F476382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 351 | 647 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300049682|Ga0501252_002421|Ga0501252_002421_169_1218 |
| Length | 349 |
| Sequence | MQQLFNIITEACSQKISIVKSSNFQINSMSVLIFIDHTDGHIKKASLEALSYGAKVAGQTGDTAEGVILGTTNEDLGGLGQYGVKKIHQVENDSLKSFDAQAYAKVVTQVAEQTGAKVVIFSNNSSGKNIAPRVAVRLKAGLVSGAVALPDTSNGFVVKKNVFSGKAFAHVTINTEIKVIALNVNSFALNVVEGKAEVVVFNTTVDVPKTKIVSTSKTSGSISLSEAEVVVSAGRGLKGPENWAMVEELAGVLGAALACSRPVADAHWRPHNEHVGQTGIAIAPNLYIAIGISGAIQHLAGVNRSKVIVVINKDAEAPFFKAADYGIVGDAFEIVPKLTQAIKKQKGIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 4 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 5 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 6 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 7 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 8 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 9 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 10 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 11 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 12 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 13 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 14 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 15 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 16 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 17 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 18 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 19 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 20 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 21 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 22 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 23 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 24 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 25 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 26 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 27 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 28 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 29 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 30 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 31 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 32 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 33 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 34 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 35 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 36 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 37 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 38 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 39 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 40 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 41 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 42 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 43 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 44 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 45 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 46 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 47 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 48 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 49 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 50 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 51 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 52 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 53 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 54 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 55 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 56 