F476382

General Info

Members Datasets Scaffolds Average Seq Length
704 351 647 318

Family's Representative Sequence

Representative Sequence 3300049682|Ga0501252_002421|Ga0501252_002421_169_1218
Length 349
Sequence MQQLFNIITEACSQKISIVKSSNFQINSMSVLIFIDHTDGHIKKASLEALSYGAKVAGQTGDTAEGVILGTTNEDLGGLGQYGVKKIHQVENDSLKSFDAQAYAKVVTQVAEQTGAKVVIFSNNSSGKNIAPRVAVRLKAGLVSGAVALPDTSNGFVVKKNVFSGKAFAHVTINTEIKVIALNVNSFALNVVEGKAEVVVFNTTVDVPKTKIVSTSKTSGSISLSEAEVVVSAGRGLKGPENWAMVEELAGVLGAALACSRPVADAHWRPHNEHVGQTGIAIAPNLYIAIGISGAIQHLAGVNRSKVIVVINKDAEAPFFKAADYGIVGDAFEIVPKLTQAIKKQKGIA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
4 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
10 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
11 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
12 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
13 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
14 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
15 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
16 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
17 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
18 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
19 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
20 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
21 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
22 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
23 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
24 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
25 2738541283 Pedobacter sp. OK701 Isolate Unclassified
26 2738541284 Pedobacter sp. YR016 Isolate Unclassified
27 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
28 2738543023 Pedobacter sp. OK628 Isolate Unclassified
29 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
30 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
31 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
32 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
33 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
34 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
35 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
36 2818991444 Filimonas endophytica 3197 Isolate Unclassified
37 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
38 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
39 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
40 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
41 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
42 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
43 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
44 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
45 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
46 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
47 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
48 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
49 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
50 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
51 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
52 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
53 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
54 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
55 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
56 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
57 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
58 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
59 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
60 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
61 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
62 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
66 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
67 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
68 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
69 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
74 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
104 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
238 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
239 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
297 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
298 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
313 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
314 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
315 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
316 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
317 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
318 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
319 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
320 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
321 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
322 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
325 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
326 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
327 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
328 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
343 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
348 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
349 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
350 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.48
Metatranscriptomes 0.28
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 2.7
Nodule 0.14
Rhizoplane 0.71
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1411852 2162886007 Bacteria 14549
2 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
3 SwRhRL2b_contig_2062776 2162886007 Bacteria 1690
4 MRS1b_contig_8964951 2162886011 Bacteria 1803
5 JGI24741J21665_1006007 3300001915 Bacteria 2478
6 JGI24737J22298_10000171 3300001990 Bacteria 20929
7 JGI24735J21928_10000006 3300002067 Bacteria 339303
8 JGI25162J39368_1000180 3300002737 Bacteria 67985
9 rootH1_10084579 3300003316 Bacteria 3929
10 rootH1_10084579 3300003323 Bacteria 3180
11 rootH1_10166102 3300003316 Bacteria 2807
12 rootH2_10016295 3300003320 Bacteria 51846
13 rootH2_10196964 3300003320 Bacteria 1808
14 rootH2_10295593 3300003320 Bacteria 1861
15 rootL2_10004550 3300003322 Bacteria 2778
16 rootL2_10089539 3300003322 Bacteria 11365
17 rootL2_10138794 3300003322 Bacteria 3550
18 rootL2_10171436 3300003322 Bacteria 4725
19 rootL2_10179839 3300003322 Bacteria 2946
20 rootH1_10010249 3300003323 Bacteria 10054
21 rootH1_10044553 3300003323 Bacteria 13117
22 rootH1_10187770 3300003323 Bacteria 4696
23 rootH1_10193885 3300003323 Bacteria 1161
24 Ga0006562J51391_1004223 3300003578 Bacteria 3015
25 Ga0055534_1005024 3300003784 Bacteria 3656
26 Ga0065714_10002212 3300005288 Bacteria 56085
27 Ga0065714_10065485 3300005288 Bacteria 9793
28 Ga0065714_10070550 3300005288 Bacteria 3836
29 Ga0065714_10083187 3300005288 Bacteria 2257
30 Ga0065704_10000188 3300005289 Bacteria 267216
31 Ga0065704_10000193 3300005289 Bacteria 203271
32 Ga0065704_10079391 3300005289 Bacteria 4177
33 Ga0065704_10079664 3300005289 Bacteria 4106
34 Ga0065712_10001395 3300005290 Bacteria 7623
35 Ga0065712_10004793 3300005290 Bacteria 3813
36 Ga0065715_10104240 3300005293 Unclassified 2978
37 Ga0065707_10101916 3300005295 Bacteria 2838
38 Ga0070676_10038836 3300005328 Bacteria 2751
39 Ga0070683_100002228 3300005329 Bacteria 15359
40 Ga0070683_100006944 3300005329 Bacteria 9518
41 Ga0070683_100023606 3300005329 Bacteria 5502
42 Ga0070683_100256092 3300005329 Unclassified 1665
43 Ga0070683_100301568 3300005329 Bacteria 1524
44 Ga0070690_100027165 3300005330 Bacteria 3537
45 Ga0070690_100176209 3300005330 Bacteria 1475
46 Ga0070670_100004989 3300005331 Bacteria 11167
47 Ga0070670_100050676 3300005331 Bacteria 3567
48 Ga0070670_100076556 3300005331 Bacteria 2875
49 Ga0068869_100001288 3300005334 Bacteria 14839
50 Ga0068869_100025626 3300005334 Bacteria 4096
51 Ga0068869_100139809 3300005334 Bacteria 1869
52 Ga0070666_10111904 3300005335 Bacteria 1888
53 Ga0070682_100042657 3300005337 Bacteria 2802
54 Ga0070682_100199376 3300005337 Bacteria 1411
55 Ga0068868_100004534 3300005338 Bacteria 9749
56 Ga0068868_100038212 3300005338 Bacteria 3726
57 Ga0068868_100105694 3300005338 Bacteria 2283
58 Ga0068868_100223500 3300005338 Bacteria 1577
59 Ga0070689_100003775 3300005340 Bacteria 10144
60 Ga0070689_100034123 3300005340 Bacteria 3881
61 Ga0070689_100173822 3300005340 Bacteria 1746
62 Ga0070689_100395705 3300005340 Unclassified 1167
63 Ga0070687_100043718 3300005343 Bacteria 2278
64 Ga0070687_100056043 3300005343 Bacteria 2061
65 Ga0070661_100010109 3300005344 Bacteria 6554
66 Ga0070668_100011326 3300005347 Bacteria 6644
67 Ga0070668_100139384 3300005347 Bacteria 1953
68 Ga0070668_100217632 3300005347 Unclassified 1574
69 Ga0070669_100000874 3300005353 Bacteria 21974
70 Ga0070669_100219157 3300005353 Bacteria 1504
71 Ga0070675_100023401 3300005354 Bacteria 4939
72 Ga0070675_100040444 3300005354 Bacteria 3806
73 Ga0070675_100054876 3300005354 Bacteria 3279
74 Ga0070675_100098547 3300005354 Bacteria 2459
75 Ga0070675_100274360 3300005354 Unclassified 1480
76 Ga0070675_100455540 3300005354 Bacteria 1148
77 Ga0070674_100013146 3300005356 Bacteria 5106
78 Ga0070673_100019243 3300005364 Bacteria 4900
79 Ga0070673_100048333 3300005364 Bacteria 3316
80 Ga0070673_100280301 3300005364 Bacteria 1462
81 Ga0070688_100001369 3300005365 Bacteria 12108
82 Ga0070688_100051441 3300005365 Unclassified 2570
83 Ga0070659_100002840 3300005366 Bacteria 12323
84 Ga0070659_100013207 3300005366 Bacteria 6142
85 Ga0070667_100033888 3300005367 Bacteria 4272
86 Ga0070667_100197088 3300005367 Bacteria 1786
87 Ga0070678_100022366 3300005456 Bacteria 4188
88 Ga0070678_100135362 3300005456 Bacteria 1964
89 Ga0070662_100013466 3300005457 Bacteria 5444
90 Ga0070662_100021109 3300005457 Bacteria 4444
91 Ga0070662_100075421 3300005457 Bacteria 2497
92 Ga0070681_10006746 3300005458 Bacteria 11175
93 Ga0068867_100022653 3300005459 Bacteria 4492
94 Ga0068867_100033639 3300005459 Bacteria 3714
95 Ga0068867_100035811 3300005459 Bacteria 3601
