ga0207657_10240989 3300025919 Bacteria 1444
332 Ga0207657_11206075 3300025919 Bacteria 575
333 Ga0207649_10000393 3300025920 Bacteria 32808
334 Ga0207649_10388117 3300025920 Bacteria 1042
335 Ga0207652_10000004 3300025921 Bacteria 436303
336 Ga0207652_10064277 3300025921 Bacteria 3175
337 Ga0207652_10144292 3300025921 Bacteria 2130
338 Ga0207652_10473307 3300025921 Bacteria 1128
339 Ga0207652_10578512 3300025921 Bacteria 1008
340 Ga0207681_10000004 3300025923 Bacteria 559005
341 Ga0207681_10003633 3300025923 Bacteria 9591
342 Ga0207681_10057830 3300025923 Bacteria 2652
343 Ga0207681_10067961 3300025923 Bacteria 2473
344 Ga0207681_10127025 3300025923 Bacteria 1879
345 Ga0207681_10330869 3300025923 Bacteria 1214
346 Ga0207694_10003601 3300025924 Bacteria 12274
347 Ga0207694_10141633 3300025924 Bacteria 1934
348 Ga0207694_10365311 3300025924 Bacteria 1196
349 Ga0207650_10002357 3300025925 Bacteria 13129
350 Ga0207650_10003090 3300025925 Bacteria 11462
351 Ga0207650_10049939 3300025925 Bacteria 3091
352 Ga0207650_10230002 3300025925 Bacteria 1495
353 Ga0207659_10002277 3300025926 Bacteria 11433
354 Ga0207687_10003237 3300025927 Bacteria 11034
355 Ga0207644_10000009 3300025931 Bacteria 251643
356 Ga0207644_10141096 3300025931 Bacteria 1855
357 Ga0207690_10067960 3300025932 Bacteria 2446
358 Ga0207690_10102309 3300025932 Bacteria 2048
359 Ga0207690_10174708 3300025932 Bacteria 1612
360 Ga0207690_10479921 3300025932 Bacteria 1003
361 Ga0207690_10756158 3300025932 Bacteria 801
362 Ga0207706_10001776 3300025933 Bacteria 21179
363 Ga0207706_10002422 3300025933 Bacteria 18208
364 Ga0207706_10009419 3300025933 Bacteria 8966
365 Ga0207706_10053926 3300025933 Bacteria 3549
366 Ga0207706_10111158 3300025933 Bacteria 2410
367 Ga0207686_10738817 3300025934 Unclassified 785
368 Ga0207709_10045384 3300025935 Bacteria 2661
369 Ga0207709_10097896 3300025935 Bacteria 1933
370 Ga0207691_10024273 3300025940 Bacteria 5702
371 Ga0207711_10011481 3300025941 Bacteria 7363
372 Ga0207661_10311270 3300025944 Bacteria 1414
373 Ga0207679_10102831 3300025945 Bacteria 2238
374 Ga0207679_10155985 3300025945 Bacteria 1864
375 Ga0207667_10087995 3300025949 Bacteria 3212
376 Ga0207667_10181620 3300025949 Bacteria 2160
377 Ga0207667_10467109 3300025949 Bacteria 1281
378 Ga0207667_10713898 3300025949 Bacteria 1004
379 Ga0207651_10017718 3300025960 Bacteria 4215
380 Ga0207712_10019312 3300025961 Bacteria 4449
381 Ga0207712_10041519 3300025961 Bacteria 3162
382 Ga0207668_10000047 3300025972 Bacteria 101453
383 Ga0207668_10001399 3300025972 Bacteria 14213
384 Ga0207668_10062258 3300025972 Bacteria 2627
385 Ga0207668_10110957 3300025972 Bacteria 2058
386 Ga0207668_10154373 3300025972 Bacteria 1781
387 Ga0207668_10326348 3300025972 Bacteria 1275
388 Ga0207640_10003418 3300025981 Bacteria 8550
389 Ga0207640_10015151 3300025981 Bacteria 4456
390 Ga0207640_10053669 3300025981 Bacteria 2632
391 Ga0207658_10000057 3300025986 Bacteria 124003
392 Ga0207658_10002888 3300025986 Bacteria 12319
393 Ga0207703_10000135 3300026035 Bacteria 89779
394 Ga0207703_10006420 3300026035 Bacteria 9398
395 Ga0207639_10000323 3300026041 Bacteria 33257
396 Ga0207639_10017444 3300026041 Bacteria 5090
397 Ga0207639_10057207 3300026041 Bacteria 2993
398 Ga0207639_10070294 3300026041 Bacteria 2734
399 Ga0207639_10445859 3300026041 Bacteria 1174
400 Ga0207639_10908420 3300026041 Bacteria 823
401 Ga0207678_10000068 3300026067 Bacteria 81610
402 Ga0207678_10008727 3300026067 Bacteria 8925
403 Ga0207678_10076194 3300026067 Bacteria 2873
404 Ga0207678_10181976 3300026067 Bacteria 1795
405 Ga0207678_10801019 3300026067 Bacteria 832
406 Ga0207708_10111841 3300026075 Bacteria 2121
407 Ga0207702_10008576 3300026078 Bacteria 8617
408 Ga0207702_10658268 3300026078 Bacteria 1030
409 Ga0207702_11833888 3300026078 Bacteria 598
410 Ga0207641_10000014 3300026088 Bacteria 336170
411 Ga0207641_10000277 3300026088 Bacteria 64441
412 Ga0207641_10016289 3300026088 Bacteria 6087
413 Ga0207648_10072221 3300026089 Bacteria 3008
414 Ga0207648_10197422 3300026089 Bacteria 1784
415 Ga0207676_10000532 3300026095 Bacteria 31972
416 Ga0207676_10000600 3300026095 Bacteria 29522
417 Ga0207676_10001074 3300026095 Bacteria 20774
418 Ga0207676_10467989 3300026095 Bacteria 1191
419 Ga0207674_10022118 3300026116 Bacteria 6834
420 Ga0207674_10048226 3300026116 Bacteria 4360
421 Ga0207674_10063538 3300026116 Bacteria 3727
422 Ga0207674_10295080 3300026116 Bacteria 1570