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 57 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 58 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 59 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 60 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 61 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 62 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 66 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 67 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 68 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 69 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 70 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 74 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 81 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 108 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 112 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 114 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 115 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 116 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 117 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 118 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 119 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 120 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 121 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 122 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 234 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 235 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 238 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 239 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 297 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 298 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 313 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 314 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 318 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 320 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 326 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 328 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 341 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 342 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 343 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 348 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 349 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.48 |
| Metatranscriptomes | 0.28 |
| Isolates | 8.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 2.7 |
| Nodule | 0.14 |
| Rhizoplane | 0.71 |
| Rhizosphere | 87.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1411852 | 2162886007 | Bacteria | 14549 |
| 2 | SwRhRL2b_contig_1762462 | 2162886007 | Bacteria | 256265 |
| 3 | SwRhRL2b_contig_2062776 | 2162886007 | Bacteria | 1690 |
| 4 | MRS1b_contig_8964951 | 2162886011 | Bacteria | 1803 |
| 5 | JGI24741J21665_1006007 | 3300001915 | Bacteria | 2478 |
| 6 | JGI24737J22298_10000171 | 3300001990 | Bacteria | 20929 |
| 7 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 8 | JGI25162J39368_1000180 | 3300002737 | Bacteria | 67985 |
| 9 | rootH1_10084579 | 3300003316 | Bacteria | 3929 |
| 10 | rootH1_10084579 | 3300003323 | Bacteria | 3180 |
| 11 | rootH1_10166102 | 3300003316 | Bacteria | 2807 |
| 12 | rootH2_10016295 | 3300003320 | Bacteria | 51846 |
| 13 | rootH2_10196964 | 3300003320 | Bacteria | 1808 |
| 14 | rootH2_10295593 | 3300003320 | Bacteria | 1861 |
| 15 | rootL2_10004550 | 3300003322 | Bacteria | 2778 |
| 16 | rootL2_10089539 | 3300003322 | Bacteria | 11365 |
| 17 | rootL2_10138794 | 3300003322 | Bacteria | 3550 |