96 Ga0068867_100080041 3300005459 Bacteria 2460
97 Ga0068867_100091658 3300005459 Bacteria 2307
98 Ga0070685_10040904 3300005466 Bacteria 2640
99 Ga0070685_10233509 3300005466 Bacteria 1211
100 Ga0070698_100000936 3300005471 Bacteria 31949
101 Ga0070698_100003346 3300005471 Bacteria 17650
102 Ga0070684_100001451 3300005535 Bacteria 17095
103 Ga0070684_100033002 3300005535 Bacteria 4417
104 Ga0068853_100001183 3300005539 Bacteria 18575
105 Ga0068853_100046722 3300005539 Bacteria 3713
106 Ga0068853_100070624 3300005539 Bacteria 3040
107 Ga0070672_100175560 3300005543 Bacteria 1783
108 Ga0070686_100014676 3300005544 Bacteria 4520
109 Ga0070686_100195727 3300005544 Bacteria 1446
110 Ga0070665_100000016 3300005548 Bacteria 451538
111 Ga0070665_100003187 3300005548 Bacteria 17651
112 Ga0070704_100219681 3300005549 Bacteria 1544
113 Ga0068855_100003016 3300005563 Bacteria 20598
114 Ga0068855_100124705 3300005563 Bacteria 2946
115 Ga0068855_100348302 3300005563 Bacteria 1632
116 Ga0068855_100587769 3300005563 Unclassified 1202
117 Ga0070664_100003972 3300005564 Bacteria 11895
118 Ga0070664_100010568 3300005564 Bacteria 7482
119 Ga0070664_100013148 3300005564 Bacteria 6739
120 Ga0070664_100124706 3300005564 Bacteria 2258
121 Ga0070664_100187689 3300005564 Bacteria 1841
122 Ga0070664_100473572 3300005564 Unclassified 1152
123 Ga0068857_100009246 3300005577 Bacteria 8549
124 Ga0068857_100058936 3300005577 Bacteria 3410
125 Ga0068857_100584040 3300005577 Bacteria 1055
126 Ga0068854_100007114 3300005578 Bacteria 7145
127 Ga0068854_100058975 3300005578 Bacteria 2772
128 Ga0068854_100073472 3300005578 Bacteria 2506
129 Ga0068854_100079315 3300005578 Bacteria 2420
130 Ga0068854_100360845 3300005578 Bacteria 1192
131 Ga0068856_100152701 3300005614 Bacteria 2318
132 Ga0068856_100260275 3300005614 Bacteria 1750
133 Ga0068856_100263112 3300005614 Bacteria 1740
134 Ga0068856_100544908 3300005614 Bacteria 1181
135 Ga0070702_100148462 3300005615 Bacteria 1502
136 Ga0068852_100005008 3300005616 Bacteria 9424
137 Ga0068852_100005930 3300005616 Bacteria 8785
138 Ga0068852_100038113 3300005616 Bacteria 4037
139 Ga0068852_100048616 3300005616 Bacteria 3625
140 Ga0068859_100050663 3300005617 Bacteria 4171
141 Ga0068859_100058045 3300005617 Bacteria 3898
142 Ga0068859_100102936 3300005617 Bacteria 2913
143 Ga0068859_100132306 3300005617 Bacteria 2566
144 Ga0068859_100166052 3300005617 Bacteria 2287
145 Ga0068859_100181666 3300005617 Bacteria 2186
146 Ga0068859_100369522 3300005617 Bacteria 1530
147 Ga0068864_100005936 3300005618 Bacteria 10014
148 Ga0068864_100057224 3300005618 Bacteria 3368
149 Ga0068864_100073871 3300005618 Unclassified 2974
150 Ga0068864_100181639 3300005618 Bacteria 1924
151 Ga0068866_10012173 3300005718 Bacteria 3745
152 Ga0068866_10017509 3300005718 Bacteria 3223
153 Ga0068861_100002657 3300005719 Bacteria 11700
154 Ga0068861_100053413 3300005719 Bacteria 3074
155 Ga0068861_100280177 3300005719 Bacteria 1435
156 Ga0068851_10060841 3300005834 Bacteria 1934
157 Ga0068870_10024468 3300005840 Unclassified 2988
158 Ga0068863_100035606 3300005841 Bacteria 4740
159 Ga0068863_100309792 3300005841 Bacteria 1532
160 Ga0068860_100000006 3300005843 Bacteria 461966
161 Ga0068860_100304548 3300005843 Bacteria 1562
162 Ga0068862_100013727 3300005844 Bacteria 6713
163 Ga0068862_100103861 3300005844 Bacteria 2489
164 Ga0068862_100269983 3300005844 Bacteria 1555
165 Ga0075366_10009372 3300006195 Bacteria 5463
166 Ga0075366_10033092 3300006195 Bacteria 3045
167 Ga0075428_100004467 3300006844 Bacteria 15439
168 Ga0075428_100045987 3300006844 Bacteria 4795
169 Ga0075428_100500532 3300006844 Bacteria 1300
170 Ga0075430_100005032 3300006846 Bacteria 11126
171 Ga0075431_100015087 3300006847 Bacteria 7824
172 Ga0075431_100018066 3300006847 Bacteria 7173
173 Ga0075433_10003668 3300006852 Bacteria 11871
174 Ga0075429_100108610 3300006880 Bacteria 2425
175 Ga0068865_100018228 3300006881 Bacteria 4528
176 Ga0068865_100405711 3300006881 Bacteria 1117
177 Ga0097620_100016642 3300006931 Bacteria 7382
178 Ga0097620_100050660 3300006931 Bacteria 4171
179 Ga0097620_100058044 3300006931 Bacteria 3898
180 Ga0097620_100102944 3300006931 Bacteria 2913
181 Ga0097620_100132315 3300006931 Bacteria 2566
182 Ga0097620_100166062 3300006931 Bacteria 2287
183 Ga0097620_100181670 3300006931 Bacteria 2186
184 Ga0097620_100369492 3300006931 Bacteria 1530
185 Ga0075435_100018506 3300007076 Bacteria 5300
186 Ga0105244_10000049 3300009036 Bacteria 140190
187 Ga0105240_10003256 3300009093 Bacteria 25386
188 Ga0105240_10010049 3300009093 Bacteria 13326
189 Ga0105240_10032954 3300009093 Bacteria 6699
190 Ga0105240_10046443 3300009093 Bacteria 5503
191 Ga0105240_10048728 3300009093 Bacteria 5352
192 Ga0105240_10079202 3300009093 Bacteria 4044
193 Ga0105240_10324552 3300009093 Bacteria 1753
194 Ga0111539_10016041 3300009094 Bacteria 9300
195 Ga0111539_10452493 3300009094 Bacteria 1495
196 Ga0105247_10014759 3300009101 Bacteria 4683
197 Ga0114129_10059718 3300009147 Bacteria 5331
198 Ga0114129_10225572 3300009147 Bacteria 2525
199 Ga0105243_10002732 3300009148 Bacteria 14670
200 Ga0105241_10256888 3300009174 Unclassified 1484
201 Ga0105242_10016107 3300009176 Bacteria 5809
202 Ga0105242_10031148 3300009176 Bacteria 4258
203 Ga0105242_10051408 3300009176 Bacteria 3358
204 Ga0105237_10002313 3300009545 Bacteria 23676
205 Ga0105237_10025406 3300009545 Bacteria 6058
206 Ga0105237_10037120 3300009545 Bacteria 4927
207 Ga0105237_10153726 3300009545 Bacteria 2297
208 Ga0105237_10164721 3300009545 Bacteria 2216
209 Ga0105238_10010139 3300009551 Bacteria 9450
210 Ga0105249_10001693 3300009553 Bacteria 19305
211 Ga0105249_10008239 3300009553 Bacteria 9076
212 Ga0105249_10048976 3300009553 Bacteria 3853
213 Ga0105249_10528850 3300009553 Bacteria 1227
214 Ga0105239_10000190 3300010375 Bacteria 89155
215 Ga0105239_10004108 3300010375 Bacteria 17496
216 Ga0105239_10128503 3300010375 Bacteria 2817
217 Ga0105239_10157001 3300010375 Bacteria 2541
218 Ga0105239_10282818 3300010375 Bacteria 1867
219 Ga0105239_10459259 3300010375 Bacteria 1445
220 Ga0105246_10058498 3300011119 Bacteria 2670
221 Ga0105246_10076639 3300011119 Bacteria 2370
222 Ga0157373_10000107 3300013100 Bacteria 65161
223 Ga0157373_10000121 3300013100 Bacteria 60158
224 Ga0157371_10000201 3300013102 Bacteria 87780
225 Ga0157371_10002317 3300013102 Bacteria 18296
226 Ga0157371_10004753 3300013102 Bacteria 11717
227 Ga0157371_10007473 3300013102 Bacteria 8844
228 Ga0157371_10013504 3300013102 Bacteria 6199
229 Ga0157371_10039565 3300013102 Bacteria 3372
230 Ga0157371_10056805 3300013102 Bacteria 2776
231 Ga0157370_10002315 3300013104 Bacteria 23062
232 Ga0157370_10005377 3300013104 Bacteria 14378
233 Ga0157370_10006844 3300013104 Bacteria 12487
234 Ga0157370_10008393 3300013104 Bacteria 11142
235 Ga0157370_10022329 3300013104 Bacteria 6296
236 Ga0157370_10029298 3300013104 Bacteria 5406
237 Ga0157370_10036657 3300013104 Bacteria 4757
238 Ga0157370_10039262 3300013104 Bacteria 4575
239 Ga0157369_10000759 3300013105 Bacteria 41636
240 Ga0157369_10047939 3300013105 Bacteria 4637
241 Ga0157374_10000411 3300013296 Bacteria 38796
242 Ga0157374_10004791 3300013296 Bacteria 11352
243 Ga0157374_10125752 3300013296 Bacteria 2478
244 Ga0157374_10228006 3300013296 Bacteria 1829
245 Ga0157374_10318835 3300013296 Bacteria 1540
246 Ga0157378_10055697 3300013297 Bacteria 3522
247 Ga0157378_10069191 3300013297 Bacteria 3166
248 Ga0157378_10073212 3300013297 Bacteria 3080
249 Ga0157378_10371451 3300013297 Unclassified 1402
250 Ga0157378_10461484 3300013297 Bacteria 1262
251 Ga0163162_10000355 3300013306 Bacteria 41762
252 Ga0163162_10009885 3300013306 Bacteria 9277
253 Ga0163162_10043246 3300013306 Bacteria 4511
254 Ga0163162_10063705 3300013306 Bacteria 3730
255 Ga0157372_10001647 3300013307 Bacteria 24243
256 Ga0157372_10002968 3300013307 Bacteria 18277
257 Ga0157372_10007563 3300013307 Bacteria 11552
258 Ga0157372_10041645 3300013307 Bacteria 5078
259 Ga0157372_10044507 3300013307 Bacteria 4919
260 Ga0157372_10093380 3300013307 Bacteria 3424
261 Ga0157372_10100160 3300013307 Bacteria 3306
262 Ga0157372_10184526 3300013307 Bacteria 2415
263 Ga0157372_10352147 3300013307 Bacteria 1715
264 Ga0157372_10504270 3300013307 Bacteria 1411
265 Ga0157375_10000759 3300013308 Bacteria 28326
266 Ga0157375_10006455 3300013308 Bacteria 10216
267 Ga0157375_10040868 3300013308 Bacteria 4474
268 Ga0157375_10071769 3300013308 Bacteria 3477
269 Ga0157375_10105335 3300013308 Bacteria 2910
270 Ga0157375_10108483 3300013308 Bacteria 2871
271 Ga0163163_10000261 3300014325 Bacteria 53342
272 Ga0163163_10024337 3300014325 Bacteria 5762
273 Ga0163163_10270258 3300014325 Bacteria 1751
274 Ga0163163_10286702 3300014325 Bacteria 1699
275 Ga0163163_10494458 3300014325 Bacteria 1285
276 Ga0157380_10000466 3300014326 Bacteria 24697
277 Ga0157380_10018714 3300014326 Bacteria 5148
278 Ga0157380_10065958 3300014326 Bacteria 2911
279 Ga0157380_10208958 3300014326 Bacteria 1738
280 Ga0182008_10000011 3300014497 Bacteria 297770
281 Ga0182008_10000018 3300014497 Bacteria 230609
282 Ga0182008_10000378 3300014497 Bacteria 34433
283 Ga0182008_10009150 3300014497 Bacteria 5360
284 Ga0157377_10002452 3300014745 Bacteria 8203
285 Ga0157377_10128308 3300014745 Bacteria 1545
286 Ga0157379_10047163 3300014968 Bacteria 3843
287 Ga0157379_10221478 3300014968 Unclassified 1714
288 Ga0157376_10129922 3300014969 Bacteria 2246
289 Ga0157376_10167760 3300014969 Bacteria 1996
290 Ga0182006_1000012 3300015261 Bacteria 394239
291 Ga0182006_1000382 3300015261 Bacteria 36661
292 Ga0182006_1009184 3300015261 Bacteria 4442
293 Ga0163161_10001631 3300017792 Bacteria 16494
294 Ga0163161_10006037 3300017792 Bacteria 8395
295 Ga0163161_10020600 3300017792 Bacteria 4630
296 Ga0163161_10088946 3300017792 Bacteria 2283
297 Ga0163161_10089199 3300017792 Bacteria 2280
298 Ga0163161_10097987 3300017792 Bacteria 2178
299 Ga0163161_10193274 3300017792 Bacteria 1565
300 Ga0209437_100148 3300025233 Bacteria 158795