423 Ga0207674_11407119 3300026116 Bacteria 667
424 Ga0207674_11407120 3300026116 Bacteria 667
425 Ga0207675_100000740 3300026118 Bacteria 32427
426 Ga0207675_100003945 3300026118 Bacteria 14400
427 Ga0207675_100423211 3300026118 Bacteria 1316
428 Ga0207683_10008377 3300026121 Bacteria 8843
429 Ga0207698_10016480 3300026142 Bacteria 4982
430 Ga0207698_10051137 3300026142 Bacteria 3157
431 Ga0207698_10083226 3300026142 Bacteria 2589
432 Ga0207698_10176048 3300026142 Bacteria 1889
433 Ga0207698_10398497 3300026142 Bacteria 1315
434 Ga0209813_10000062 3300027866 Bacteria 43852
435 Ga0209974_10030433 3300027876 Bacteria 1789
436 Ga0207428_10487573 3300027907 Bacteria 896
437 Ga0268266_10000002 3300028379 Bacteria 3059047
438 Ga0268266_10193219 3300028379 Bacteria 1859
439 Ga0268266_10226630 3300028379 Bacteria 1720
440 Ga0268266_10415806 3300028379 Bacteria 1274
441 Ga0268266_10632788 3300028379 Bacteria 1029
442 Ga0268265_10001269 3300028380 Bacteria 21775
443 Ga0268265_10008180 3300028380 Bacteria 7066
444 Ga0268265_10160681 3300028380 Bacteria 1908
445 Ga0268264_10000069 3300028381 Bacteria 270492
446 Ga0268264_10004744 3300028381 Bacteria 11545
447 Ga0268264_10516537 3300028381 Bacteria 1167
448 Ga0307513_10030103 3300031456 Bacteria 6172
449 Ga0307408_100001959 3300031548 Bacteria 14887
450 Ga0307408_100008912 3300031548 Bacteria 6630
451 Ga0307408_100018443 3300031548 Bacteria 4684
452 Ga0307508_10001350 3300031616 Bacteria 27688
453 Ga0307405_10005480 3300031731 Bacteria 6125
454 Ga0307405_10346769 3300031731 Bacteria 1144
455 Ga0307405_10942180 3300031731 Bacteria 733
456 Ga0307413_10018804 3300031824 Bacteria 3634
457 Ga0307413_10058402 3300031824 Bacteria 2364
458 Ga0307413_10158299 3300031824 Bacteria 1588
459 Ga0307410_10002493 3300031852 Bacteria 8895
460 Ga0307410_10006448 3300031852 Bacteria 6334
461 Ga0307410_10014471 3300031852 Bacteria 4643
462 Ga0307406_10281262 3300031901 Bacteria 1269
463 Ga0307406_10412255 3300031901 Bacteria 1074
464 Ga0307406_10663458 3300031901 Bacteria 867
465 Ga0307407_10011510 3300031903 Bacteria 4214
466 Ga0307407_10084793 3300031903 Bacteria 1926
467 Ga0307407_10321260 3300031903 Bacteria 1086
468 Ga0307412_10054477 3300031911 Bacteria 2655
469 Ga0307412_10057889 3300031911 Bacteria 2589
470 Ga0307412_10612831 3300031911 Bacteria 923
471 Ga0307412_10979349 3300031911 Bacteria 746
472 Ga0307412_11213228 3300031911 Bacteria 676
473 Ga0307409_100001956 3300031995 Bacteria 10535
474 Ga0307409_100134104 3300031995 Bacteria 2121
475 Ga0307409_100737894 3300031995 Bacteria 987
476 Ga0307416_100006877 3300032002 Bacteria 7160
477 Ga0307416_100067191 3300032002 Bacteria 2955
478 Ga0307416_100126467 3300032002 Bacteria 2290
479 Ga0307416_100163788 3300032002 Bacteria 2059
480 Ga0307416_100283559 3300032002 Bacteria 1635
481 Ga0307416_102348288 3300032002 Bacteria 633
482 Ga0307414_10005096 3300032004 Bacteria 7204
483 Ga0307414_10022674 3300032004 Bacteria 3966
484 Ga0307414_10130704 3300032004 Bacteria 1949
485 Ga0307414_10182960 3300032004 Bacteria 1687
486 Ga0307414_10268528 3300032004 Bacteria 1427
487 Ga0307414_10361270 3300032004 Bacteria 1249
488 Ga0307414_10369404 3300032004 Bacteria 1237
489 Ga0307414_11249543 3300032004 Bacteria 688
490 Ga0307411_10003049 3300032005 Bacteria 7653
491 Ga0307411_10033420 3300032005 Bacteria 3190
492 Ga0307411_10033422 3300032005 Bacteria 3190
493 Ga0307415_100031294 3300032126 Bacteria 3426
494 Ga0307415_100058462 3300032126 Bacteria 2655
495 Ga0307415_100160374 3300032126 Bacteria 1742
496 Ga0373923_0264169 3300035111 Bacteria 808
497 Ga0373935_0011883 3300035692 Bacteria 5231
498 Ga0373927_0618172 3300035695 Bacteria 716
499 Ga0373937_0300059 3300036401 Bacteria 1518
500 Ga0395899_0018782 3300037312 Bacteria 5252
501 Ga0395899_0158379 3300037312 Bacteria 1601
502 Ga0395899_0250521 3300037312 Bacteria 1215
503 Ga0395899_0401583 3300037312 Bacteria 907
504 Ga0395900_0000764 3300037418 Bacteria 42836
505 Ga0395900_0019021 3300037418 Bacteria 7004
506 Ga0395900_0020505 3300037418 Bacteria 6748
507 Ga0395900_0237976 3300037418 Bacteria 1827
508 Ga0395900_0525565 3300037418 Bacteria 1130
509 Ga0395900_0782442 3300037418 Bacteria 883
510 Ga0395898_0056692 3300037466 Bacteria 3819
511 Ga0395898_0081863 3300037466 Bacteria 3112
512 Ga0395898_0728105 3300037466 Bacteria 933
513 Ga0395898_1833019 3300037466 Bacteria 527
514 Ga0395905_0003045 3300037471 Bacteria 18153
515 Ga0395905_0021583 3300037471 Bacteria 6088