| 18 | rootL2_10171436 | 3300003322 | Bacteria | 4725 |
| 19 | rootL2_10179839 | 3300003322 | Bacteria | 2946 |
| 20 | rootH1_10010249 | 3300003323 | Bacteria | 10054 |
| 21 | rootH1_10044553 | 3300003323 | Bacteria | 13117 |
| 22 | rootH1_10187770 | 3300003323 | Bacteria | 4696 |
| 23 | rootH1_10193885 | 3300003323 | Bacteria | 1161 |
| 24 | Ga0006562J51391_1004223 | 3300003578 | Bacteria | 3015 |
| 25 | Ga0055534_1005024 | 3300003784 | Bacteria | 3656 |
| 26 | Ga0065714_10002212 | 3300005288 | Bacteria | 56085 |
| 27 | Ga0065714_10065485 | 3300005288 | Bacteria | 9793 |
| 28 | Ga0065714_10070550 | 3300005288 | Bacteria | 3836 |
| 29 | Ga0065714_10083187 | 3300005288 | Bacteria | 2257 |
| 30 | Ga0065704_10000188 | 3300005289 | Bacteria | 267216 |
| 31 | Ga0065704_10000193 | 3300005289 | Bacteria | 203271 |
| 32 | Ga0065704_10079391 | 3300005289 | Bacteria | 4177 |
| 33 | Ga0065704_10079664 | 3300005289 | Bacteria | 4106 |
| 34 | Ga0065712_10001395 | 3300005290 | Bacteria | 7623 |
| 35 | Ga0065712_10004793 | 3300005290 | Bacteria | 3813 |
| 36 | Ga0065715_10104240 | 3300005293 | Unclassified | 2978 |
| 37 | Ga0065707_10101916 | 3300005295 | Bacteria | 2838 |
| 38 | Ga0070676_10038836 | 3300005328 | Bacteria | 2751 |
| 39 | Ga0070683_100002228 | 3300005329 | Bacteria | 15359 |
| 40 | Ga0070683_100006944 | 3300005329 | Bacteria | 9518 |
| 41 | Ga0070683_100023606 | 3300005329 | Bacteria | 5502 |
| 42 | Ga0070683_100256092 | 3300005329 | Unclassified | 1665 |
| 43 | Ga0070683_100301568 | 3300005329 | Bacteria | 1524 |
| 44 | Ga0070690_100027165 | 3300005330 | Bacteria | 3537 |
| 45 | Ga0070690_100176209 | 3300005330 | Bacteria | 1475 |
| 46 | Ga0070670_100004989 | 3300005331 | Bacteria | 11167 |
| 47 | Ga0070670_100050676 | 3300005331 | Bacteria | 3567 |
| 48 | Ga0070670_100076556 | 3300005331 | Bacteria | 2875 |
| 49 | Ga0068869_100001288 | 3300005334 | Bacteria | 14839 |
| 50 | Ga0068869_100025626 | 3300005334 | Bacteria | 4096 |
| 51 | Ga0068869_100139809 | 3300005334 | Bacteria | 1869 |
| 52 | Ga0070666_10111904 | 3300005335 | Bacteria | 1888 |
| 53 | Ga0070682_100042657 | 3300005337 | Bacteria | 2802 |
| 54 | Ga0070682_100199376 | 3300005337 | Bacteria | 1411 |
| 55 | Ga0068868_100004534 | 3300005338 | Bacteria | 9749 |
| 56 | Ga0068868_100038212 | 3300005338 | Bacteria | 3726 |
| 57 | Ga0068868_100105694 | 3300005338 | Bacteria | 2283 |
| 58 | Ga0068868_100223500 | 3300005338 | Bacteria | 1577 |
| 59 | Ga0070689_100003775 | 3300005340 | Bacteria | 10144 |
| 60 | Ga0070689_100034123 | 3300005340 | Bacteria | 3881 |
| 61 | Ga0070689_100173822 | 3300005340 | Bacteria | 1746 |
| 62 | Ga0070689_100395705 | 3300005340 | Unclassified | 1167 |
| 63 | Ga0070687_100043718 | 3300005343 | Bacteria | 2278 |
| 64 | Ga0070687_100056043 | 3300005343 | Bacteria | 2061 |
| 65 | Ga0070661_100010109 | 3300005344 | Bacteria | 6554 |
| 66 | Ga0070668_100011326 | 3300005347 | Bacteria | 6644 |
| 67 | Ga0070668_100139384 | 3300005347 | Bacteria | 1953 |
| 68 | Ga0070668_100217632 | 3300005347 | Unclassified | 1574 |
| 69 | Ga0070669_100000874 | 3300005353 | Bacteria | 21974 |
| 70 | Ga0070669_100219157 | 3300005353 | Bacteria | 1504 |
| 71 | Ga0070675_100023401 | 3300005354 | Bacteria | 4939 |
| 72 | Ga0070675_100040444 | 3300005354 | Bacteria | 3806 |
| 73 | Ga0070675_100054876 | 3300005354 | Bacteria | 3279 |
| 74 | Ga0070675_100098547 | 3300005354 | Bacteria | 2459 |
| 75 | Ga0070675_100274360 | 3300005354 | Unclassified | 1480 |
| 76 | Ga0070675_100455540 | 3300005354 | Bacteria | 1148 |
| 77 | Ga0070674_100013146 | 3300005356 | Bacteria | 5106 |