301 Ga0209026_1002337 3300025250 Bacteria 7193
302 Ga0209675_1000035 3300025291 Bacteria 255411
303 Ga0207655_1000254 3300025728 Bacteria 85278
304 Ga0207642_10006099 3300025899 Bacteria 3984
305 Ga0207642_10103891 3300025899 Bacteria 1432
306 Ga0207710_10007865 3300025900 Unclassified 4512
307 Ga0207688_10034972 3300025901 Bacteria 2783
308 Ga0207680_10087750 3300025903 Bacteria 1970
309 Ga0207647_10000988 3300025904 Bacteria 22050
310 Ga0207647_10001309 3300025904 Bacteria 19141
311 Ga0207647_10029961 3300025904 Bacteria 3515
312 Ga0207647_10131530 3300025904 Bacteria 1470
313 Ga0207645_10005943 3300025907 Bacteria 8794
314 Ga0207645_10009020 3300025907 Bacteria 6921
315 Ga0207645_10077619 3300025907 Bacteria 2128
316 Ga0207645_10143876 3300025907 Bacteria 1554
317 Ga0207643_10006271 3300025908 Bacteria 6363
318 Ga0207654_10153253 3300025911 Unclassified 1481
319 Ga0207707_10012028 3300025912 Bacteria 7524
320 Ga0207695_10000245 3300025913 Bacteria 141090
321 Ga0207695_10022735 3300025913 Bacteria 7105
322 Ga0207695_10038847 3300025913 Bacteria 5120
323 Ga0207695_10045424 3300025913 Bacteria 4663
324 Ga0207695_10045638 3300025913 Bacteria 4650
325 Ga0207671_10000130 3300025914 Bacteria 117434
326 Ga0207671_10001167 3300025914 Bacteria 31300
327 Ga0207671_10003985 3300025914 Bacteria 14355
328 Ga0207671_10023941 3300025914 Bacteria 4598
329 Ga0207662_10022813 3300025918 Bacteria 3592
330 Ga0207662_10081303 3300025918 Bacteria 1977
331 Ga0207649_10048701 3300025920 Bacteria 2615
332 Ga0207649_10113493 3300025920 Unclassified 1815
333 Ga0207649_10282129 3300025920 Bacteria 1208
334 Ga0207681_10046332 3300025923 Unclassified 2924
335 Ga0207650_10004584 3300025925 Bacteria 9448
336 Ga0207650_10013375 3300025925 Bacteria 5681
337 Ga0207650_10035392 3300025925 Bacteria 3625
338 Ga0207650_10228083 3300025925 Bacteria 1501
339 Ga0207650_10235119 3300025925 Bacteria 1479
340 Ga0207650_10253565 3300025925 Bacteria 1425
341 Ga0207659_10059732 3300025926 Bacteria 2742
342 Ga0207659_10061397 3300025926 Bacteria 2709
343 Ga0207659_10075625 3300025926 Unclassified 2472
344 Ga0207659_10269293 3300025926 Bacteria 1389
345 Ga0207644_10117869 3300025931 Bacteria 2017
346 Ga0207644_10177274 3300025931 Bacteria 1668
347 Ga0207644_10190364 3300025931 Bacteria 1613
348 Ga0207690_10027835 3300025932 Unclassified 3576
349 Ga0207690_10169661 3300025932 Bacteria 1634
350 Ga0207706_10024096 3300025933 Archaea 5458
351 Ga0207709_10005255 3300025935 Bacteria 7363
352 Ga0207670_10005679 3300025936 Bacteria 6869
353 Ga0207670_10103032 3300025936 Bacteria 2042
354 Ga0207670_10113090 3300025936 Bacteria 1960
355 Ga0207704_10215667 3300025938 Bacteria 1416
356 Ga0207691_10036383 3300025940 Bacteria 4561
357 Ga0207691_10164519 3300025940 Bacteria 1944
358 Ga0207689_10012068 3300025942 Bacteria 7402
359 Ga0207689_10036012 3300025942 Bacteria 4108
360 Ga0207689_10089859 3300025942 Bacteria 2523
361 Ga0207661_10004373 3300025944 Bacteria 9903
362 Ga0207661_10043402 3300025944 Bacteria 3548
363 Ga0207661_10212879 3300025944 Bacteria 1704
364 Ga0207679_10003487 3300025945 Bacteria 9726
365 Ga0207679_10067552 3300025945 Bacteria 2682
366 Ga0207679_10208953 3300025945 Bacteria 1636
367 Ga0207667_10000419 3300025949 Bacteria 57239
368 Ga0207667_10008361 3300025949 Bacteria 12300
369 Ga0207667_10096730 3300025949 Bacteria 3047
370 Ga0207651_10023076 3300025960 Bacteria 3819
371 Ga0207651_10035166 3300025960 Bacteria 3254
372 Ga0207712_10001641 3300025961 Bacteria 15072
373 Ga0207712_10001938 3300025961 Bacteria 13589
374 Ga0207712_10002372 3300025961 Bacteria 12208
375 Ga0207712_10061613 3300025961 Bacteria 2663
376 Ga0207668_10144150 3300025972 Bacteria 1835
377 Ga0207640_10011600 3300025981 Bacteria 4994
378 Ga0207640_10044473 3300025981 Bacteria 2846
379 Ga0207640_10319859 3300025981 Unclassified 1235
380 Ga0207658_10177109 3300025986 Bacteria 1762
381 Ga0207677_10004653 3300026023 Bacteria 7386
382 Ga0207677_10183465 3300026023 Bacteria 1648
383 Ga0207677_10390406 3300026023 Unclassified 1177
384 Ga0207677_10495012 3300026023 Bacteria 1056
385 Ga0207703_10220236 3300026035 Unclassified 1696
386 Ga0207703_10275059 3300026035 Bacteria 1527
387 Ga0207639_10017896 3300026041 Bacteria 5027
388 Ga0207639_10098869 3300026041 Bacteria 2353
389 Ga0207639_10216017 3300026041 Bacteria 1653
390 Ga0207639_10434971 3300026041 Bacteria 1188
391 Ga0207678_10029562 3300026067 Bacteria 4783
392 Ga0207708_10051481 3300026075 Bacteria 3135
393 Ga0207702_10008491 3300026078 Bacteria 8661
394 Ga0207702_10036343 3300026078 Bacteria 4120
395 Ga0207702_10400771 3300026078 Bacteria 1323
396 Ga0207641_10000730 3300026088 Bacteria 35276
397 Ga0207641_10029778 3300026088 Bacteria 4515
398 Ga0207641_10095484 3300026088 Bacteria 2610
399 Ga0207648_10008178 3300026089 Bacteria 10169
400 Ga0207648_10016701 3300026089 Bacteria 6698
401 Ga0207648_10025061 3300026089 Bacteria 5317
402 Ga0207648_10042119 3300026089 Bacteria 4009
403 Ga0207648_10224246 3300026089 Bacteria 1671
404 Ga0207676_10008125 3300026095 Bacteria 7459
405 Ga0207676_10195523 3300026095 Bacteria 1783
406 Ga0207674_10015776 3300026116 Bacteria 8288
407 Ga0207674_10021519 3300026116 Bacteria 6943
408 Ga0207674_10022873 3300026116 Bacteria 6707
409 Ga0207674_10051391 3300026116 Bacteria 4206
410 Ga0207675_100031951 3300026118 Bacteria 4904
411 Ga0207675_100060240 3300026118 Bacteria 3544
412 Ga0207675_100101239 3300026118 Bacteria 2714
413 Ga0207675_100228341 3300026118 Bacteria 1795
414 Ga0207675_100351759 3300026118 Bacteria 1444
415 Ga0207683_10004324 3300026121 Bacteria 12267
416 Ga0207683_10011177 3300026121 Bacteria 7654
417 Ga0207698_10007210 3300026142 Bacteria 6966
418 Ga0207698_10032743 3300026142 Bacteria 3769
419 Ga0207698_10050386 3300026142 Unclassified 3176
420 Ga0207698_10398620 3300026142 Unclassified 1314
421 Ga0268266_10000149 3300028379 Bacteria 134809
422 Ga0268266_10002951 3300028379 Bacteria 17546
423 Ga0268266_10068183 3300028379 Bacteria 3080
424 Ga0268266_10282131 3300028379 Bacteria 1545
425 Ga0268265_10200528 3300028380 Bacteria 1731
426 Ga0268265_10205583 3300028380 Bacteria 1711
427 Ga0268264_10000064 3300028381 Bacteria 301274
428 Ga0268264_10056103 3300028381 Bacteria 3292
429 Ga0265334_10017059 3300028573 Unclassified 3004
430 Ga0307517_10007088 3300028786 Bacteria 16436
431 Ga0307517_10113612 3300028786 Bacteria 2043
432 Ga0307515_10000223 3300028794 Bacteria 140434
433 Ga0307515_10002152 3300028794 Bacteria 43253
434 Ga0307515_10002588 3300028794 Bacteria 39033
435 Ga0265340_10089548 3300031247 Bacteria 1440
436 Ga0265327_10000022 3300031251 Bacteria 402724
437 Ga0265327_10000692 3300031251 Bacteria 53756
438 Ga0265327_10023225 3300031251 Bacteria 3678
439 Ga0307408_100000183 3300031548 Bacteria 69517
440 Ga0307516_10000659 3300031730 Bacteria 46694
441 Ga0307410_10040892 3300031852 Bacteria 3054
442 Ga0307412_10000007 3300031911 Bacteria 486267
443 Ga0307412_10000077 3300031911 Bacteria 96375
444 Ga0307412_10004787 3300031911 Bacteria 7555
445 Ga0307416_100000039 3300032002 Bacteria 133298
446 Ga0307416_100021338 3300032002 Bacteria 4648
447 Ga0307414_10000009 3300032004 Bacteria 359782
448 Ga0307414_10000967 3300032004 Bacteria 14631
449 Ga0307414_10001475 3300032004 Bacteria 12239
450 Ga0307414_10002260 3300032004 Bacteria 10066
451 Ga0307414_10018460 3300032004 Bacteria 4295
452 Ga0307414_10063996 3300032004 Bacteria 2616
453 Ga0307414_10132054 3300032004 Bacteria 1940
454 Ga0307414_10185034 3300032004 Bacteria 1679
455 Ga0307414_10241423 3300032004 Bacteria 1496
456 Ga0307411_10306347 3300032005 Bacteria 1276
457 Ga0307411_10339218 3300032005 Bacteria 1221
458 Ga0307507_10000170 3300033179 Bacteria 116878
459 Ga0373937_0043275 3300036401 Bacteria 4109
460 Ga0395899_0000025 3300037312 Bacteria 350927
461 Ga0395900_0117419 3300037418 Bacteria 2730
462 Ga0395900_0194251 3300037418 Bacteria 2057
463 Ga0395905_0000001 3300037471 Bacteria 2037079
464 Ga0395905_0000580 3300037471 Bacteria 49303
465 Ga0395905_0016411 3300037471 Bacteria 7038
466 Ga0395905_0083520 3300037471 Bacteria 2992
467 Ga0395901_0003783 3300038443 Bacteria 15246
468 Ga0436365_0518983 3300039437 Bacteria 1949
469 Ga0439466_0024551 3300041411 Bacteria 2111
470 Ga0439465_0008983 3300041413 Bacteria 3149
471 Ga0439445_0001630 3300042004 Bacteria 4907
472 Ga0439449_0010736 3300042007 Unclassified 3459
473 Ga0450923_002279 3300042125 Bacteria 2728
474 Ga0450894_004100 3300042131 Bacteria 1899
475 Ga0450898_004923 3300042134 Bacteria 1996
476 Ga0466972_0005319 3300044658 Bacteria 6445
477 Ga0453684_0003103 3300044712 Bacteria 38279
478 Ga0466970_0034986 3300044765 Bacteria 2661
479 Ga0451576_0000003 3300045051 Bacteria 1550573
480 Ga0495627_000003 3300046453 Bacteria 704557
481 Ga0495627_008622 3300046453 Bacteria 3804
482 Ga0495590_0008967 3300046457 Bacteria 3801
483 Ga0495638_0037665 3300046460 Bacteria 3076
484 Ga0495638_0094936 3300046460 Bacteria 1792
485 Ga0495650_0000238 3300046471 Bacteria 110217
486 Ga0495650_0040117 3300046471 Bacteria 2014
487 Ga0495605_0082384 3300046474 Bacteria 1503
488 Ga0495585_0000585 3300046492 Bacteria 34224
489 Ga0495585_0001267 3300046492 Bacteria 20233
490 Ga0495596_0010477 3300046500 Bacteria 4033
491 Ga0495583_0060132 3300046506 Bacteria 1700
492 Ga0495606_0000008 3300046507 Bacteria 321373
493 Ga0495606_0166249 3300046507 Bacteria 1283
494 Ga0495608_0062593 3300046511 Bacteria 2444
495 Ga0495610_0000032 3300046512 Bacteria 216443
496 Ga0495610_0001853 3300046512 Bacteria 18322
497 Ga0495610_0109259 3300046512 Bacteria 1227
498 Ga0495616_0006304 3300046513 Bacteria 7196
499 Ga0495616_0007243 3300046513 Bacteria 6644
500 Ga0495616_0059868 3300046513 Bacteria 1872
501 Ga0495628_0013015 3300046516 Bacteria 7007
502 Ga0495630_0021568 3300046517 Bacteria 4756
503 Ga0495632_0072158 3300046519 Bacteria 1657
504 Ga0495637_0069894 3300046520 Bacteria 1419
505 Ga0495643_0041170 3300046522 Bacteria 2520
506 Ga0495643_0041186 3300046522 Bacteria 2519
507 Ga0495648_0001120 3300046524 Bacteria 27151