516 Ga0395905_0026680 3300037471 Bacteria 5447
517 Ga0395905_0026966 3300037471 Bacteria 5418
518 Ga0395905_0061435 3300037471 Bacteria 3515
519 Ga0395905_0119628 3300037471 Bacteria 2475
520 Ga0395905_0151993 3300037471 Bacteria 2178
521 Ga0395905_0201402 3300037471 Bacteria 1866
522 Ga0395905_0228802 3300037471 Bacteria 1739
523 Ga0395905_0422179 3300037471 Bacteria 1230
524 Ga0395905_0893439 3300037471 Bacteria 791
525 Ga0395905_1430114 3300037471 Bacteria 596
526 Ga0436364_0783469 3300037853 Bacteria 845
527 Ga0436364_1376076 3300037853 Bacteria 696
528 Ga0436364_1549875 3300037853 Bacteria 1560
529 Ga0395901_0008085 3300038443 Bacteria 10626
530 Ga0395901_0009829 3300038443 Bacteria 9698
531 Ga0395901_0011906 3300038443 Bacteria 8821
532 Ga0395901_0167230 3300038443 Bacteria 2308
533 Ga0395901_0180614 3300038443 Bacteria 2213
534 Ga0395901_0557676 3300038443 Bacteria 1160
535 Ga0395901_0573348 3300038443 Bacteria 1141
536 Ga0436365_0176211 3300039437 Bacteria 57194
537 Ga0436365_0862951 3300039437 Bacteria 1103
538 Ga0436365_1643344 3300039437 Bacteria 707
539 Ga0436360_1357732 3300039438 Bacteria 2661
540 Ga0436361_0580849 3300039447 Bacteria 1018
541 Ga0436361_1102360 3300039447 Bacteria 3934
542 Ga0436363_0689652 3300039450 Bacteria 689
543 Ga0436363_1450113 3300039450 Bacteria 858
544 Ga0436362_0386479 3300039453 Bacteria 885
545 Ga0436362_0945445 3300039453 Bacteria 4337
546 Ga0436362_0976836 3300039453 Bacteria 135942
547 Ga0439448_0002960 3300042005 Bacteria 4660
548 Ga0466966_0001337 3300044684 Bacteria 15828
549 Ga0466963_0277001 3300044694 Bacteria 1179
550 Ga0495617_041834 3300046452 Bacteria 1531
551 Ga0495627_000584 3300046453 Bacteria 29144
552 Ga0495627_000871 3300046453 Bacteria 21374
553 Ga0495627_062907 3300046453 Bacteria 1095
554 Ga0495627_088423 3300046453 Bacteria 892
555 Ga0495638_0055240 3300046460 Bacteria 2466
556 Ga0495638_0247843 3300046460 Bacteria 983
557 Ga0495584_0322376 3300046491 Bacteria 785
558 Ga0495585_0182581 3300046492 Bacteria 1078
559 Ga0495585_0280224 3300046492 Bacteria 824
560 Ga0495596_0045487 3300046500 Bacteria 1726
561 Ga0495610_0000186 3300046512 Bacteria 69408
562 Ga0495610_0017207 3300046512 Bacteria 4127
563 Ga0495616_0000182 3300046513 Bacteria 53346
564 Ga0495632_0001056 3300046519 Bacteria 23635
565 Ga0495637_0018088 3300046520 Bacteria 3272
566 Ga0495637_0020325 3300046520 Bacteria 3057
567 Ga0495643_0000146 3300046522 Bacteria 114508
568 Ga0495648_0004271 3300046524 Bacteria 12254
569 Ga0495648_0113632 3300046524 Bacteria 1468
570 Ga0495648_0217601 3300046524 Bacteria 944
571 Ga0495663_0000006 3300046525 Bacteria 306938
572 Ga0495663_0083488 3300046525 Bacteria 1032
573 Ga0495598_0013638 3300046537 Bacteria 2019
574 Ga0495621_0001565 3300046539 Bacteria 5962
575 Ga0495633_0000192 3300046558 Bacteria 78563
576 Ga0495633_0001161 3300046558 Bacteria 21140
577 Ga0495633_0020434 3300046558 Bacteria 3330
578 Ga0495633_0039310 3300046558 Bacteria 2258
579 Ga0495668_0016769 3300046616 Bacteria 4257
580 Ga0495625_0000107 3300046660 Bacteria 125777
581 Ga0495625_0377657 3300046660 Bacteria 890
582 Ga0495659_0010552 3300046664 Bacteria 2967
583 Ga0495670_0007711 3300046691 Bacteria 5293
584 Ga0495671_0000100 3300046692 Bacteria 78876
585 Ga0495677_0046050 3300047445 Bacteria 1601
586 Ga0495681_0001332 3300047470 Bacteria 18673
587 Ga0495681_0034366 3300047470 Bacteria 2527
588 Ga0495686_0000513 3300047472 Bacteria 56005
589 Ga0495686_0032568 3300047472 Bacteria 3373
590 Ga0495686_0047524 3300047472 Bacteria 2709
591 Ga0495686_0087793 3300047472 Bacteria 1891
592 Ga0496102_0562859 3300048905 Bacteria 1063
593 Ga0496102_0631815 3300048905 Bacteria 994
594 Ga0496102_0702575 3300048905 Bacteria 934
595 Ga0496102_1326051 3300048905 Bacteria 639
596 Ga0496103_0504660 3300048906 Bacteria 774
597 Ga0496105_0325649 3300048908 Bacteria 1231
598 Ga0496107_0108645 3300048910 Bacteria 2037
599 Ga0496108_0000914 3300048911 Bacteria 22971
600 Ga0496109_0051693 3300048912 Bacteria 3743
601 Ga0496110_0045756 3300048913 Bacteria 3826
602 Ga0496110_0057006 3300048913 Bacteria 3438
603 Ga0496110_0489587 3300048913 Bacteria 1120
604 Ga0496111_0139718 3300048914 Bacteria 1795
605 Ga0496113_0194112 3300048916 Bacteria 1612
606 Ga0496114_0000206 3300048917 Bacteria 42865
607 Ga0496115_0001013 3300048918 Bacteria 20385
608 Ga0496115_0429820 3300048918 Bacteria 1069
609 Ga0496116_0019717 3300048919 Bacteria 5155
610 Ga0496116_0047570 3300048919 Bacteria 2886