| 78 | Ga0070673_100019243 | 3300005364 | Bacteria | 4900 |
| 79 | Ga0070673_100048333 | 3300005364 | Bacteria | 3316 |
| 80 | Ga0070673_100280301 | 3300005364 | Bacteria | 1462 |
| 81 | Ga0070688_100001369 | 3300005365 | Bacteria | 12108 |
| 82 | Ga0070688_100051441 | 3300005365 | Unclassified | 2570 |
| 83 | Ga0070659_100002840 | 3300005366 | Bacteria | 12323 |
| 84 | Ga0070659_100013207 | 3300005366 | Bacteria | 6142 |
| 85 | Ga0070667_100033888 | 3300005367 | Bacteria | 4272 |
| 86 | Ga0070667_100197088 | 3300005367 | Bacteria | 1786 |
| 87 | Ga0070678_100022366 | 3300005456 | Bacteria | 4188 |
| 88 | Ga0070678_100135362 | 3300005456 | Bacteria | 1964 |
| 89 | Ga0070662_100013466 | 3300005457 | Bacteria | 5444 |
| 90 | Ga0070662_100021109 | 3300005457 | Bacteria | 4444 |
| 91 | Ga0070662_100075421 | 3300005457 | Bacteria | 2497 |
| 92 | Ga0070681_10006746 | 3300005458 | Bacteria | 11175 |
| 93 | Ga0068867_100022653 | 3300005459 | Bacteria | 4492 |
| 94 | Ga0068867_100033639 | 3300005459 | Bacteria | 3714 |
| 95 | Ga0068867_100035811 | 3300005459 | Bacteria | 3601 |
| 96 | Ga0068867_100080041 | 3300005459 | Bacteria | 2460 |
| 97 | Ga0068867_100091658 | 3300005459 | Bacteria | 2307 |
| 98 | Ga0070685_10040904 | 3300005466 | Bacteria | 2640 |
| 99 | Ga0070685_10233509 | 3300005466 | Bacteria | 1211 |
| 100 | Ga0070698_100000936 | 3300005471 | Bacteria | 31949 |
| 101 | Ga0070698_100003346 | 3300005471 | Bacteria | 17650 |
| 102 | Ga0070684_100001451 | 3300005535 | Bacteria | 17095 |
| 103 | Ga0070684_100033002 | 3300005535 | Bacteria | 4417 |
| 104 | Ga0068853_100001183 | 3300005539 | Bacteria | 18575 |
| 105 | Ga0068853_100046722 | 3300005539 | Bacteria | 3713 |
| 106 | Ga0068853_100070624 | 3300005539 | Bacteria | 3040 |
| 107 | Ga0070672_100175560 | 3300005543 | Bacteria | 1783 |
| 108 | Ga0070686_100014676 | 3300005544 | Bacteria | 4520 |
| 109 | Ga0070686_100195727 | 3300005544 | Bacteria | 1446 |
| 110 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 111 | Ga0070665_100003187 | 3300005548 | Bacteria | 17651 |
| 112 | Ga0070704_100219681 | 3300005549 | Bacteria | 1544 |
| 113 | Ga0068855_100003016 | 3300005563 | Bacteria | 20598 |
| 114 | Ga0068855_100124705 | 3300005563 | Bacteria | 2946 |
| 115 | Ga0068855_100348302 | 3300005563 | Bacteria | 1632 |
| 116 | Ga0068855_100587769 | 3300005563 | Unclassified | 1202 |
| 117 | Ga0070664_100003972 | 3300005564 | Bacteria | 11895 |
| 118 | Ga0070664_100010568 | 3300005564 | Bacteria | 7482 |
| 119 | Ga0070664_100013148 | 3300005564 | Bacteria | 6739 |
| 120 | Ga0070664_100124706 | 3300005564 | Bacteria | 2258 |
| 121 | Ga0070664_100187689 | 3300005564 | Bacteria | 1841 |
| 122 | Ga0070664_100473572 | 3300005564 | Unclassified | 1152 |
| 123 | Ga0068857_100009246 | 3300005577 | Bacteria | 8549 |
| 124 | Ga0068857_100058936 | 3300005577 | Bacteria | 3410 |
| 125 | Ga0068857_100584040 | 3300005577 | Bacteria | 1055 |
| 126 | Ga0068854_100007114 | 3300005578 | Bacteria | 7145 |
| 127 | Ga0068854_100058975 | 3300005578 | Bacteria | 2772 |
| 128 | Ga0068854_100073472 | 3300005578 | Bacteria | 2506 |
| 129 | Ga0068854_100079315 | 3300005578 | Bacteria | 2420 |
| 130 | Ga0068854_100360845 | 3300005578 | Bacteria | 1192 |
| 131 | Ga0068856_100152701 | 3300005614 | Bacteria | 2318 |
| 132 | Ga0068856_100260275 | 3300005614 | Bacteria | 1750 |
| 133 | Ga0068856_100263112 | 3300005614 | Bacteria | 1740 |
| 134 | Ga0068856_100544908 | 3300005614 | Bacteria | 1181 |
| 135 | Ga0070702_100148462 | 3300005615 | Bacteria | 1502 |
| 136 | Ga0068852_100005008 | 3300005616 | Bacteria | 9424 |