508 Ga0495648_0010757 3300046524 Bacteria 6948
509 Ga0495648_0036130 3300046524 Bacteria 3193
510 Ga0495663_0000124 3300046525 Bacteria 32076
511 Ga0495654_0000001 3300046530 Bacteria 1513197
512 Ga0495586_0017743 3300046535 Bacteria 3787
513 Ga0495598_0022800 3300046537 Bacteria 1679
514 Ga0495609_0000225 3300046538 Bacteria 55731
515 Ga0495609_0001651 3300046538 Bacteria 14544
516 Ga0495609_0029633 3300046538 Bacteria 2492
517 Ga0495633_0000109 3300046558 Bacteria 110841
518 Ga0495633_0000388 3300046558 Bacteria 46365
519 Ga0495633_0013488 3300046558 Bacteria 4305
520 Ga0495633_0046683 3300046558 Bacteria 2048
521 Ga0495668_0000068 3300046616 Bacteria 176297
522 Ga0495668_0000127 3300046616 Bacteria 114097
523 Ga0495634_0071196 3300046642 Bacteria 2290
524 Ga0495625_0000017 3300046660 Bacteria 299728
525 Ga0495625_0000542 3300046660 Bacteria 55319
526 Ga0495625_0000691 3300046660 Bacteria 48010
527 Ga0495625_0001121 3300046660 Bacteria 34662
528 Ga0495625_0003593 3300046660 Bacteria 15258
529 Ga0495625_0010781 3300046660 Bacteria 7521
530 Ga0495625_0088404 3300046660 Bacteria 2146
531 Ga0495635_0016878 3300046663 Bacteria 5099
532 Ga0495661_0008349 3300046665 Bacteria 7167
533 Ga0495661_0016032 3300046665 Bacteria 4978
534 Ga0495657_0109673 3300046675 Bacteria 1750
535 Ga0495658_0034975 3300046683 Bacteria 2760
536 Ga0495613_0023524 3300046689 Bacteria 4591
537 Ga0495649_0000008 3300046694 Bacteria 483706
538 Ga0495589_0107703 3300046794 Bacteria 1346
539 Ga0495636_0000028 3300047318 Bacteria 60595
540 Ga0495672_0012808 3300047320 Bacteria 5827
541 Ga0495672_0072999 3300047320 Bacteria 1936
542 Ga0495687_000158 3300047443 Bacteria 103129
543 Ga0495687_002605 3300047443 Bacteria 14184
544 Ga0495673_0010133 3300047469 Bacteria 5154
545 Ga0495686_0000253 3300047472 Bacteria 96076
546 Ga0495686_0000261 3300047472 Bacteria 94540
547 Ga0495686_0000299 3300047472 Bacteria 85384
548 Ga0495686_0007933 3300047472 Bacteria 7881
549 Ga0495686_0019848 3300047472 Bacteria 4486
550 Ga0495686_0048500 3300047472 Bacteria 2677
551 Ga0495686_0056490 3300047472 Bacteria 2452
552 Ga0496102_0073354 3300048905 Bacteria 3145
553 Ga0496110_0076570 3300048913 Bacteria 2975
554 Ga0496114_0002061 3300048917 Bacteria 15306
555 Ga0496115_0001812 3300048918 Bacteria 15277
556 Ga0496116_0000022 3300048919 Bacteria 482506
557 Ga0496117_0000064 3300048920 Bacteria 254248
558 Ga0496118_0000147 3300048921 Bacteria 123467
559 Ga0496119_0000025 3300048922 Bacteria 257069
560 Ga0496122_0000433 3300048925 Bacteria 87562
561 Ga0496122_0000554 3300048925 Bacteria 77013
562 Ga0496122_0000746 3300048925 Bacteria 63466
563 Ga0496122_0002432 3300048925 Bacteria 26482
564 Ga0496122_0003237 3300048925 Bacteria 21629
565 Ga0496122_0007430 3300048925 Bacteria 12183
566 Ga0496123_0003730 3300048926 Bacteria 16731
567 Ga0496123_0037741 3300048926 Bacteria 3407
568 Ga0496123_0109822 3300048926 Bacteria 1579
569 Ga0496124_0001842 3300048927 Bacteria 29277
570 Ga0496124_0132563 3300048927 Bacteria 1978
571 Ga0496125_0001531 3300048928 Bacteria 33182
572 Ga0496125_0007660 3300048928 Bacteria 11444
573 Ga0496125_0058743 3300048928 Bacteria 3105
574 Ga0496125_0102632 3300048928 Bacteria 2101
575 Ga0496126_0000922 3300048929 Bacteria 50884
576 Ga0501290_002932 3300049513 Bacteria 2170
577 Ga0501293_002582 3300049516 Bacteria 1378
578 Ga0501335_000488 3300049551 Bacteria 2559
579 Ga0501031_0001600 3300049568 Bacteria 14146
580 Ga0501032_0050991 3300049569 Bacteria 2790
581 Ga0501032_0065140 3300049569 Bacteria 2438
582 Ga0501034_0014477 3300049571 Bacteria 8123
583 Ga0501034_0050622 3300049571 Bacteria 4189
584 Ga0501034_0087078 3300049571 Bacteria 3123
585 Ga0501036_0005556 3300049572 Bacteria 10227
586 Ga0501036_0005726 3300049572 Bacteria 10077
587 Ga0501037_0027053 3300049573 Bacteria 4237
588 Ga0501038_0034595 3300049574 Bacteria 4441
589 Ga0501039_0005269 3300049575 Bacteria 9792
590 Ga0501043_0015546 3300049579 Bacteria 5964
591 Ga0501043_0037488 3300049579 Bacteria 3813
592 Ga0501043_0075016 3300049579 Bacteria 2657
593 Ga0501046_0039611 3300049580 Bacteria 3772
594 Ga0501046_0094373 3300049580 Bacteria 2299
595 Ga0501047_0027972 3300049581 Bacteria 5434
596 Ga0501047_0041618 3300049581 Bacteria 4440
597 Ga0501072_0058117 3300049588 Bacteria 3049
598 Ga0501073_0023518 3300049589 Bacteria 4424
599 Ga0501074_0000591 3300049590 Bacteria 22526
600 Ga0501198_002065 3300049649 Bacteria 2676
601 Ga0501217_005896 3300049661 Bacteria 2579
602 Ga0501223_002142 3300049663 Bacteria 4425
603 Ga0501233_004133 3300049668 Bacteria 2644
604 Ga0501235_012149 3300049669 Unclassified 1892
605 Ga0501235_016090 3300049669 Bacteria 1651
606 Ga0501243_004110 3300049675 Bacteria 2175
607 Ga0501252_002421 3300049682 Bacteria 1850
608 Ga0501259_002506 3300049688 Bacteria 2969
609 Ga0501259_002880 3300049688 Bacteria 2764
610 Ga0501261_003913 3300049690 Bacteria 1827
611 Ga0501225_0001741 3300049705 Bacteria 6822
612 Ga0501234_000344 3300049707 Bacteria 6865
613 Ga0501234_012990 3300049707 Unclassified 1307
614 Ga0501080_0111345 3300049742 Bacteria 2537
615 Ga0501241_000114 3300049758 Bacteria 17450
616 Ga0501266_002788 3300049763 Bacteria 2187
617 Ga0501268_007439 3300049765 Bacteria 1634
618 Ga0501269_000702 3300049766 Bacteria 5545
619 Ga0501271_005263 3300049768 Bacteria 1255
620 Ga0501035_0006079 3300049822 Bacteria 11367
621 Ga0501035_0057398 3300049822 Bacteria 3471
622 Ga0501044_0035878 3300049823 Bacteria 5190
623 Ga0501044_0166347 3300049823 Bacteria 2179
624 Ga0501284_00033 3300050005 Bacteria 63455
625 nmdc:mga0k408_48831_c1 3300050493 Bacteria 2449
626 nmdc:mga0k408_6928_c1 3300050493 Bacteria 6044
627 nmdc:mga05p37_222343_c1 3300050507 Bacteria 2278
628 nmdc:mga05p37_76696_c1 3300050507 Bacteria 2866
629 nmdc:mga09592_105905_c1 3300050508 Bacteria 2412
630 nmdc:mga0qj67_34474_c1 3300050509 Bacteria 3954
631 nmdc:mga06r32_250475_c1 3300050510 Bacteria 1759
632 nmdc:mga08y16_533070_c1 3300050511 Bacteria 1190
633 nmdc:mga08x19_35271_c1 3300050514 Bacteria 3164
634 nmdc:mga0a205_10623_c1 3300050515 Bacteria 8465
635 nmdc:mga0a205_106747_c1 3300050515 Bacteria 2698
636 Ga0500583_0024788 3300053092 Unclassified 2550
637 Ga0500651_0000127 3300053093 Bacteria 47010
638 Ga0500614_037545 3300053123 Bacteria 1216
639 Ga0500618_000009 3300053125 Bacteria 209970
640 Ga0500559_0010090 3300053136 Bacteria 4065
641 Ga0500568_0002946 3300053139 Bacteria 9744
642 Ga0500616_0004954 3300053153 Bacteria 9243
643 Ga0500622_0001133 3300053156 Bacteria 22246
644 Ga0500624_000382 3300053157 Bacteria 14094
645 Ga0500627_0005143 3300053158 Bacteria 4306
646 Ga0500611_000011 3300053727 Bacteria 141259
647 Ga0501084_0092724 3300054114 Bacteria 2536

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10003668 Ga0075433_100036684 254
2 3300007076 Ga0075435_100018506 Ga0075435_1000185065 254
3 3300050515 nmdc:mga0a205_10623_c1 nmdc:mga0a205_10623_c1_2961_3839 254
4 3300005364 Ga0070673_100280301 Ga0070673_1002803012 256
5 3300050514 nmdc:mga08x19_35271_c1 nmdc:mga08x19_35271_c1_1728_2612 256
6 3300050515 nmdc:mga0a205_106747_c1 nmdc:mga0a205_106747_c1_393_1277 256
7 3300050510 nmdc:mga06r32_250475_c1 nmdc:mga06r32_250475_c1_13_891 258
8 3300005329 Ga0070683_100002228 Ga0070683_1000022288 264
9 3300005344 Ga0070661_100010109 Ga0070661_1000101092 264
10 3300005366 Ga0070659_100002840 Ga0070659_1000028408 264
11 3300005535 Ga0070684_100001451 Ga0070684_10000145120 264
12 3300005539 Ga0068853_100001183 Ga0068853_10000118317 264
13 3300005564 Ga0070664_100010568 Ga0070664_1000105687 264
14 3300005577 Ga0068857_100009246 Ga0068857_1000092469 264
15 3300025932 Ga0207690_10027835 Ga0207690_100278351 264
16 3300025944 Ga0207661_10004373 Ga0207661_100043734 264
17 3300025945 Ga0207679_10003487 Ga0207679_100034878 264
18 3300026041 Ga0207639_10017896 Ga0207639_100178964 264
19 3300046471 Ga0495650_0040117 Ga0495650_0040117_11_925 265
20 3300017792 Ga0163161_10088946 Ga0163161_100889463 266
21 3300025904 Ga0207647_10001309 Ga0207647_1000130910 267
22 3300005617 Ga0068859_100166052 Ga0068859_1001660522 269
23 3300005843 Ga0068860_100000006 Ga0068860_100000006126 269
24 3300006931 Ga0097620_100166062 Ga0097620_1001660622 269
25 3300013306 Ga0163162_10000355 Ga0163162_1000035538 269
26 3300028381 Ga0268264_10000064 Ga0268264_1000006468 269
27 3300028786 Ga0307517_10113612 Ga0307517_101136122 269
28 3300046460 Ga0495638_0037665 Ga0495638_0037665_1941_2906 269
29 3300046524 Ga0495648_0001120 Ga0495648_0001120_8707_9672 269
30 3300047443 Ga0495687_000158 Ga0495687_000158_70385_71350 269
31 3300048917 Ga0496114_0002061 Ga0496114_0002061_5707_6684 269
32 3300053092 Ga0500583_0024788 Ga0500583_0024788_528_1493 269
33 3300005548 Ga0070665_100000016 Ga0070665_100000016109 270
34 3300013297 Ga0157378_10461484 Ga0157378_104614842 270
35 3300028379 Ga0268266_10000149 Ga0268266_10000149108 270
36 3300031251 Ga0265327_10000692 Ga0265327_1000069242 270
37 3300046460 Ga0495638_0094936 Ga0495638_0094936_192_1208 270
38 3300005563 Ga0068855_100587769 Ga0068855_1005877691 271
39 3300006847 Ga0075431_100015087 Ga0075431_1000150878 271
40 3300009093 Ga0105240_10048728 Ga0105240_100487282 271
41 3300009147 Ga0114129_10059718 Ga0114129_100597184 271
42 3300025913 Ga0207695_10022735 Ga0207695_100227356 271
43 3300050507 nmdc:mga05p37_76696_c1 nmdc:mga05p37_76696_c1_1723_2676 271
44 3300044658 Ga0466972_0005319 Ga0466972_0005319_1150_2115 272
45 3300047318 Ga0495636_0000028 Ga0495636_0000028_56428_57405 272
46 3300005614 Ga0068856_100260275 Ga0068856_1002602752 273
47 3300032004 Ga0307414_10018460 Ga0307414_100184604 273
48 3300003316 rootH1_10166102 rootH1_101661023 274
49 3300049669 Ga0501235_012149 Ga0501235_012149_291_1253 275
50 3300014497 Ga0182008_10009150 Ga0182008_100091501 276
51 3300005329 Ga0070683_100301568 Ga0070683_1003015682 277
52 3300005563 Ga0068855_100003016 Ga0068855_10000301620 277
53 3300005616 Ga0068852_100038113 Ga0068852_1000381133 277
54 3300009093 Ga0105240_10003256 Ga0105240_1000325621 277
55 3300010375 Ga0105239_10128503 Ga0105239_101285032 277