611 Ga0496117_0030704 3300048920 Bacteria 4117
612 Ga0496119_0025551 3300048922 Bacteria 4121
613 Ga0496120_0146262 3300048923 Bacteria 1193
614 Ga0496121_0000189 3300048924 Bacteria 137827
615 Ga0496121_0003303 3300048924 Bacteria 23154
616 Ga0496121_0035146 3300048924 Bacteria 4495
617 Ga0496122_0125665 3300048925 Bacteria 1642
618 Ga0496123_0019732 3300048926 Bacteria 5303
619 Ga0496123_0070113 3300048926 Bacteria 2196
620 Ga0496124_0029380 3300048927 Bacteria 4899
621 Ga0496124_0060805 3300048927 Bacteria 3168
622 Ga0496124_0196213 3300048927 Bacteria 1540
623 Ga0496124_0225022 3300048927 Bacteria 1407
624 Ga0496125_0009585 3300048928 Bacteria 9911
625 Ga0496125_0035550 3300048928 Bacteria 4367
626 Ga0496125_0084265 3300048928 Bacteria 2414
627 Ga0496126_0018985 3300048929 Bacteria 6789
628 Ga0496126_0829352 3300048929 Bacteria 707
629 Ga0495678_059497 3300049459 Bacteria 1440
630 Ga0501290_006651 3300049513 Bacteria 1447
631 Ga0501033_0157192 3300049570 Bacteria 1638
632 Ga0501034_0020877 3300049571 Bacteria 6685
633 Ga0501034_0344439 3300049571 Bacteria 1420
634 Ga0501037_0484270 3300049573 Bacteria 841
635 Ga0501046_0106566 3300049580 Bacteria 2145
636 Ga0501047_0235519 3300049581 Bacteria 1683
637 Ga0501070_0152544 3300049586 Bacteria 1906
638 Ga0501071_0239731 3300049587 Bacteria 1367
639 Ga0501198_020873 3300049649 Bacteria 1040
640 Ga0501211_013375 3300049658 Bacteria 816
641 Ga0501223_000036 3300049663 Bacteria 46823
642 Ga0501223_004150 3300049663 Bacteria 3121
643 Ga0501223_006069 3300049663 Bacteria 2513
644 Ga0501223_016865 3300049663 Bacteria 1442
645 Ga0501224_000001 3300049664 Bacteria 308131
646 Ga0501227_015092 3300049665 Bacteria 1724
647 Ga0501233_024940 3300049668 Bacteria 1311
648 Ga0501235_012396 3300049669 Bacteria 1875
649 Ga0501243_040218 3300049675 Bacteria 820
650 Ga0501247_006394 3300049677 Bacteria 1333
651 Ga0501256_002042 3300049685 Bacteria 1572
652 Ga0501257_000073 3300049686 Bacteria 25203
653 Ga0501225_0000037 3300049705 Bacteria 46276
654 Ga0501225_0001326 3300049705 Bacteria 7692
655 Ga0501225_0022235 3300049705 Bacteria 1751
656 Ga0501267_008201 3300049764 Bacteria 1028
657 Ga0501268_008723 3300049765 Bacteria 1543
658 Ga0501278_016981 3300049774 Bacteria 639
659 Ga0501279_012735 3300049775 Bacteria 1146
660 Ga0501280_005610 3300049776 Bacteria 1792
661 Ga0501283_035633 3300049779 Bacteria 848
662 Ga0501044_0225587 3300049823 Bacteria 1823
663 Ga0501044_0267643 3300049823 Bacteria 1646
664 Ga0501044_0484226 3300049823 Bacteria 1140
665 Ga0501044_0653431 3300049823 Bacteria 940
666 Ga0501044_1284043 3300049823 Bacteria 599
667 Ga0501226_000047 3300049853 Bacteria 54518
668 nmdc:mga03n38_326177_c1 3300050490 Bacteria 830
669 nmdc:mga0k408_202812_c1 3300050493 Bacteria 1184
670 nmdc:mga06z11_36_c1 3300050494 Bacteria 55905
671 nmdc:mga04h51_475_c1 3300050495 Bacteria 9623
672 nmdc:mga07m45_152791_c1 3300050496 Bacteria 1339
673 nmdc:mga08y16_187000_c1 3300050511 Bacteria 2149
674 Ga0500610_0418004 3300053079 Bacteria 538
675 Ga0500643_000136 3300053087 Bacteria 74292
676 Ga0500643_001250 3300053087 Bacteria 15061
677 Ga0500643_037629 3300053087 Bacteria 1439
678 Ga0500595_001051 3300053119 Bacteria 15380
679 Ga0500573_0000021 3300053140 Bacteria 159093
680 Ga0500573_0110159 3300053140 Bacteria 1541
681 Ga0500604_0004006 3300053151 Bacteria 3933
682 Ga0500616_0199798 3300053153 Bacteria 886
683 Ga0500624_000015 3300053157 Bacteria 161928
684 Ga0500624_000930 3300053157 Bacteria 6159
685 Ga0500627_0000774 3300053158 Bacteria 8513
686 Ga0500636_0102937 3300053177 Bacteria 1620
687 Ga0500645_003386 3300053730 Bacteria 6510
688 2512643921 2512564014 Bacteria 4639632
689 2600202973 2599185354 Bacteria 4398675
690 2688066608 2687453257 Bacteria 6784659
691 2778126027 2775507255 Bacteria 3945731
692 2809062871 2808606401 Bacteria 4586670
693 2809078835 2808606404 Bacteria 4652788
694 2809085895 2808606405 Bacteria 4586632
695 2880520150 2880518877 Bacteria 5012590
696 2889416005 2889415604 Bacteria 8048700
697 2919710480 2919709256 Bacteria 4318106
698 2920114608 2920107658 Bacteria 10042636
699 2928028486 2928027323 Bacteria 4382488
700 2984555938 2984555340 Bacteria 4247089
701 2984565956 2984564862 Bacteria 4339992
702 2990265889 2990265787 Bacteria 3943888
703 2993356965 2993356040 Bacteria 4247105
704 2993696320 2993693658 Bacteria 4040749
705 Ga0501033_0392407
706 SwRhRL2b_contig_158587
707 SwRhRL2b_contig_3731301