| 137 | Ga0068852_100005930 | 3300005616 | Bacteria | 8785 |
| 138 | Ga0068852_100038113 | 3300005616 | Bacteria | 4037 |
| 139 | Ga0068852_100048616 | 3300005616 | Bacteria | 3625 |
| 140 | Ga0068859_100050663 | 3300005617 | Bacteria | 4171 |
| 141 | Ga0068859_100058045 | 3300005617 | Bacteria | 3898 |
| 142 | Ga0068859_100102936 | 3300005617 | Bacteria | 2913 |
| 143 | Ga0068859_100132306 | 3300005617 | Bacteria | 2566 |
| 144 | Ga0068859_100166052 | 3300005617 | Bacteria | 2287 |
| 145 | Ga0068859_100181666 | 3300005617 | Bacteria | 2186 |
| 146 | Ga0068859_100369522 | 3300005617 | Bacteria | 1530 |
| 147 | Ga0068864_100005936 | 3300005618 | Bacteria | 10014 |
| 148 | Ga0068864_100057224 | 3300005618 | Bacteria | 3368 |
| 149 | Ga0068864_100073871 | 3300005618 | Unclassified | 2974 |
| 150 | Ga0068864_100181639 | 3300005618 | Bacteria | 1924 |
| 151 | Ga0068866_10012173 | 3300005718 | Bacteria | 3745 |
| 152 | Ga0068866_10017509 | 3300005718 | Bacteria | 3223 |
| 153 | Ga0068861_100002657 | 3300005719 | Bacteria | 11700 |
| 154 | Ga0068861_100053413 | 3300005719 | Bacteria | 3074 |
| 155 | Ga0068861_100280177 | 3300005719 | Bacteria | 1435 |
| 156 | Ga0068851_10060841 | 3300005834 | Bacteria | 1934 |
| 157 | Ga0068870_10024468 | 3300005840 | Unclassified | 2988 |
| 158 | Ga0068863_100035606 | 3300005841 | Bacteria | 4740 |
| 159 | Ga0068863_100309792 | 3300005841 | Bacteria | 1532 |
| 160 | Ga0068860_100000006 | 3300005843 | Bacteria | 461966 |
| 161 | Ga0068860_100304548 | 3300005843 | Bacteria | 1562 |
| 162 | Ga0068862_100013727 | 3300005844 | Bacteria | 6713 |
| 163 | Ga0068862_100103861 | 3300005844 | Bacteria | 2489 |
| 164 | Ga0068862_100269983 | 3300005844 | Bacteria | 1555 |
| 165 | Ga0075366_10009372 | 3300006195 | Bacteria | 5463 |
| 166 | Ga0075366_10033092 | 3300006195 | Bacteria | 3045 |
| 167 | Ga0075428_100004467 | 3300006844 | Bacteria | 15439 |
| 168 | Ga0075428_100045987 | 3300006844 | Bacteria | 4795 |
| 169 | Ga0075428_100500532 | 3300006844 | Bacteria | 1300 |
| 170 | Ga0075430_100005032 | 3300006846 | Bacteria | 11126 |
| 171 | Ga0075431_100015087 | 3300006847 | Bacteria | 7824 |
| 172 | Ga0075431_100018066 | 3300006847 | Bacteria | 7173 |
| 173 | Ga0075433_10003668 | 3300006852 | Bacteria | 11871 |
| 174 | Ga0075429_100108610 | 3300006880 | Bacteria | 2425 |
| 175 | Ga0068865_100018228 | 3300006881 | Bacteria | 4528 |
| 176 | Ga0068865_100405711 | 3300006881 | Bacteria | 1117 |
| 177 | Ga0097620_100016642 | 3300006931 | Bacteria | 7382 |
| 178 | Ga0097620_100050660 | 3300006931 | Bacteria | 4171 |
| 179 | Ga0097620_100058044 | 3300006931 | Bacteria | 3898 |
| 180 | Ga0097620_100102944 | 3300006931 | Bacteria | 2913 |
| 181 | Ga0097620_100132315 | 3300006931 | Bacteria | 2566 |
| 182 | Ga0097620_100166062 | 3300006931 | Bacteria | 2287 |
| 183 | Ga0097620_100181670 | 3300006931 | Bacteria | 2186 |
| 184 | Ga0097620_100369492 | 3300006931 | Bacteria | 1530 |
| 185 | Ga0075435_100018506 | 3300007076 | Bacteria | 5300 |
| 186 | Ga0105244_10000049 | 3300009036 | Bacteria | 140190 |
| 187 | Ga0105240_10003256 | 3300009093 | Bacteria | 25386 |
| 188 | Ga0105240_10010049 | 3300009093 | Bacteria | 13326 |
| 189 | Ga0105240_10032954 | 3300009093 | Bacteria | 6699 |
| 190 | Ga0105240_10046443 | 3300009093 | Bacteria | 5503 |
| 191 | Ga0105240_10048728 | 3300009093 | Bacteria | 5352 |
| 192 | Ga0105240_10079202 | 3300009093 | Bacteria | 4044 |
| 193 | Ga0105240_10324552 | 3300009093 | Bacteria | 1753 |
| 194 | Ga0111539_10016041 | 3300009094 | Bacteria | 9300 |
| 195 | Ga0111539_10452493 | 3300009094 | Bacteria | 1495 |