56 3300013104 Ga0157370_10029298 Ga0157370_100292983 277
57 3300013105 Ga0157369_10047939 Ga0157369_100479393 277
58 3300013307 Ga0157372_10100160 Ga0157372_101001602 277
59 3300025250 Ga0209026_1002337 Ga0209026_10023372 277
60 3300025913 Ga0207695_10000245 Ga0207695_1000024554 277
61 3300025944 Ga0207661_10212879 Ga0207661_102128792 277
62 3300025949 Ga0207667_10008361 Ga0207667_100083613 277
63 3300026142 Ga0207698_10032743 Ga0207698_100327433 277
64 3300031548 Ga0307408_100000183 Ga0307408_10000018317 277
65 3300049690 Ga0501261_003913 Ga0501261_003913_584_1600 277
66 3300053157 Ga0500624_000382 Ga0500624_000382_2208_3185 277
67 iso_pu_bacteria 2511231000 2511233822 277
68 iso_pu_bacteria 2523533629 2524005998 277
69 iso_pu_bacteria 2582581278 2585141301 277
70 iso_pu_bacteria 2582581281 2585158890 277
71 iso_pu_bacteria 2582581282 2585163178 277
72 iso_pu_bacteria 2582581873 2585424632 277
73 iso_pu_bacteria 2585428045 2587681362 277
74 iso_pu_bacteria 2585428060 2587749367 277
75 iso_pu_bacteria 2585428061 2587750483 277
76 iso_pu_bacteria 2585428095 2587866934 277
77 iso_pu_bacteria 2585428115 2587942724 277
78 iso_pu_bacteria 2585428182 2588207854 277
79 iso_pu_bacteria 2585428183 2588213592 277
80 iso_pu_bacteria 2585428184 2588221474 277
81 iso_pu_bacteria 2585428185 2588223592 277
82 iso_pu_bacteria 2585428187 2588233272 277
83 iso_pu_bacteria 2588253712 2588446754 277
84 iso_pu_bacteria 2588254255 2590600388 277
85 iso_pu_bacteria 2588254257 2590612220 277
86 iso_pu_bacteria 2728369107 2729198856 277
87 iso_pu_bacteria 2738541273 2738699418 277
88 iso_pu_bacteria 2738543014 2739255385 277
89 iso_pu_bacteria 2739367874 2740058007 277
90 iso_pu_bacteria 2751185877 2753672380 277
91 iso_pu_bacteria 2765235839 2765572906 277
92 iso_pu_bacteria 2772190705 2772607602 277
93 iso_pu_bacteria 2775506739 2775672732 277
94 iso_pu_bacteria 2816332188 2816873362 277
95 iso_pu_bacteria 2842083920 2842086765 277
96 iso_pu_bacteria 2871720351 2871721138 277
97 iso_pu_bacteria 2889290771 2889291379 277
98 iso_pu_bacteria 2905999023 2906001802 277
99 iso_pu_bacteria 2919097161 2919100384 277
100 iso_pu_bacteria 2919399522 2919404266 277
101 iso_pu_bacteria 2945924605 2945927110 277
102 iso_pu_bacteria 2946019816 2946021665 277
103 iso_pu_bacteria 2977243572 2977245989 277
104 iso_pu_bacteria 2984572630 2984576140 277
105 iso_pu_bacteria 2984606641 2984609595 277
106 iso_pu_bacteria 2993372514 2993373332 277
107 iso_pu_bacteria 2993480792 2993484014 277
108 3300003322 rootL2_10171436 rootL2_101714362 279
109 3300014326 Ga0157380_10208958 Ga0157380_102089581 279
110 iso_pu_bacteria 2881955468 2881956657 280
111 2162886007 SwRhRL2b_contig_2062776 SwRhRL2b_0412.00004720 281
112 3300001915 JGI24741J21665_1006007 JGI24741J21665_10060073 281
113 3300003320 rootH2_10196964 rootH2_101969642 281
114 3300003322 rootL2_10089539 rootL2_100895393 281
115 3300003323 rootH1_10044553 rootH1_100445537 281
116 3300003578 Ga0006562J51391_1004223 Ga0006562J51391_10042234 281
117 3300003784 Ga0055534_1005024 Ga0055534_10050243 281
118 3300005288 Ga0065714_10070550 Ga0065714_100705502 281
119 3300005289 Ga0065704_10079391 Ga0065704_100793912 281
120 3300005289 Ga0065704_10079664 Ga0065704_100796643 281
121 3300005329 Ga0070683_100006944 Ga0070683_1000069444 281
122 3300005337 Ga0070682_100199376 Ga0070682_1001993761 281
123 3300009036 Ga0105244_10000049 Ga0105244_1000004965 281
124 3300009148 Ga0105243_10002732 Ga0105243_100027329 281
125 3300009553 Ga0105249_10048976 Ga0105249_100489763 281
126 3300013100 Ga0157373_10000107 Ga0157373_1000010734 281
127 3300013102 Ga0157371_10000201 Ga0157371_1000020173 281
128 3300013104 Ga0157370_10005377 Ga0157370_1000537711 281
129 3300013104 Ga0157370_10022329 Ga0157370_100223297 281
130 3300013104 Ga0157370_10039262 Ga0157370_100392625 281
131 3300013105 Ga0157369_10000759 Ga0157369_1000075918 281
132 3300013308 Ga0157375_10000759 Ga0157375_1000075916 281
133 3300014497 Ga0182008_10000011 Ga0182008_10000011222 281
134 3300015261 Ga0182006_1000012 Ga0182006_1000012345 281
135 3300017792 Ga0163161_10006037 Ga0163161_100060373 281
136 3300017792 Ga0163161_10097987 Ga0163161_100979873 281
137 3300025291 Ga0209675_1000035 Ga0209675_1000035139 281
138 3300025728 Ga0207655_1000254 Ga0207655_100025426 281
139 3300025935 Ga0207709_10005255 Ga0207709_100052557 281
140 3300025961 Ga0207712_10061613 Ga0207712_100616133 281
141 3300031911 Ga0307412_10000007 Ga0307412_1000000757 281
142 3300031911 Ga0307412_10004787 Ga0307412_100047874 281
143 3300032002 Ga0307416_100000039 Ga0307416_10000003944 281
144 3300032004 Ga0307414_10000009 Ga0307414_100000097 281
145 3300032004 Ga0307414_10063996 Ga0307414_100639961 281
146 3300032004 Ga0307414_10185034 Ga0307414_101850342 281
147 3300032004 Ga0307414_10241423 Ga0307414_102414232 281
148 3300041411 Ga0439466_0024551 Ga0439466_0024551_326_1273 281
149 3300041413 Ga0439465_0008983 Ga0439465_0008983_1409_2407 281
150 3300042004 Ga0439445_0001630 Ga0439445_0001630_22_969 281
151 3300046453 Ga0495627_000003 Ga0495627_000003_222326_223273 281
152 3300046457 Ga0495590_0008967 Ga0495590_0008967_1059_2006 281
153 3300046500 Ga0495596_0010477 Ga0495596_0010477_1310_2257 281
154 3300046512 Ga0495610_0000032 Ga0495610_0000032_128039_128986 281
155 3300046519 Ga0495632_0072158 Ga0495632_0072158_198_1145 281
156 3300046522 Ga0495643_0041170 Ga0495643_0041170_1442_2389 281
157 3300046522 Ga0495643_0041186 Ga0495643_0041186_877_1824 281
158 3300046525 Ga0495663_0000124 Ga0495663_0000124_4547_5494 281
159 3300046530 Ga0495654_0000001 Ga0495654_0000001_897004_897951 281
160 3300046538 Ga0495609_0000225 Ga0495609_0000225_1278_2225 281
161 3300046558 Ga0495633_0000109 Ga0495633_0000109_57328_58275 281
162 3300046558 Ga0495633_0013488 Ga0495633_0013488_1524_2471 281
163 3300046660 Ga0495625_0000542 Ga0495625_0000542_49655_50602 281
164 3300047472 Ga0495686_0048500 Ga0495686_0048500_1536_2483 281
165 3300048905 Ga0496102_0073354 Ga0496102_0073354_1420_2367 281
166 3300048919 Ga0496116_0000022 Ga0496116_0000022_363883_364830 281
167 3300048920 Ga0496117_0000064 Ga0496117_0000064_129830_130777 281
168 3300048921 Ga0496118_0000147 Ga0496118_0000147_14453_15400 281
169 3300048922 Ga0496119_0000025 Ga0496119_0000025_126280_127227 281
170 3300048925 Ga0496122_0000433 Ga0496122_0000433_30609_31556 281
171 3300048925 Ga0496122_0000554 Ga0496122_0000554_60274_61221 281
172 3300048925 Ga0496122_0002432 Ga0496122_0002432_6802_7749 281
173 3300048925 Ga0496122_0003237 Ga0496122_0003237_5491_6438 281
174 3300048925 Ga0496122_0007430 Ga0496122_0007430_5321_6268 281
175 3300048926 Ga0496123_0003730 Ga0496123_0003730_9009_9956 281
176 3300048926 Ga0496123_0109822 Ga0496123_0109822_309_1256 281
177 3300048927 Ga0496124_0001842 Ga0496124_0001842_3230_4177 281
178 3300048927 Ga0496124_0132563 Ga0496124_0132563_133_1080 281
179 3300048928 Ga0496125_0001531 Ga0496125_0001531_21861_22808 281
180 3300048928 Ga0496125_0007660 Ga0496125_0007660_4475_5422 281
181 3300048928 Ga0496125_0058743 Ga0496125_0058743_2096_3043 281
182 3300048929 Ga0496126_0000922 Ga0496126_0000922_32822_33769 281
183 3300049551 Ga0501335_000488 Ga0501335_000488_986_1984 281
184 3300049758 Ga0501241_000114 Ga0501241_000114_7103_8050 281
185 3300049765 Ga0501268_007439 Ga0501268_007439_177_1199 281
186 3300049766 Ga0501269_000702 Ga0501269_000702_2540_3538 281
187 iso_pu_bacteria 2818991444 2819586756 281
188 iso_pu_bacteria 2599185184 2599476807 282
189 iso_pu_bacteria 2919437846 2919441233 282
190 iso_pu_bacteria 2928078545 2928078715 282
191 iso_pu_bacteria 2928147474 2928151607 282
192 iso_pu_bacteria 2932082852 2932084240 282
193 3300013102 Ga0157371_10056805 Ga0157371_100568053 283
194 3300013307 Ga0157372_10007563 Ga0157372_100075634 283
195 3300028794 Ga0307515_10000223 Ga0307515_1000022359 283
196 3300032004 Ga0307414_10002260 Ga0307414_1000226010 283
197 3300046453 Ga0495627_008622 Ga0495627_008622_204_1157 283
198 3300046660 Ga0495625_0003593 Ga0495625_0003593_12204_13181 283
199 3300047472 Ga0495686_0000253 Ga0495686_0000253_91560_92513 283
200 3300049581 Ga0501047_0041618 Ga0501047_0041618_2277_3245 283
201 3300049822 Ga0501035_0006079 Ga0501035_0006079_1287_2255 283
202 iso_pu_bacteria 2738541283 2738755059 283
203 iso_pu_bacteria 2738541284 2738760974 283
204 iso_pu_bacteria 2738543023 2739301213 283
205 iso_pu_bacteria 2775506987 2776613161 283
206 iso_pu_bacteria 2852627209 2852631311 283
207 iso_pu_bacteria 2896317667 2896319610 283
208 iso_pu_bacteria 2896344016 2896346681 283
209 iso_pu_bacteria 2919186247 2919187250 283
210 iso_pu_bacteria 2939664404 2939665481 283
211 iso_pu_bacteria 3003233435 3003237088 283
212 3300003322 rootL2_10179839 rootL2_101798392 284
213 3300005578 Ga0068854_100360845 Ga0068854_1003608452 284
214 3300010375 Ga0105239_10157001 Ga0105239_101570011 284
215 3300013307 Ga0157372_10352147 Ga0157372_103521471 284
216 3300028786 Ga0307517_10007088 Ga0307517_1000708814 284
217 3300031730 Ga0307516_10000659 Ga0307516_1000065932 284
218 3300031852 Ga0307410_10040892 Ga0307410_100408924 284
219 3300032002 Ga0307416_100021338 Ga0307416_1000213385 284
220 3300039437 Ga0436365_0518983 Ga0436365_0518983_392_1351 284
221 3300046616 Ga0495668_0000068 Ga0495668_0000068_96414_97394 284
222 3300047472 Ga0495686_0000261 Ga0495686_0000261_34273_35304 284
223 3300049661 Ga0501217_005896 Ga0501217_005896_1037_1999 284
224 3300053153 Ga0500616_0004954 Ga0500616_0004954_2231_3211 284
225 3300053158 Ga0500627_0005143 Ga0500627_0005143_1671_2651 284
226 2162886011 MRS1b_contig_8964951 MRS1b_0151.00001590 285
227 3300003322 rootL2_10138794 rootL2_101387944 285
228 3300003323 rootH1_10193885 rootH1_101938851 285
229 3300005290 Ga0065712_10001395 Ga0065712_100013955 285
230 3300005290 Ga0065712_10004793 Ga0065712_100047932 285
231 3300005293 Ga0065715_10104240 Ga0065715_101042402 285
232 3300005295 Ga0065707_10101916 Ga0065707_101019162 285
233 3300005328 Ga0070676_10038836 Ga0070676_100388364 285
234 3300005329 Ga0070683_100023606 Ga0070683_1000236067 285