708 JGI24736J21556_1035193
709 JGI24741J21665_1019720
710 JGI24752J21851_1001534
711 JGI24740J21852_10000581
712 JGI24740J21852_10040944
713 JGI24740J21852_10082444
714 JGI24739J22299_10000556
715 JGI24739J22299_10085242
716 JGI24737J22298_10004950
717 JGI24737J22298_10018373
718 JGI24737J22298_10073671
719 JGI24735J21928_10000676
720 JGI24735J21928_10007951
721 JGI24735J21928_10010773
722 JGI24738J21930_10002503
723 JGI24749J21850_1022072
724 JGI24034J26672_10009458
725 JGI25150J39212_1000711
726 JGI25151J46595_10023430
727 JGI25165J46597_1000024
728 JGI25153J46596_10000186
729 Ga0055526_1000503
730 Ga0055536_1026934
731 Ga0055540_1003332
732 Ga0055540_1006395
733 Ga0055543_1035427
734 Ga0065704_10001990
735 Ga0065704_10004250
736 Ga0065704_10190368
737 Ga0065715_10000724
738 Ga0070658_10022607
739 Ga0070658_10135521
740 Ga0070658_10138794
741 Ga0070658_10295647
742 Ga0070658_10528128
743 Ga0070658_10779209
744 Ga0070683_100836122
745 Ga0070690_100026517
746 Ga0070670_100000964
747 Ga0070670_100001075
748 Ga0070670_100003439
749 Ga0070670_100055005
750 Ga0070670_100273307
751 Ga0070677_10000705
752 Ga0068869_100501048
753 Ga0070666_10000089
754 Ga0070666_10082589
755 Ga0070666_10111826
756 Ga0070680_100010145
757 Ga0070680_100061186
758 Ga0070680_100203329
759 Ga0070680_100381810
760 Ga0070680_100478403
761 Ga0070682_100327637
762 Ga0070682_100675763
763 Ga0068868_100088300
764 Ga0070660_100051863
765 Ga0070660_100067208
766 Ga0070660_100285692
767 Ga0070660_100635435
768 Ga0070660_100757531
769 Ga0070660_101062951
770 Ga0070660_101219995
771 Ga0070691_10454621
772 Ga0070661_100000014
773 Ga0070661_100056132
774 Ga0070661_100078489
775 Ga0070692_10006130
776 Ga0070668_100000014
777 Ga0070668_100035049
778 Ga0070668_100050210
779 Ga0070668_100078772
780 Ga0070668_100137456
781 Ga0070668_100576832
782 Ga0070669_100000024
783 Ga0070669_100003409
784 Ga0070669_100018244
785 Ga0070669_100068114
786 Ga0070669_100390569
787 Ga0070669_100525624
788 Ga0070675_100006846
789 Ga0070671_100000006
790 Ga0070671_100031481
791 Ga0070671_100051163
792 Ga0070671_100462840
793 Ga0070674_100010543
794 Ga0070673_100034866
795 Ga0070673_100038050
796 Ga0070659_100059544
797 Ga0070659_100060274
798 Ga0070659_100544125
799 Ga0070659_100862008
800 Ga0070667_100000051
801 Ga0070667_100056171
802 Ga0070667_100137672
803 Ga0070701_10088315
804 Ga0070700_100055816
805 Ga0070708_100039593
806 Ga0070663_100013235
807 Ga0070663_100095827
808 Ga0070663_100340925
809 Ga0070663_101366240
810 Ga0070678_100006580
811 Ga0070662_100001528
812 Ga0070662_100019126
813 Ga0070662_100152991
814 Ga0070662_100240976
815 Ga0070662_100477549
816 Ga0070681_10069647
817 Ga0070681_10125533
818 Ga0070681_10302567
819 Ga0070681_10304875
820 Ga0070681_10503411
821 Ga0068867_100064156
822 Ga0070706_100618422
823 Ga0070679_100000003
824 Ga0070679_100033561
825 Ga0070679_100091875
826 Ga0070679_100205183
827 Ga0070679_100262730
828 Ga0070679_101170360
829 Ga0070679_101188883
830 Ga0070684_100274879
831 Ga0070684_101284704
832 Ga0068853_100005871
833 Ga0068853_100024335
834 Ga0068853_100124119
835 Ga0068853_100235623
836 Ga0068853_100383723
837 Ga0070672_100005676
838 Ga0070686_101055559
839 Ga0070665_100000471
840 Ga0070665_100095368
841 Ga0070665_100310719
842 Ga0070665_100822401
843 Ga0070665_101837287
844 Ga0068855_100055176
845 Ga0068855_100473645
846 Ga0068855_101277420
847 Ga0070664_100061185
848 Ga0070664_100119688
849 Ga0070664_100194348
850 Ga0070664_100560586
851 Ga0068857_100005612
852 Ga0068857_100067854
853 Ga0068857_100102670
854 Ga0068857_100160563
855 Ga0068857_100693885
856 Ga0068857_101286437
857 Ga0068857_101286438
858 Ga0068854_100119433
859 Ga0068854_100176768
860 Ga0068854_100182268
861 Ga0068854_100228496
862 Ga0068854_100264883
863 Ga0068854_100552740
864 Ga0068856_100011736
865 Ga0068856_100290455
866 Ga0068852_100013294
867 Ga0068852_100051429
868 Ga0068852_100364779
869 Ga0068859_100000256
870 Ga0068859_100014519
871 Ga0068864_100001091
872 Ga0068864_100001437
873 Ga0068864_100012174
874 Ga0068864_100012452
875 Ga0068861_100000799
876 Ga0068861_100004837
877 Ga0068851_10019383
878 Ga0068851_10159714
879 Ga0068863_100000028
880 Ga0068863_100005179
881 Ga0068863_100009700
882 Ga0068863_100203058
883 Ga0068858_100000181
884 Ga0068858_100004139
885 Ga0068858_100047175
886 Ga0068858_100869672
887 Ga0068860_100005743
888 Ga0068860_100041662
889 Ga0068860_100579424
890 Ga0068862_100000310
891 Ga0068862_100135043