| 196 | Ga0105247_10014759 | 3300009101 | Bacteria | 4683 |
| 197 | Ga0114129_10059718 | 3300009147 | Bacteria | 5331 |
| 198 | Ga0114129_10225572 | 3300009147 | Bacteria | 2525 |
| 199 | Ga0105243_10002732 | 3300009148 | Bacteria | 14670 |
| 200 | Ga0105241_10256888 | 3300009174 | Unclassified | 1484 |
| 201 | Ga0105242_10016107 | 3300009176 | Bacteria | 5809 |
| 202 | Ga0105242_10031148 | 3300009176 | Bacteria | 4258 |
| 203 | Ga0105242_10051408 | 3300009176 | Bacteria | 3358 |
| 204 | Ga0105237_10002313 | 3300009545 | Bacteria | 23676 |
| 205 | Ga0105237_10025406 | 3300009545 | Bacteria | 6058 |
| 206 | Ga0105237_10037120 | 3300009545 | Bacteria | 4927 |
| 207 | Ga0105237_10153726 | 3300009545 | Bacteria | 2297 |
| 208 | Ga0105237_10164721 | 3300009545 | Bacteria | 2216 |
| 209 | Ga0105238_10010139 | 3300009551 | Bacteria | 9450 |
| 210 | Ga0105249_10001693 | 3300009553 | Bacteria | 19305 |
| 211 | Ga0105249_10008239 | 3300009553 | Bacteria | 9076 |
| 212 | Ga0105249_10048976 | 3300009553 | Bacteria | 3853 |
| 213 | Ga0105249_10528850 | 3300009553 | Bacteria | 1227 |
| 214 | Ga0105239_10000190 | 3300010375 | Bacteria | 89155 |
| 215 | Ga0105239_10004108 | 3300010375 | Bacteria | 17496 |
| 216 | Ga0105239_10128503 | 3300010375 | Bacteria | 2817 |
| 217 | Ga0105239_10157001 | 3300010375 | Bacteria | 2541 |
| 218 | Ga0105239_10282818 | 3300010375 | Bacteria | 1867 |
| 219 | Ga0105239_10459259 | 3300010375 | Bacteria | 1445 |
| 220 | Ga0105246_10058498 | 3300011119 | Bacteria | 2670 |
| 221 | Ga0105246_10076639 | 3300011119 | Bacteria | 2370 |
| 222 | Ga0157373_10000107 | 3300013100 | Bacteria | 65161 |
| 223 | Ga0157373_10000121 | 3300013100 | Bacteria | 60158 |
| 224 | Ga0157371_10000201 | 3300013102 | Bacteria | 87780 |
| 225 | Ga0157371_10002317 | 3300013102 | Bacteria | 18296 |
| 226 | Ga0157371_10004753 | 3300013102 | Bacteria | 11717 |
| 227 | Ga0157371_10007473 | 3300013102 | Bacteria | 8844 |
| 228 | Ga0157371_10013504 | 3300013102 | Bacteria | 6199 |
| 229 | Ga0157371_10039565 | 3300013102 | Bacteria | 3372 |
| 230 | Ga0157371_10056805 | 3300013102 | Bacteria | 2776 |
| 231 | Ga0157370_10002315 | 3300013104 | Bacteria | 23062 |
| 232 | Ga0157370_10005377 | 3300013104 | Bacteria | 14378 |
| 233 | Ga0157370_10006844 | 3300013104 | Bacteria | 12487 |
| 234 | Ga0157370_10008393 | 3300013104 | Bacteria | 11142 |
| 235 | Ga0157370_10022329 | 3300013104 | Bacteria | 6296 |
| 236 | Ga0157370_10029298 | 3300013104 | Bacteria | 5406 |
| 237 | Ga0157370_10036657 | 3300013104 | Bacteria | 4757 |
| 238 | Ga0157370_10039262 | 3300013104 | Bacteria | 4575 |
| 239 | Ga0157369_10000759 | 3300013105 | Bacteria | 41636 |
| 240 | Ga0157369_10047939 | 3300013105 | Bacteria | 4637 |
| 241 | Ga0157374_10000411 | 3300013296 | Bacteria | 38796 |
| 242 | Ga0157374_10004791 | 3300013296 | Bacteria | 11352 |
| 243 | Ga0157374_10125752 | 3300013296 | Bacteria | 2478 |
| 244 | Ga0157374_10228006 | 3300013296 | Bacteria | 1829 |
| 245 | Ga0157374_10318835 | 3300013296 | Bacteria | 1540 |
| 246 | Ga0157378_10055697 | 3300013297 | Bacteria | 3522 |
| 247 | Ga0157378_10069191 | 3300013297 | Bacteria | 3166 |
| 248 | Ga0157378_10073212 | 3300013297 | Bacteria | 3080 |
| 249 | Ga0157378_10371451 | 3300013297 | Unclassified | 1402 |
| 250 | Ga0157378_10461484 | 3300013297 | Bacteria | 1262 |
| 251 | Ga0163162_10000355 | 3300013306 | Bacteria | 41762 |
| 252 | Ga0163162_10009885 | 3300013306 | Bacteria | 9277 |
| 253 | Ga0163162_10043246 | 3300013306 | Bacteria | 4511 |
| 254 | Ga0163162_10063705 | 3300013306 | Bacteria | 3730 |