235 3300005329 Ga0070683_100256092 Ga0070683_1002560922 285
236 3300005330 Ga0070690_100027165 Ga0070690_1000271653 285
237 3300005330 Ga0070690_100176209 Ga0070690_1001762092 285
238 3300005331 Ga0070670_100004989 Ga0070670_10000498910 285
239 3300005331 Ga0070670_100050676 Ga0070670_1000506764 285
240 3300005331 Ga0070670_100076556 Ga0070670_1000765562 285
241 3300005334 Ga0068869_100001288 Ga0068869_10000128815 285
242 3300005334 Ga0068869_100025626 Ga0068869_1000256264 285
243 3300005334 Ga0068869_100139809 Ga0068869_1001398091 285
244 3300005335 Ga0070666_10111904 Ga0070666_101119042 285
245 3300005337 Ga0070682_100042657 Ga0070682_1000426572 285
246 3300005338 Ga0068868_100004534 Ga0068868_10000453411 285
247 3300005338 Ga0068868_100038212 Ga0068868_1000382122 285
248 3300005338 Ga0068868_100105694 Ga0068868_1001056942 285
249 3300005338 Ga0068868_100223500 Ga0068868_1002235002 285
250 3300005340 Ga0070689_100003775 Ga0070689_10000377511 285
251 3300005340 Ga0070689_100034123 Ga0070689_1000341234 285
252 3300005340 Ga0070689_100173822 Ga0070689_1001738222 285
253 3300005340 Ga0070689_100395705 Ga0070689_1003957051 285
254 3300005343 Ga0070687_100043718 Ga0070687_1000437182 285
255 3300005343 Ga0070687_100056043 Ga0070687_1000560433 285
256 3300005347 Ga0070668_100011326 Ga0070668_1000113267 285
257 3300005347 Ga0070668_100139384 Ga0070668_1001393841 285
258 3300005347 Ga0070668_100217632 Ga0070668_1002176321 285
259 3300005353 Ga0070669_100000874 Ga0070669_10000087419 285
260 3300005353 Ga0070669_100219157 Ga0070669_1002191572 285
261 3300005354 Ga0070675_100023401 Ga0070675_1000234013 285
262 3300005354 Ga0070675_100040444 Ga0070675_1000404442 285
263 3300005354 Ga0070675_100054876 Ga0070675_1000548762 285
264 3300005354 Ga0070675_100098547 Ga0070675_1000985473 285
265 3300005354 Ga0070675_100274360 Ga0070675_1002743602 285
266 3300005354 Ga0070675_100455540 Ga0070675_1004555401 285
267 3300005356 Ga0070674_100013146 Ga0070674_1000131466 285
268 3300005364 Ga0070673_100019243 Ga0070673_1000192436 285
269 3300005364 Ga0070673_100048333 Ga0070673_1000483331 285
270 3300005365 Ga0070688_100001369 Ga0070688_10000136913 285
271 3300005365 Ga0070688_100051441 Ga0070688_1000514412 285
272 3300005366 Ga0070659_100013207 Ga0070659_1000132073 285
273 3300005367 Ga0070667_100033888 Ga0070667_1000338882 285
274 3300005367 Ga0070667_100197088 Ga0070667_1001970882 285
275 3300005456 Ga0070678_100022366 Ga0070678_1000223662 285
276 3300005457 Ga0070662_100013466 Ga0070662_1000134664 285
277 3300005457 Ga0070662_100021109 Ga0070662_1000211095 285
278 3300005457 Ga0070662_100075421 Ga0070662_1000754213 285
279 3300005458 Ga0070681_10006746 Ga0070681_100067468 285
280 3300005459 Ga0068867_100022653 Ga0068867_1000226534 285
281 3300005459 Ga0068867_100033639 Ga0068867_1000336393 285
282 3300005459 Ga0068867_100035811 Ga0068867_1000358114 285
283 3300005459 Ga0068867_100080041 Ga0068867_1000800413 285
284 3300005459 Ga0068867_100091658 Ga0068867_1000916582 285
285 3300005466 Ga0070685_10040904 Ga0070685_100409042 285
286 3300005466 Ga0070685_10233509 Ga0070685_102335091 285
287 3300005471 Ga0070698_100000936 Ga0070698_10000093623 285
288 3300005471 Ga0070698_100003346 Ga0070698_1000033467 285
289 3300005535 Ga0070684_100033002 Ga0070684_1000330025 285
290 3300005539 Ga0068853_100046722 Ga0068853_1000467223 285
291 3300005539 Ga0068853_100070624 Ga0068853_1000706245 285
292 3300005543 Ga0070672_100175560 Ga0070672_1001755602 285
293 3300005544 Ga0070686_100014676 Ga0070686_1000146764 285
294 3300005544 Ga0070686_100195727 Ga0070686_1001957272 285
295 3300005549 Ga0070704_100219681 Ga0070704_1002196811 285
296 3300005563 Ga0068855_100348302 Ga0068855_1003483021 285
297 3300005564 Ga0070664_100003972 Ga0070664_1000039727 285
298 3300005564 Ga0070664_100013148 Ga0070664_1000131485 285
299 3300005564 Ga0070664_100124706 Ga0070664_1001247062 285
300 3300005564 Ga0070664_100187689 Ga0070664_1001876892 285
301 3300005564 Ga0070664_100473572 Ga0070664_1004735721 285
302 3300005577 Ga0068857_100058936 Ga0068857_1000589363 285
303 3300005577 Ga0068857_100584040 Ga0068857_1005840401 285
304 3300005578 Ga0068854_100007114 Ga0068854_1000071148 285
305 3300005578 Ga0068854_100058975 Ga0068854_1000589753 285
306 3300005578 Ga0068854_100073472 Ga0068854_1000734722 285
307 3300005614 Ga0068856_100152701 Ga0068856_1001527012 285
308 3300005614 Ga0068856_100263112 Ga0068856_1002631122 285
309 3300005615 Ga0070702_100148462 Ga0070702_1001484621 285
310 3300005616 Ga0068852_100005008 Ga0068852_1000050084 285
311 3300005616 Ga0068852_100005930 Ga0068852_1000059307 285
312 3300005616 Ga0068852_100048616 Ga0068852_1000486163 285
313 3300005617 Ga0068859_100050663 Ga0068859_1000506632 285
314 3300005617 Ga0068859_100058045 Ga0068859_1000580455 285
315 3300005617 Ga0068859_100102936 Ga0068859_1001029361 285
316 3300005617 Ga0068859_100132306 Ga0068859_1001323062 285
317 3300005617 Ga0068859_100181666 Ga0068859_1001816662 285
318 3300005617 Ga0068859_100369522 Ga0068859_1003695222 285
319 3300005618 Ga0068864_100005936 Ga0068864_10000593613 285
320 3300005618 Ga0068864_100057224 Ga0068864_1000572242 285
321 3300005618 Ga0068864_100073871 Ga0068864_1000738713 285
322 3300005618 Ga0068864_100181639 Ga0068864_1001816392 285
323 3300005718 Ga0068866_10012173 Ga0068866_100121733 285
324 3300005718 Ga0068866_10017509 Ga0068866_100175094 285
325 3300005719 Ga0068861_100002657 Ga0068861_1000026579 285
326 3300005719 Ga0068861_100053413 Ga0068861_1000534132 285
327 3300005834 Ga0068851_10060841 Ga0068851_100608412 285
328 3300005840 Ga0068870_10024468 Ga0068870_100244682 285
329 3300005841 Ga0068863_100035606 Ga0068863_1000356065 285
330 3300005841 Ga0068863_100309792 Ga0068863_1003097922 285
331 3300005843 Ga0068860_100304548 Ga0068860_1003045482 285
332 3300005844 Ga0068862_100013727 Ga0068862_1000137278 285
333 3300005844 Ga0068862_100103861 Ga0068862_1001038613 285
334 3300005844 Ga0068862_100269983 Ga0068862_1002699832 285
335 3300006195 Ga0075366_10033092 Ga0075366_100330923 285
336 3300006844 Ga0075428_100004467 Ga0075428_1000044673 285
337 3300006844 Ga0075428_100045987 Ga0075428_1000459874 285
338 3300006844 Ga0075428_100500532 Ga0075428_1005005321 285
339 3300006846 Ga0075430_100005032 Ga0075430_1000050329 285
340 3300006847 Ga0075431_100018066 Ga0075431_1000180662 285
341 3300006880 Ga0075429_100108610 Ga0075429_1001086103 285
342 3300006881 Ga0068865_100018228 Ga0068865_1000182283 285
343 3300006881 Ga0068865_100405711 Ga0068865_1004057111 285
344 3300006931 Ga0097620_100016642 Ga0097620_1000166423 285
345 3300006931 Ga0097620_100050660 Ga0097620_1000506602 285
346 3300006931 Ga0097620_100058044 Ga0097620_1000580445 285
347 3300006931 Ga0097620_100102944 Ga0097620_1001029441 285
348 3300006931 Ga0097620_100132315 Ga0097620_1001323152 285
349 3300006931 Ga0097620_100181670 Ga0097620_1001816702 285
350 3300006931 Ga0097620_100369492 Ga0097620_1003694922 285
351 3300009093 Ga0105240_10010049 Ga0105240_1001004910 285
352 3300009093 Ga0105240_10032954 Ga0105240_100329546 285
353 3300009093 Ga0105240_10046443 Ga0105240_100464436 285
354 3300009093 Ga0105240_10079202 Ga0105240_100792024 285
355 3300009094 Ga0111539_10016041 Ga0111539_100160416 285
356 3300009094 Ga0111539_10452493 Ga0111539_104524932 285
357 3300009101 Ga0105247_10014759 Ga0105247_100147595 285
358 3300009147 Ga0114129_10225572 Ga0114129_102255723 285
359 3300009174 Ga0105241_10256888 Ga0105241_102568881 285
360 3300009176 Ga0105242_10016107 Ga0105242_100161077 285
361 3300009176 Ga0105242_10031148 Ga0105242_100311481 285
362 3300009176 Ga0105242_10051408 Ga0105242_100514085 285
363 3300009545 Ga0105237_10153726 Ga0105237_101537262 285
364 3300009545 Ga0105237_10164721 Ga0105237_101647212 285
365 3300009551 Ga0105238_10010139 Ga0105238_100101398 285
366 3300009553 Ga0105249_10001693 Ga0105249_1000169313 285
367 3300009553 Ga0105249_10008239 Ga0105249_100082392 285
368 3300009553 Ga0105249_10528850 Ga0105249_105288501 285
369 3300010375 Ga0105239_10282818 Ga0105239_102828182 285
370 3300011119 Ga0105246_10058498 Ga0105246_100584982 285
371 3300011119 Ga0105246_10076639 Ga0105246_100766392 285
372 3300013102 Ga0157371_10007473 Ga0157371_100074738 285
373 3300013102 Ga0157371_10039565 Ga0157371_100395651 285
374 3300013104 Ga0157370_10008393 Ga0157370_100083939 285
375 3300013296 Ga0157374_10000411 Ga0157374_1000041133 285
376 3300013296 Ga0157374_10004791 Ga0157374_100047913 285
377 3300013296 Ga0157374_10125752 Ga0157374_101257522 285
378 3300013296 Ga0157374_10228006 Ga0157374_102280062 285
379 3300013296 Ga0157374_10318835 Ga0157374_103188352 285
380 3300013297 Ga0157378_10069191 Ga0157378_100691912 285
381 3300013297 Ga0157378_10371451 Ga0157378_103714512 285
382 3300013306 Ga0163162_10009885 Ga0163162_100098855 285
383 3300013306 Ga0163162_10063705 Ga0163162_100637052 285
384 3300013307 Ga0157372_10001647 Ga0157372_1000164711 285
385 3300013307 Ga0157372_10002968 Ga0157372_1000296811 285
386 3300013307 Ga0157372_10044507 Ga0157372_100445074 285
387 3300013307 Ga0157372_10093380 Ga0157372_100933804 285
388 3300013307 Ga0157372_10504270 Ga0157372_105042702 285
389 3300013308 Ga0157375_10006455 Ga0157375_100064554 285
390 3300013308 Ga0157375_10040868 Ga0157375_100408685 285
391 3300013308 Ga0157375_10071769 Ga0157375_100717691 285
392 3300013308 Ga0157375_10105335 Ga0157375_101053353 285
393 3300013308 Ga0157375_10108483 Ga0157375_101084833 285
394 3300014325 Ga0163163_10000261 Ga0163163_1000026159 285
395 3300014325 Ga0163163_10024337 Ga0163163_100243375 285
396 3300014325 Ga0163163_10270258 Ga0163163_102702582 285
397 3300014325 Ga0163163_10286702 Ga0163163_102867023 285
398 3300014325 Ga0163163_10494458 Ga0163163_104944581 285
399 3300014326 Ga0157380_10018714 Ga0157380_100187145 285
400 3300014326 Ga0157380_10065958 Ga0157380_100659584 285
401 3300014745 Ga0157377_10002452 Ga0157377_100024523 285
402 3300014745 Ga0157377_10128308 Ga0157377_101283081 285