892 Ga0068862_100190712
893 Ga0075368_10000166
894 Ga0075363_100154936
895 Ga0075367_10000165
896 Ga0075366_10017242
897 Ga0097621_100495776
898 Ga0075370_10100655
899 Ga0097620_100000256
900 Ga0097620_100014519
901 Ga0105251_10023016
902 Ga0105251_10107027
903 Ga0105250_10285979
904 Ga0105240_10023003
905 Ga0111539_10267250
906 Ga0105245_10000853
907 Ga0105247_10000644
908 Ga0105247_10618861
909 Ga0105243_10063765
910 Ga0105243_10181415
911 Ga0105243_10281670
912 Ga0105241_10008572
913 Ga0105241_10424314
914 Ga0105242_10201400
915 Ga0105248_10020230
916 Ga0105248_10232476
917 Ga0105237_10008645
918 Ga0105238_10374635
919 Ga0105238_11127583
920 Ga0105249_10004911
921 Ga0105249_10157827
922 Ga0105249_11754747
923 Ga0105148_100460
924 Ga0157373_10003521
925 Ga0157373_10004059
926 Ga0157373_10081951
927 Ga0157373_10162755
928 Ga0157373_10164707
929 Ga0157373_10340048
930 Ga0157371_10065105
931 Ga0157371_10097703
932 Ga0157371_10102209
933 Ga0157371_10175356
934 Ga0157371_10236991
935 Ga0157371_10416884
936 Ga0157370_10053517
937 Ga0157370_10261661
938 Ga0157370_10393871
939 Ga0157369_10005483
940 Ga0157369_10008669
941 Ga0157369_10020246
942 Ga0157369_10068610
943 Ga0157369_10102893
944 Ga0157369_10217589
945 Ga0157374_10113648
946 Ga0157374_10538032
947 Ga0157378_10040072
948 Ga0157378_10081723
949 Ga0157378_10837975
950 Ga0163162_10035439
951 Ga0163162_10041138
952 Ga0163162_10363831
953 Ga0163162_10383996
954 Ga0157372_10182330
955 Ga0157372_10202554
956 Ga0157372_11846898
957 Ga0157372_12518700
958 Ga0163163_10080992
959 Ga0163163_10082591
960 Ga0163163_10151215
961 Ga0157380_10001163
962 Ga0157380_10104065
963 Ga0182008_10288782
964 Ga0157379_10081986
965 Ga0157379_10308399
966 Ga0183363_1007
967 Ga0163161_10009743
968 Ga0163161_10034019
969 Ga0213873_10000007
970 Ga0213873_10027588
971 Ga0213872_10126432
972 Ga0213876_10000005
973 Ga0213871_10003839
974 Ga0207672_1005086
975 Ga0209437_101961
976 Ga0207425_1000049
977 Ga0209148_1026487
978 Ga0209129_1004041
979 Ga0209233_1000084
980 Ga0209565_1000170
981 Ga0209673_1006861
982 Ga0209676_1004023
983 Ga0209025_1000068
984 Ga0209564_1000733
985 Ga0209758_1000019
986 Ga0209050_1000001
987 Ga0209050_1000108
988 Ga0209050_1034129
989 Ga0209051_1000239
990 Ga0209257_1001303
991 Ga0209257_1001609
992 Ga0207697_10000419
993 Ga0207697_10008882
994 Ga0207697_10066668
995 Ga0207656_10014744
996 Ga0207713_1078990
997 Ga0207682_10003154
998 Ga0207682_10329151
999 Ga0207710_10000700
1000 Ga0207688_10117503
1001 Ga0207680_10000481
1002 Ga0207680_10052317
1003 Ga0207647_10000848
1004 Ga0207647_10002965
1005 Ga0207647_10019937
1006 Ga0207647_10351267
1007 Ga0207705_10057951
1008 Ga0207705_10092403
1009 Ga0207705_10103351
1010 Ga0207705_10131355
1011 Ga0207705_10140325
1012 Ga0207705_10185314
1013 Ga0207705_10246306
1014 Ga0207705_10372644
1015 Ga0207705_11095867
1016 Ga0207684_10215440
1017 Ga0207654_10055457
1018 Ga0207654_10155086
1019 Ga0207707_10106419
1020 Ga0207707_10173424
1021 Ga0207707_10246896
1022 Ga0207707_10401112
1023 Ga0207695_10018286
1024 Ga0207695_10029118
1025 Ga0207671_10012474
1026 Ga0207660_10002430
1027 Ga0207660_10492475
1028 Ga0207660_10617513
1029 Ga0207657_10008341
1030 Ga0207657_10013974
1031 Ga0207657_10031828
1032 Ga0207657_10073222
1033 Ga0207657_10085802
1034 Ga0207657_10225535
1035 Ga0207657_10240989
1036 Ga0207657_11206075
1037 Ga0207649_10000393
1038 Ga0207649_10388117
1039 Ga0207652_10000004
1040 Ga0207652_10064277
1041 Ga0207652_10144292
1042 Ga0207652_10473307
1043 Ga0207652_10578512
1044 Ga0207681_10000004
1045 Ga0207681_10003633
1046 Ga0207681_10057830
1047 Ga0207681_10067961
1048 Ga0207681_10127025
1049 Ga0207681_10330869
1050 Ga0207694_10003601
1051 Ga0207694_10141633
1052 Ga0207694_10365311
1053 Ga0207650_10002357
1054 Ga0207650_10003090
1055 Ga0207650_10049939
1056 Ga0207650_10230002
1057 Ga0207659_10002277
1058 Ga0207687_10003237
1059 Ga0207644_10000009
1060 Ga0207644_10141096
1061 Ga0207690_10067960
1062 Ga0207690_10102309
1063 Ga0207690_10174708
1064 Ga0207690_10479921
1065 Ga0207690_10756158
1066 Ga0207706_10001776
1067 Ga0207706_10002422
1068 Ga0207706_10009419
1069 Ga0207706_10053926
1070 Ga0207706_10111158
1071 Ga0207686_10738817
1072 Ga0207709_10045384
1073 Ga0207709_10097896
1074 Ga0207691_10024273
1075 Ga0207711_10011481
1076 Ga0207661_10311270
1077 Ga0207679_10102831
1078 Ga0207679_10155985
1079 Ga0207667_10087995
1080 Ga0207667_10181620
1081 Ga0207667_10467109
1082 Ga0207667_10713898