| 255 | Ga0157372_10001647 | 3300013307 | Bacteria | 24243 |
| 256 | Ga0157372_10002968 | 3300013307 | Bacteria | 18277 |
| 257 | Ga0157372_10007563 | 3300013307 | Bacteria | 11552 |
| 258 | Ga0157372_10041645 | 3300013307 | Bacteria | 5078 |
| 259 | Ga0157372_10044507 | 3300013307 | Bacteria | 4919 |
| 260 | Ga0157372_10093380 | 3300013307 | Bacteria | 3424 |
| 261 | Ga0157372_10100160 | 3300013307 | Bacteria | 3306 |
| 262 | Ga0157372_10184526 | 3300013307 | Bacteria | 2415 |
| 263 | Ga0157372_10352147 | 3300013307 | Bacteria | 1715 |
| 264 | Ga0157372_10504270 | 3300013307 | Bacteria | 1411 |
| 265 | Ga0157375_10000759 | 3300013308 | Bacteria | 28326 |
| 266 | Ga0157375_10006455 | 3300013308 | Bacteria | 10216 |
| 267 | Ga0157375_10040868 | 3300013308 | Bacteria | 4474 |
| 268 | Ga0157375_10071769 | 3300013308 | Bacteria | 3477 |
| 269 | Ga0157375_10105335 | 3300013308 | Bacteria | 2910 |
| 270 | Ga0157375_10108483 | 3300013308 | Bacteria | 2871 |
| 271 | Ga0163163_10000261 | 3300014325 | Bacteria | 53342 |
| 272 | Ga0163163_10024337 | 3300014325 | Bacteria | 5762 |
| 273 | Ga0163163_10270258 | 3300014325 | Bacteria | 1751 |
| 274 | Ga0163163_10286702 | 3300014325 | Bacteria | 1699 |
| 275 | Ga0163163_10494458 | 3300014325 | Bacteria | 1285 |
| 276 | Ga0157380_10000466 | 3300014326 | Bacteria | 24697 |
| 277 | Ga0157380_10018714 | 3300014326 | Bacteria | 5148 |
| 278 | Ga0157380_10065958 | 3300014326 | Bacteria | 2911 |
| 279 | Ga0157380_10208958 | 3300014326 | Bacteria | 1738 |
| 280 | Ga0182008_10000011 | 3300014497 | Bacteria | 297770 |
| 281 | Ga0182008_10000018 | 3300014497 | Bacteria | 230609 |
| 282 | Ga0182008_10000378 | 3300014497 | Bacteria | 34433 |
| 283 | Ga0182008_10009150 | 3300014497 | Bacteria | 5360 |
| 284 | Ga0157377_10002452 | 3300014745 | Bacteria | 8203 |
| 285 | Ga0157377_10128308 | 3300014745 | Bacteria | 1545 |
| 286 | Ga0157379_10047163 | 3300014968 | Bacteria | 3843 |
| 287 | Ga0157379_10221478 | 3300014968 | Unclassified | 1714 |
| 288 | Ga0157376_10129922 | 3300014969 | Bacteria | 2246 |
| 289 | Ga0157376_10167760 | 3300014969 | Bacteria | 1996 |
| 290 | Ga0182006_1000012 | 3300015261 | Bacteria | 394239 |
| 291 | Ga0182006_1000382 | 3300015261 | Bacteria | 36661 |
| 292 | Ga0182006_1009184 | 3300015261 | Bacteria | 4442 |
| 293 | Ga0163161_10001631 | 3300017792 | Bacteria | 16494 |
| 294 | Ga0163161_10006037 | 3300017792 | Bacteria | 8395 |
| 295 | Ga0163161_10020600 | 3300017792 | Bacteria | 4630 |
| 296 | Ga0163161_10088946 | 3300017792 | Bacteria | 2283 |
| 297 | Ga0163161_10089199 | 3300017792 | Bacteria | 2280 |
| 298 | Ga0163161_10097987 | 3300017792 | Bacteria | 2178 |
| 299 | Ga0163161_10193274 | 3300017792 | Bacteria | 1565 |
| 300 | Ga0209437_100148 | 3300025233 | Bacteria | 158795 |
| 301 | Ga0209026_1002337 | 3300025250 | Bacteria | 7193 |
| 302 | Ga0209675_1000035 | 3300025291 | Bacteria | 255411 |
| 303 | Ga0207655_1000254 | 3300025728 | Bacteria | 85278 |
| 304 | Ga0207642_10006099 | 3300025899 | Bacteria | 3984 |
| 305 | Ga0207642_10103891 | 3300025899 | Bacteria | 1432 |
| 306 | Ga0207710_10007865 | 3300025900 | Unclassified | 4512 |
| 307 | Ga0207688_10034972 | 3300025901 | Bacteria | 2783 |
| 308 | Ga0207680_10087750 | 3300025903 | Bacteria | 1970 |
| 309 | Ga0207647_10000988 | 3300025904 | Bacteria | 22050 |
| 310 | Ga0207647_10001309 | 3300025904 | Bacteria | 19141 |
| 311 | Ga0207647_10029961 | 3300025904 | Bacteria | 3515 |
| 312 | Ga0207647_10131530 | 3300025904 | Bacteria | 1470 |
| 313 | Ga0207645_10005943 | 3300025907 | Bacteria | 8794 |
| 314 | Ga0207645_10009020 | 3300025907 | Bacteria | 6921 |