403 3300014968 Ga0157379_10047163 Ga0157379_100471631 285
404 3300014969 Ga0157376_10129922 Ga0157376_101299223 285
405 3300014969 Ga0157376_10167760 Ga0157376_101677602 285
406 3300017792 Ga0163161_10020600 Ga0163161_100206005 285
407 3300017792 Ga0163161_10089199 Ga0163161_100891992 285
408 3300017792 Ga0163161_10193274 Ga0163161_101932742 285
409 3300025899 Ga0207642_10006099 Ga0207642_100060994 285
410 3300025899 Ga0207642_10103891 Ga0207642_101038912 285
411 3300025900 Ga0207710_10007865 Ga0207710_100078654 285
412 3300025901 Ga0207688_10034972 Ga0207688_100349722 285
413 3300025903 Ga0207680_10087750 Ga0207680_100877502 285
414 3300025904 Ga0207647_10000988 Ga0207647_1000098832 285
415 3300025904 Ga0207647_10029961 Ga0207647_100299612 285
416 3300025907 Ga0207645_10005943 Ga0207645_100059438 285
417 3300025907 Ga0207645_10009020 Ga0207645_100090203 285
418 3300025907 Ga0207645_10077619 Ga0207645_100776193 285
419 3300025907 Ga0207645_10143876 Ga0207645_101438761 285
420 3300025908 Ga0207643_10006271 Ga0207643_100062713 285
421 3300025911 Ga0207654_10153253 Ga0207654_101532532 285
422 3300025912 Ga0207707_10012028 Ga0207707_100120288 285
423 3300025913 Ga0207695_10038847 Ga0207695_100388472 285
424 3300025913 Ga0207695_10045424 Ga0207695_100454244 285
425 3300025913 Ga0207695_10045638 Ga0207695_100456384 285
426 3300025914 Ga0207671_10003985 Ga0207671_1000398511 285
427 3300025918 Ga0207662_10022813 Ga0207662_100228133 285
428 3300025918 Ga0207662_10081303 Ga0207662_100813033 285
429 3300025920 Ga0207649_10048701 Ga0207649_100487012 285
430 3300025920 Ga0207649_10113493 Ga0207649_101134931 285
431 3300025920 Ga0207649_10282129 Ga0207649_102821291 285
432 3300025923 Ga0207681_10046332 Ga0207681_100463322 285
433 3300025925 Ga0207650_10004584 Ga0207650_100045846 285
434 3300025925 Ga0207650_10013375 Ga0207650_100133758 285
435 3300025925 Ga0207650_10035392 Ga0207650_100353924 285
436 3300025925 Ga0207650_10228083 Ga0207650_102280831 285
437 3300025925 Ga0207650_10235119 Ga0207650_102351191 285
438 3300025925 Ga0207650_10253565 Ga0207650_102535651 285
439 3300025926 Ga0207659_10059732 Ga0207659_100597324 285
440 3300025926 Ga0207659_10061397 Ga0207659_100613973 285
441 3300025926 Ga0207659_10075625 Ga0207659_100756251 285
442 3300025926 Ga0207659_10269293 Ga0207659_102692931 285
443 3300025931 Ga0207644_10117869 Ga0207644_101178692 285
444 3300025931 Ga0207644_10177274 Ga0207644_101772742 285
445 3300025931 Ga0207644_10190364 Ga0207644_101903642 285
446 3300025932 Ga0207690_10169661 Ga0207690_101696611 285
447 3300025933 Ga0207706_10024096 Ga0207706_100240965 285
448 3300025936 Ga0207670_10005679 Ga0207670_100056792 285
449 3300025936 Ga0207670_10103032 Ga0207670_101030322 285
450 3300025936 Ga0207670_10113090 Ga0207670_101130902 285
451 3300025938 Ga0207704_10215667 Ga0207704_102156671 285
452 3300025940 Ga0207691_10036383 Ga0207691_100363832 285
453 3300025940 Ga0207691_10164519 Ga0207691_101645192 285
454 3300025942 Ga0207689_10012068 Ga0207689_100120689 285
455 3300025942 Ga0207689_10036012 Ga0207689_100360122 285
456 3300025942 Ga0207689_10089859 Ga0207689_100898593 285
457 3300025944 Ga0207661_10043402 Ga0207661_100434022 285
458 3300025945 Ga0207679_10067552 Ga0207679_100675523 285
459 3300025945 Ga0207679_10208953 Ga0207679_102089532 285
460 3300025949 Ga0207667_10000419 Ga0207667_100004199 285
461 3300025960 Ga0207651_10023076 Ga0207651_100230765 285
462 3300025960 Ga0207651_10035166 Ga0207651_100351663 285
463 3300025961 Ga0207712_10001641 Ga0207712_1000164113 285
464 3300025961 Ga0207712_10001938 Ga0207712_100019385 285
465 3300025961 Ga0207712_10002372 Ga0207712_100023726 285
466 3300025972 Ga0207668_10144150 Ga0207668_101441501 285
467 3300025981 Ga0207640_10011600 Ga0207640_100116002 285
468 3300025981 Ga0207640_10044473 Ga0207640_100444733 285
469 3300025981 Ga0207640_10319859 Ga0207640_103198592 285
470 3300025986 Ga0207658_10177109 Ga0207658_101771092 285
471 3300026023 Ga0207677_10004653 Ga0207677_100046534 285
472 3300026023 Ga0207677_10183465 Ga0207677_101834651 285
473 3300026023 Ga0207677_10390406 Ga0207677_103904061 285
474 3300026023 Ga0207677_10495012 Ga0207677_104950121 285
475 3300026035 Ga0207703_10220236 Ga0207703_102202362 285
476 3300026035 Ga0207703_10275059 Ga0207703_102750591 285
477 3300026041 Ga0207639_10098869 Ga0207639_100988692 285
478 3300026041 Ga0207639_10216017 Ga0207639_102160172 285
479 3300026041 Ga0207639_10434971 Ga0207639_104349711 285
480 3300026067 Ga0207678_10029562 Ga0207678_100295623 285
481 3300026075 Ga0207708_10051481 Ga0207708_100514812 285
482 3300026078 Ga0207702_10036343 Ga0207702_100363433 285
483 3300026078 Ga0207702_10400771 Ga0207702_104007711 285
484 3300026088 Ga0207641_10000730 Ga0207641_100007309 285
485 3300026088 Ga0207641_10029778 Ga0207641_100297784 285
486 3300026088 Ga0207641_10095484 Ga0207641_100954843 285
487 3300026089 Ga0207648_10008178 Ga0207648_100081787 285
488 3300026089 Ga0207648_10016701 Ga0207648_100167017 285
489 3300026089 Ga0207648_10025061 Ga0207648_100250616 285
490 3300026089 Ga0207648_10042119 Ga0207648_100421193 285
491 3300026089 Ga0207648_10224246 Ga0207648_102242462 285
492 3300026095 Ga0207676_10008125 Ga0207676_100081253 285
493 3300026095 Ga0207676_10195523 Ga0207676_101955232 285
494 3300026116 Ga0207674_10015776 Ga0207674_100157768 285
495 3300026116 Ga0207674_10021519 Ga0207674_100215198 285
496 3300026116 Ga0207674_10022873 Ga0207674_100228738 285
497 3300026116 Ga0207674_10051391 Ga0207674_100513914 285
498 3300026118 Ga0207675_100031951 Ga0207675_1000319513 285
499 3300026118 Ga0207675_100060240 Ga0207675_1000602403 285
500 3300026118 Ga0207675_100101239 Ga0207675_1001012394 285
501 3300026118 Ga0207675_100228341 Ga0207675_1002283412 285
502 3300026121 Ga0207683_10004324 Ga0207683_100043245 285
503 3300026121 Ga0207683_10011177 Ga0207683_100111777 285
504 3300026142 Ga0207698_10007210 Ga0207698_100072105 285
505 3300026142 Ga0207698_10050386 Ga0207698_100503863 285
506 3300026142 Ga0207698_10398620 Ga0207698_103986202 285
507 3300028379 Ga0268266_10068183 Ga0268266_100681831 285
508 3300028379 Ga0268266_10282131 Ga0268266_102821311 285
509 3300028380 Ga0268265_10200528 Ga0268265_102005281 285
510 3300028380 Ga0268265_10205583 Ga0268265_102055833 285
511 3300028381 Ga0268264_10056103 Ga0268264_100561032 285
512 3300031247 Ga0265340_10089548 Ga0265340_100895482 285
513 3300032005 Ga0307411_10306347 Ga0307411_103063472 285
514 3300032005 Ga0307411_10339218 Ga0307411_103392181 285
515 3300033179 Ga0307507_10000170 Ga0307507_1000017026 285
516 3300036401 Ga0373937_0043275 Ga0373937_0043275_1653_2612 285
517 3300037418 Ga0395900_0117419 Ga0395900_0117419_416_1381 285
518 3300037471 Ga0395905_0000001 Ga0395905_0000001_436877_437854 285
519 3300037471 Ga0395905_0016411 Ga0395905_0016411_5082_6047 285
520 3300037471 Ga0395905_0083520 Ga0395905_0083520_12_977 285
521 3300038443 Ga0395901_0003783 Ga0395901_0003783_11941_12921 285
522 3300042007 Ga0439449_0010736 Ga0439449_0010736_1393_2358 285
523 3300042125 Ga0450923_002279 Ga0450923_002279_1372_2331 285
524 3300042131 Ga0450894_004100 Ga0450894_004100_831_1796 285
525 3300042134 Ga0450898_004923 Ga0450898_004923_1018_1983 285
526 3300045051 Ga0451576_0000003 Ga0451576_0000003_1516999_1517979 285
527 3300046511 Ga0495608_0062593 Ga0495608_0062593_1424_2383 285
528 3300046516 Ga0495628_0013015 Ga0495628_0013015_5866_6825 285
529 3300046517 Ga0495630_0021568 Ga0495630_0021568_1205_2164 285
530 3300046535 Ga0495586_0017743 Ga0495586_0017743_888_1847 285
531 3300046537 Ga0495598_0022800 Ga0495598_0022800_75_1034 285
532 3300046642 Ga0495634_0071196 Ga0495634_0071196_1150_2109 285
533 3300046663 Ga0495635_0016878 Ga0495635_0016878_573_1532 285
534 3300046675 Ga0495657_0109673 Ga0495657_0109673_190_1149 285
535 3300046689 Ga0495613_0023524 Ga0495613_0023524_742_1701 285
536 3300047320 Ga0495672_0012808 Ga0495672_0012808_2645_3607 285
537 3300047320 Ga0495672_0072999 Ga0495672_0072999_304_1269 285
538 3300047472 Ga0495686_0007933 Ga0495686_0007933_2140_3105 285
539 3300047472 Ga0495686_0019848 Ga0495686_0019848_1770_2735 285
540 3300048913 Ga0496110_0076570 Ga0496110_0076570_544_1503 285
541 3300049513 Ga0501290_002932 Ga0501290_002932_715_1755 285
542 3300049516 Ga0501293_002582 Ga0501293_002582_53_1093 285
543 3300049568 Ga0501031_0001600 Ga0501031_0001600_11981_12946 285
544 3300049569 Ga0501032_0050991 Ga0501032_0050991_1049_2014 285
545 3300049569 Ga0501032_0065140 Ga0501032_0065140_334_1299 285
546 3300049571 Ga0501034_0050622 Ga0501034_0050622_810_1775 285
547 3300049571 Ga0501034_0087078 Ga0501034_0087078_919_1884 285
548 3300049572 Ga0501036_0005556 Ga0501036_0005556_1416_2381 285
549 3300049572 Ga0501036_0005726 Ga0501036_0005726_1584_2549 285
550 3300049573 Ga0501037_0027053 Ga0501037_0027053_1915_2880 285
551 3300049574 Ga0501038_0034595 Ga0501038_0034595_2218_3183 285
552 3300049575 Ga0501039_0005269 Ga0501039_0005269_6566_7531 285
553 3300049579 Ga0501043_0015546 Ga0501043_0015546_3487_4452 285
554 3300049579 Ga0501043_0037488 Ga0501043_0037488_1530_2495 285
555 3300049579 Ga0501043_0075016 Ga0501043_0075016_170_1138 285
556 3300049580 Ga0501046_0039611 Ga0501046_0039611_851_1816 285
557 3300049580 Ga0501046_0094373 Ga0501046_0094373_343_1308 285
558 3300049581 Ga0501047_0027972 Ga0501047_0027972_1537_2502 285
559 3300049588 Ga0501072_0058117 Ga0501072_0058117_864_1823 285
560 3300049589 Ga0501073_0023518 Ga0501073_0023518_1936_2901 285
561 3300049590 Ga0501074_0000591 Ga0501074_0000591_16894_17859 285
562 3300049649 Ga0501198_002065 Ga0501198_002065_746_1786 285
563 3300049663 Ga0501223_002142 Ga0501223_002142_2303_3343 285
564 3300049668 Ga0501233_004133 Ga0501233_004133_525_1565 285
565 3300049669 Ga0501235_016090 Ga0501235_016090_624_1589 285
566 3300049675 Ga0501243_004110 Ga0501243_004110_25_990 285
567 3300049682 Ga0501252_002421 Ga0501252_002421_169_1218 285
568 3300049688 Ga0501259_002506 Ga0501259_002506_715_1677 285
569 3300049688 Ga0501259_002880 Ga0501259_002880_128_1177 285