1083 Ga0207651_10017718
1084 Ga0207712_10019312
1085 Ga0207712_10041519
1086 Ga0207668_10000047
1087 Ga0207668_10001399
1088 Ga0207668_10062258
1089 Ga0207668_10110957
1090 Ga0207668_10154373
1091 Ga0207668_10326348
1092 Ga0207640_10003418
1093 Ga0207640_10015151
1094 Ga0207640_10053669
1095 Ga0207658_10000057
1096 Ga0207658_10002888
1097 Ga0207703_10000135
1098 Ga0207703_10006420
1099 Ga0207639_10000323
1100 Ga0207639_10017444
1101 Ga0207639_10057207
1102 Ga0207639_10070294
1103 Ga0207639_10445859
1104 Ga0207639_10908420
1105 Ga0207678_10000068
1106 Ga0207678_10008727
1107 Ga0207678_10076194
1108 Ga0207678_10181976
1109 Ga0207678_10801019
1110 Ga0207708_10111841
1111 Ga0207702_10008576
1112 Ga0207702_10658268
1113 Ga0207702_11833888
1114 Ga0207641_10000014
1115 Ga0207641_10000277
1116 Ga0207641_10016289
1117 Ga0207648_10072221
1118 Ga0207648_10197422
1119 Ga0207676_10000532
1120 Ga0207676_10000600
1121 Ga0207676_10001074
1122 Ga0207676_10467989
1123 Ga0207674_10022118
1124 Ga0207674_10048226
1125 Ga0207674_10063538
1126 Ga0207674_10295080
1127 Ga0207674_11407119
1128 Ga0207674_11407120
1129 Ga0207675_100000740
1130 Ga0207675_100003945
1131 Ga0207675_100423211
1132 Ga0207683_10008377
1133 Ga0207698_10016480
1134 Ga0207698_10051137
1135 Ga0207698_10083226
1136 Ga0207698_10176048
1137 Ga0207698_10398497
1138 Ga0209813_10000062
1139 Ga0209974_10030433
1140 Ga0207428_10487573
1141 Ga0268266_10000002
1142 Ga0268266_10193219
1143 Ga0268266_10226630
1144 Ga0268266_10415806
1145 Ga0268266_10632788
1146 Ga0268265_10001269
1147 Ga0268265_10008180
1148 Ga0268265_10160681
1149 Ga0268264_10000069
1150 Ga0268264_10004744
1151 Ga0268264_10516537
1152 Ga0307513_10030103
1153 Ga0307408_100001959
1154 Ga0307408_100008912
1155 Ga0307408_100018443
1156 Ga0307508_10001350
1157 Ga0307405_10005480
1158 Ga0307405_10346769
1159 Ga0307405_10942180
1160 Ga0307413_10018804
1161 Ga0307413_10058402
1162 Ga0307413_10158299
1163 Ga0307410_10002493
1164 Ga0307410_10006448
1165 Ga0307410_10014471
1166 Ga0307406_10281262
1167 Ga0307406_10412255
1168 Ga0307406_10663458
1169 Ga0307407_10011510
1170 Ga0307407_10084793
1171 Ga0307407_10321260
1172 Ga0307412_10054477
1173 Ga0307412_10057889
1174 Ga0307412_10612831
1175 Ga0307412_10979349
1176 Ga0307412_11213228
1177 Ga0307409_100001956
1178 Ga0307409_100134104
1179 Ga0307409_100737894
1180 Ga0307416_100006877
1181 Ga0307416_100067191
1182 Ga0307416_100126467
1183 Ga0307416_100163788
1184 Ga0307416_100283559
1185 Ga0307416_102348288
1186 Ga0307414_10005096
1187 Ga0307414_10022674
1188 Ga0307414_10130704
1189 Ga0307414_10182960
1190 Ga0307414_10268528
1191 Ga0307414_10361270
1192 Ga0307414_10369404
1193 Ga0307414_11249543
1194 Ga0307411_10003049
1195 Ga0307411_10033420
1196 Ga0307411_10033422
1197 Ga0307415_100031294
1198 Ga0307415_100058462
1199 Ga0307415_100160374
1200 Ga0373923_0264169
1201 Ga0373935_0011883
1202 Ga0373927_0618172
1203 Ga0373937_0300059
1204 Ga0395899_0018782
1205 Ga0395899_0158379
1206 Ga0395899_0250521
1207 Ga0395899_0401583
1208 Ga0395900_0000764
1209 Ga0395900_0019021
1210 Ga0395900_0020505
1211 Ga0395900_0237976
1212 Ga0395900_0525565
1213 Ga0395900_0782442
1214 Ga0395898_0056692
1215 Ga0395898_0081863
1216 Ga0395898_0728105
1217 Ga0395898_1833019
1218 Ga0395905_0003045
1219 Ga0395905_0021583
1220 Ga0395905_0026680
1221 Ga0395905_0026966
1222 Ga0395905_0061435
1223 Ga0395905_0119628
1224 Ga0395905_0151993
1225 Ga0395905_0201402
1226 Ga0395905_0228802
1227 Ga0395905_0422179
1228 Ga0395905_0893439
1229 Ga0395905_1430114
1230 Ga0436364_0783469
1231 Ga0436364_1376076
1232 Ga0436364_1549875
1233 Ga0395901_0008085
1234 Ga0395901_0009829
1235 Ga0395901_0011906
1236 Ga0395901_0167230
1237 Ga0395901_0180614
1238 Ga0395901_0557676
1239 Ga0395901_0573348
1240 Ga0436365_0176211
1241 Ga0436365_0862951
1242 Ga0436365_1643344
1243 Ga0436360_1357732
1244 Ga0436361_0580849
1245 Ga0436361_1102360
1246 Ga0436363_0689652
1247 Ga0436363_1450113
1248 Ga0436362_0386479
1249 Ga0436362_0945445
1250 Ga0436362_0976836
1251 Ga0439448_0002960
1252 Ga0466966_0001337
1253 Ga0466963_0277001
1254 Ga0495617_041834
1255 Ga0495627_000584
1256 Ga0495627_000871
1257 Ga0495627_062907
1258 Ga0495627_088423
1259 Ga0495638_0055240
1260 Ga0495638_0247843
1261 Ga0495584_0322376
1262 Ga0495585_0182581
1263 Ga0495585_0280224
1264 Ga0495596_0045487
1265 Ga0495610_0000186
1266 Ga0495610_0017207
1267 Ga0495616_0000182
1268 Ga0495632_0001056
1269 Ga0495637_0018088
1270 Ga0495637_0020325