570 3300049705 Ga0501225_0001741 Ga0501225_0001741_2676_3716 285
571 3300049707 Ga0501234_000344 Ga0501234_000344_1085_2134 285
572 3300049707 Ga0501234_012990 Ga0501234_012990_12_977 285
573 3300049742 Ga0501080_0111345 Ga0501080_0111345_399_1364 285
574 3300049763 Ga0501266_002788 Ga0501266_002788_25_987 285
575 3300049768 Ga0501271_005263 Ga0501271_005263_28_1077 285
576 3300049822 Ga0501035_0057398 Ga0501035_0057398_2035_3000 285
577 3300049823 Ga0501044_0035878 Ga0501044_0035878_2563_3528 285
578 3300049823 Ga0501044_0166347 Ga0501044_0166347_357_1322 285
579 3300050005 Ga0501284_00033 Ga0501284_00033_40930_41895 285
580 3300050493 nmdc:mga0k408_48831_c1 nmdc:mga0k408_48831_c1_413_1378 285
581 3300050507 nmdc:mga05p37_222343_c1 nmdc:mga05p37_222343_c1_505_1464 285
582 3300050508 nmdc:mga09592_105905_c1 nmdc:mga09592_105905_c1_165_1124 285
583 3300050509 nmdc:mga0qj67_34474_c1 nmdc:mga0qj67_34474_c1_2218_3177 285
584 3300050511 nmdc:mga08y16_533070_c1 nmdc:mga08y16_533070_c1_186_1145 285
585 3300053139 Ga0500568_0002946 Ga0500568_0002946_4442_5404 285
586 3300053727 Ga0500611_000011 Ga0500611_000011_95262_96227 285
587 3300054114 Ga0501084_0092724 Ga0501084_0092724_1011_1976 285
588 2162886007 SwRhRL2b_contig_1762462 SwRhRL2b_0592.00004040 286
589 3300001990 JGI24737J22298_10000171 JGI24737J22298_100001711 286
590 3300002067 JGI24735J21928_10000006 JGI24735J21928_100000065 286
591 3300002737 JGI25162J39368_1000180 JGI25162J39368_100018048 286
592 3300003316 rootH1_10084579 rootH1_100845792 286
593 3300003320 rootH2_10016295 rootH2_1001629525 286
594 3300003320 rootH2_10295593 rootH2_102955932 286
595 3300003322 rootL2_10004550 rootL2_100045505 286
596 3300003323 rootH1_10010249 rootH1_100102493 286
597 3300003323 rootH1_10187770 rootH1_101877704 286
598 3300005289 Ga0065704_10000188 Ga0065704_10000188214 286
599 3300005456 Ga0070678_100135362 Ga0070678_1001353622 286
600 3300005548 Ga0070665_100003187 Ga0070665_10000318713 286
601 3300005563 Ga0068855_100124705 Ga0068855_1001247052 286
602 3300005578 Ga0068854_100079315 Ga0068854_1000793152 286
603 3300005614 Ga0068856_100544908 Ga0068856_1005449082 286
604 3300006195 Ga0075366_10009372 Ga0075366_100093726 286
605 3300009093 Ga0105240_10324552 Ga0105240_103245522 286
606 3300009545 Ga0105237_10002313 Ga0105237_100023137 286
607 3300009545 Ga0105237_10025406 Ga0105237_100254064 286
608 3300009545 Ga0105237_10037120 Ga0105237_100371202 286
609 3300010375 Ga0105239_10000190 Ga0105239_1000019067 286
610 3300010375 Ga0105239_10004108 Ga0105239_1000410813 286
611 3300010375 Ga0105239_10459259 Ga0105239_104592591 286
612 3300013102 Ga0157371_10013504 Ga0157371_100135042 286
613 3300013297 Ga0157378_10055697 Ga0157378_100556972 286
614 3300013297 Ga0157378_10073212 Ga0157378_100732122 286
615 3300013306 Ga0163162_10043246 Ga0163162_100432465 286
616 3300013307 Ga0157372_10041645 Ga0157372_100416452 286
617 3300013307 Ga0157372_10184526 Ga0157372_101845262 286
618 3300014326 Ga0157380_10000466 Ga0157380_1000046620 286
619 3300025233 Ga0209437_100148 Ga0209437_10014815 286
620 3300025904 Ga0207647_10131530 Ga0207647_101315302 286
621 3300025914 Ga0207671_10000130 Ga0207671_1000013084 286
622 3300025914 Ga0207671_10001167 Ga0207671_100011677 286
623 3300025914 Ga0207671_10023941 Ga0207671_100239413 286
624 3300025949 Ga0207667_10096730 Ga0207667_100967302 286
625 3300026078 Ga0207702_10008491 Ga0207702_100084912 286
626 3300028379 Ga0268266_10002951 Ga0268266_1000295110 286
627 3300028573 Ga0265334_10017059 Ga0265334_100170593 286
628 3300028794 Ga0307515_10002152 Ga0307515_100021526 286
629 3300028794 Ga0307515_10002588 Ga0307515_1000258827 286
630 3300031251 Ga0265327_10000022 Ga0265327_10000022177 286
631 3300031251 Ga0265327_10023225 Ga0265327_100232252 286
632 3300037312 Ga0395899_0000025 Ga0395899_0000025_123746_124726 286
633 3300037418 Ga0395900_0194251 Ga0395900_0194251_878_1861 286
634 3300037471 Ga0395905_0000580 Ga0395905_0000580_26927_27904 286
635 3300044712 Ga0453684_0003103 Ga0453684_0003103_8355_9326 286
636 3300044765 Ga0466970_0034986 Ga0466970_0034986_1308_2285 286
637 3300046471 Ga0495650_0000238 Ga0495650_0000238_82059_83036 286
638 3300046474 Ga0495605_0082384 Ga0495605_0082384_247_1224 286
639 3300046492 Ga0495585_0000585 Ga0495585_0000585_11685_12662 286
640 3300046492 Ga0495585_0001267 Ga0495585_0001267_14096_15073 286
641 3300046507 Ga0495606_0000008 Ga0495606_0000008_308875_309852 286
642 3300046512 Ga0495610_0001853 Ga0495610_0001853_5352_6404 286
643 3300046512 Ga0495610_0109259 Ga0495610_0109259_189_1166 286
644 3300046513 Ga0495616_0006304 Ga0495616_0006304_5898_6935 286
645 3300046513 Ga0495616_0007243 Ga0495616_0007243_4757_5734 286
646 3300046513 Ga0495616_0059868 Ga0495616_0059868_783_1760 286
647 3300046520 Ga0495637_0069894 Ga0495637_0069894_242_1219 286
648 3300046524 Ga0495648_0010757 Ga0495648_0010757_3717_4694 286
649 3300046524 Ga0495648_0036130 Ga0495648_0036130_1759_2736 286
650 3300046538 Ga0495609_0001651 Ga0495609_0001651_9418_10395 286
651 3300046538 Ga0495609_0029633 Ga0495609_0029633_1459_2436 286
652 3300046558 Ga0495633_0000388 Ga0495633_0000388_37906_38883 286
653 3300046558 Ga0495633_0046683 Ga0495633_0046683_528_1580 286
654 3300046616 Ga0495668_0000127 Ga0495668_0000127_91824_92801 286
655 3300046660 Ga0495625_0000017 Ga0495625_0000017_9358_10395 286
656 3300046660 Ga0495625_0000691 Ga0495625_0000691_29293_30270 286
657 3300046660 Ga0495625_0001121 Ga0495625_0001121_11731_12708 286
658 3300046660 Ga0495625_0010781 Ga0495625_0010781_1240_2217 286
659 3300046660 Ga0495625_0088404 Ga0495625_0088404_1054_2031 286
660 3300046665 Ga0495661_0016032 Ga0495661_0016032_3130_4107 286
661 3300046683 Ga0495658_0034975 Ga0495658_0034975_584_1561 286
662 3300046694 Ga0495649_0000008 Ga0495649_0000008_261112_262149 286
663 3300046794 Ga0495589_0107703 Ga0495589_0107703_109_1086 286
664 3300047443 Ga0495687_002605 Ga0495687_002605_132_1109 286
665 3300047469 Ga0495673_0010133 Ga0495673_0010133_1198_2175 286
666 3300047472 Ga0495686_0000299 Ga0495686_0000299_54383_55360 286
667 3300047472 Ga0495686_0056490 Ga0495686_0056490_439_1416 286
668 3300048918 Ga0496115_0001812 Ga0496115_0001812_1137_2114 286
669 3300049571 Ga0501034_0014477 Ga0501034_0014477_3249_4220 286
670 3300050493 nmdc:mga0k408_6928_c1 nmdc:mga0k408_6928_c1_2432_3409 286
671 3300053123 Ga0500614_037545 Ga0500614_037545_125_1102 286
672 3300053125 Ga0500618_000009 Ga0500618_000009_179667_180677 286
673 3300053136 Ga0500559_0010090 Ga0500559_0010090_2569_3603 286
674 3300053156 Ga0500622_0001133 Ga0500622_0001133_17503_18480 286
675 2162886007 SwRhRL2b_contig_1411852 SwRhRL2b_0097.00004800 287
676 3300005288 Ga0065714_10002212 Ga0065714_1000221242 287
677 3300005288 Ga0065714_10065485 Ga0065714_1006548510 287
678 3300005288 Ga0065714_10083187 Ga0065714_100831872 287
679 3300005289 Ga0065704_10000193 Ga0065704_1000019340 287
680 3300005719 Ga0068861_100280177 Ga0068861_1002801772 287
681 3300013100 Ga0157373_10000121 Ga0157373_1000012141 287
682 3300013102 Ga0157371_10002317 Ga0157371_100023179 287
683 3300013102 Ga0157371_10004753 Ga0157371_100047532 287
684 3300013104 Ga0157370_10002315 Ga0157370_100023155 287
685 3300013104 Ga0157370_10006844 Ga0157370_100068445 287
686 3300013104 Ga0157370_10036657 Ga0157370_100366574 287
687 3300014497 Ga0182008_10000018 Ga0182008_10000018161 287
688 3300014497 Ga0182008_10000378 Ga0182008_1000037821 287
689 3300014968 Ga0157379_10221478 Ga0157379_102214782 287
690 3300015261 Ga0182006_1000382 Ga0182006_10003828 287
691 3300015261 Ga0182006_1009184 Ga0182006_10091844 287
692 3300017792 Ga0163161_10001631 Ga0163161_100016312 287
693 3300026118 Ga0207675_100351759 Ga0207675_1003517592 287
694 3300031911 Ga0307412_10000077 Ga0307412_1000007749 287
695 3300032004 Ga0307414_10000967 Ga0307414_100009675 287
696 3300032004 Ga0307414_10001475 Ga0307414_1000147511 287
697 3300032004 Ga0307414_10132054 Ga0307414_101320542 287
698 3300046506 Ga0495583_0060132 Ga0495583_0060132_259_1236 287
699 3300046507 Ga0495606_0166249 Ga0495606_0166249_197_1174 287
700 3300046665 Ga0495661_0008349 Ga0495661_0008349_4202_5179 287
701 3300048925 Ga0496122_0000746 Ga0496122_0000746_24355_25326 287
702 3300048926 Ga0496123_0037741 Ga0496123_0037741_1304_2275 287
703 3300048928 Ga0496125_0102632 Ga0496125_0102632_888_1859 287
704 3300053093 Ga0500651_0000127 Ga0500651_0000127_23952_24923 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

223

303

0.98

PF01012

ETF

Electron transfer flavoprotein domain

31

206

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9005 1 149
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.88 1 146
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.8639 2 146
7qh2-assembly1.cif.gz_E cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.7991 3 147
5ol2-assembly2.cif.gz_E the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile 0.7817 1 148
ID Description Score Start End Superfamily
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9769 158 287 3.40.50.1220
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9552 158 287 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9349 157 283 3.40.50.1220
1o97D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9172 169 285 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9138 157 283 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A2N2ZBZ4-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9906 174 286 GO:0009055
GO:0033539
GO:0050660
AF-A0A662D2H4-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9903 180 287 GO:0009055
GO:0033539
GO:0050660
AF-X0S2B0-F1-model_v4 Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein 0.9898 163 286 GO:0009055
GO:0033539
GO:0050660
AF-A0A6J7HL09-F1-model_v4 Unannotated protein 0.9897 171 284 GO:0009055
GO:0033539
GO:0050660
AF-A0A355RCY1-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9886 177 282 GO:0009055
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
88.19 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map