1271 Ga0495643_0000146
1272 Ga0495648_0004271
1273 Ga0495648_0113632
1274 Ga0495648_0217601
1275 Ga0495663_0000006
1276 Ga0495663_0083488
1277 Ga0495598_0013638
1278 Ga0495621_0001565
1279 Ga0495633_0000192
1280 Ga0495633_0001161
1281 Ga0495633_0020434
1282 Ga0495633_0039310
1283 Ga0495668_0016769
1284 Ga0495625_0000107
1285 Ga0495625_0377657
1286 Ga0495659_0010552
1287 Ga0495670_0007711
1288 Ga0495671_0000100
1289 Ga0495677_0046050
1290 Ga0495681_0001332
1291 Ga0495681_0034366
1292 Ga0495686_0000513
1293 Ga0495686_0032568
1294 Ga0495686_0047524
1295 Ga0495686_0087793
1296 Ga0496102_0562859
1297 Ga0496102_0631815
1298 Ga0496102_0702575
1299 Ga0496102_1326051
1300 Ga0496103_0504660
1301 Ga0496105_0325649
1302 Ga0496107_0108645
1303 Ga0496108_0000914
1304 Ga0496109_0051693
1305 Ga0496110_0045756
1306 Ga0496110_0057006
1307 Ga0496110_0489587
1308 Ga0496111_0139718
1309 Ga0496113_0194112
1310 Ga0496114_0000206
1311 Ga0496115_0001013
1312 Ga0496115_0429820
1313 Ga0496116_0019717
1314 Ga0496116_0047570
1315 Ga0496117_0030704
1316 Ga0496119_0025551
1317 Ga0496120_0146262
1318 Ga0496121_0000189
1319 Ga0496121_0003303
1320 Ga0496121_0035146
1321 Ga0496122_0125665
1322 Ga0496123_0019732
1323 Ga0496123_0070113
1324 Ga0496124_0029380
1325 Ga0496124_0060805
1326 Ga0496124_0196213
1327 Ga0496124_0225022
1328 Ga0496125_0009585
1329 Ga0496125_0035550
1330 Ga0496125_0084265
1331 Ga0496126_0018985
1332 Ga0496126_0829352
1333 Ga0495678_059497
1334 Ga0501290_006651
1335 Ga0501033_0157192
1336 Ga0501034_0020877
1337 Ga0501034_0344439
1338 Ga0501037_0484270
1339 Ga0501046_0106566
1340 Ga0501047_0235519
1341 Ga0501070_0152544
1342 Ga0501071_0239731
1343 Ga0501198_020873
1344 Ga0501211_013375
1345 Ga0501223_000036
1346 Ga0501223_004150
1347 Ga0501223_006069
1348 Ga0501223_016865
1349 Ga0501224_000001
1350 Ga0501227_015092
1351 Ga0501233_024940
1352 Ga0501235_012396
1353 Ga0501243_040218
1354 Ga0501247_006394
1355 Ga0501256_002042
1356 Ga0501257_000073
1357 Ga0501225_0000037
1358 Ga0501225_0001326
1359 Ga0501225_0022235
1360 Ga0501267_008201
1361 Ga0501268_008723
1362 Ga0501278_016981
1363 Ga0501279_012735
1364 Ga0501280_005610
1365 Ga0501283_035633
1366 Ga0501044_0225587
1367 Ga0501044_0267643
1368 Ga0501044_0484226
1369 Ga0501044_0653431
1370 Ga0501044_1284043
1371 Ga0501226_000047
1372 nmdc:mga03n38_326177_c1
1373 nmdc:mga0k408_202812_c1
1374 nmdc:mga06z11_36_c1
1375 nmdc:mga04h51_475_c1
1376 nmdc:mga07m45_152791_c1
1377 nmdc:mga08y16_187000_c1
1378 Ga0500610_0418004
1379 Ga0500643_000136
1380 Ga0500643_001250
1381 Ga0500643_037629
1382 Ga0500595_001051
1383 Ga0500573_0000021
1384 Ga0500573_0110159
1385 Ga0500604_0004006
1386 Ga0500616_0199798
1387 Ga0500624_000015
1388 Ga0500624_000930
1389 Ga0500627_0000774
1390 Ga0500636_0102937
1391 Ga0500645_003386
1392 2512643921
1393 2600202973
1394 2688066608
1395 2778126027
1396 2809062871
1397 2809078835
1398 2809085895
1399 2880520150
1400 2889416005
1401 2919710480
1402 2920114608
1403 2928028486
1404 2984555938
1405 2984565956
1406 2990265889
1407 2993356965
1408 2993696320

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

17

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9697 5 161
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9652 4 161
3nba-assembly2.cif.gz_B phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp) 0.9636 5 160
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.963 5 161
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9606 5 161
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9582 5 161 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9491 3 161 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9488 1 161 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9391 5 161 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9357 1 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7G9SKH7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9852 5 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3C0MD70-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9846 1 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0Q4CFV7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9825 21 169 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-B8GVE7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9821 5 163 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3C0YCS7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.981 3 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map