| 315 | Ga0207645_10077619 | 3300025907 | Bacteria | 2128 |
| 316 | Ga0207645_10143876 | 3300025907 | Bacteria | 1554 |
| 317 | Ga0207643_10006271 | 3300025908 | Bacteria | 6363 |
| 318 | Ga0207654_10153253 | 3300025911 | Unclassified | 1481 |
| 319 | Ga0207707_10012028 | 3300025912 | Bacteria | 7524 |
| 320 | Ga0207695_10000245 | 3300025913 | Bacteria | 141090 |
| 321 | Ga0207695_10022735 | 3300025913 | Bacteria | 7105 |
| 322 | Ga0207695_10038847 | 3300025913 | Bacteria | 5120 |
| 323 | Ga0207695_10045424 | 3300025913 | Bacteria | 4663 |
| 324 | Ga0207695_10045638 | 3300025913 | Bacteria | 4650 |
| 325 | Ga0207671_10000130 | 3300025914 | Bacteria | 117434 |
| 326 | Ga0207671_10001167 | 3300025914 | Bacteria | 31300 |
| 327 | Ga0207671_10003985 | 3300025914 | Bacteria | 14355 |
| 328 | Ga0207671_10023941 | 3300025914 | Bacteria | 4598 |
| 329 | Ga0207662_10022813 | 3300025918 | Bacteria | 3592 |
| 330 | Ga0207662_10081303 | 3300025918 | Bacteria | 1977 |
| 331 | Ga0207649_10048701 | 3300025920 | Bacteria | 2615 |
| 332 | Ga0207649_10113493 | 3300025920 | Unclassified | 1815 |
| 333 | Ga0207649_10282129 | 3300025920 | Bacteria | 1208 |
| 334 | Ga0207681_10046332 | 3300025923 | Unclassified | 2924 |
| 335 | Ga0207650_10004584 | 3300025925 | Bacteria | 9448 |
| 336 | Ga0207650_10013375 | 3300025925 | Bacteria | 5681 |
| 337 | Ga0207650_10035392 | 3300025925 | Bacteria | 3625 |
| 338 | Ga0207650_10228083 | 3300025925 | Bacteria | 1501 |
| 339 | Ga0207650_10235119 | 3300025925 | Bacteria | 1479 |
| 340 | Ga0207650_10253565 | 3300025925 | Bacteria | 1425 |
| 341 | Ga0207659_10059732 | 3300025926 | Bacteria | 2742 |
| 342 | Ga0207659_10061397 | 3300025926 | Bacteria | 2709 |
| 343 | Ga0207659_10075625 | 3300025926 | Unclassified | 2472 |
| 344 | Ga0207659_10269293 | 3300025926 | Bacteria | 1389 |
| 345 | Ga0207644_10117869 | 3300025931 | Bacteria | 2017 |
| 346 | Ga0207644_10177274 | 3300025931 | Bacteria | 1668 |
| 347 | Ga0207644_10190364 | 3300025931 | Bacteria | 1613 |
| 348 | Ga0207690_10027835 | 3300025932 | Unclassified | 3576 |
| 349 | Ga0207690_10169661 | 3300025932 | Bacteria | 1634 |
| 350 | Ga0207706_10024096 | 3300025933 | Archaea | 5458 |
| 351 | Ga0207709_10005255 | 3300025935 | Bacteria | 7363 |
| 352 | Ga0207670_10005679 | 3300025936 | Bacteria | 6869 |
| 353 | Ga0207670_10103032 | 3300025936 | Bacteria | 2042 |
| 354 | Ga0207670_10113090 | 3300025936 | Bacteria | 1960 |
| 355 | Ga0207704_10215667 | 3300025938 | Bacteria | 1416 |
| 356 | Ga0207691_10036383 | 3300025940 | Bacteria | 4561 |
| 357 | Ga0207691_10164519 | 3300025940 | Bacteria | 1944 |
| 358 | Ga0207689_10012068 | 3300025942 | Bacteria | 7402 |
| 359 | Ga0207689_10036012 | 3300025942 | Bacteria | 4108 |
| 360 | Ga0207689_10089859 | 3300025942 | Bacteria | 2523 |
| 361 | Ga0207661_10004373 | 3300025944 | Bacteria | 9903 |
| 362 | Ga0207661_10043402 | 3300025944 | Bacteria | 3548 |
| 363 | Ga0207661_10212879 | 3300025944 | Bacteria | 1704 |
| 364 | Ga0207679_10003487 | 3300025945 | Bacteria | 9726 |
| 365 | Ga0207679_10067552 | 3300025945 | Bacteria | 2682 |
| 366 | Ga0207679_10208953 | 3300025945 | Bacteria | 1636 |
| 367 | Ga0207667_10000419 | 3300025949 | Bacteria | 57239 |
| 368 | Ga0207667_10008361 | 3300025949 | Bacteria | 12300 |
| 369 | Ga0207667_10096730 | 3300025949 | Bacteria | 3047 |
| 370 | Ga0207651_10023076 | 3300025960 | Bacteria | 3819 |
| 371 | Ga0207651_10035166 | 3300025960 | Bacteria | 3254 |
| 372 | Ga0207712_10001641 | 3300025961 | Bacteria | 15072 |
| 373 | Ga0207712_10001938 | 3300025961 | Bacteria | 13589 |
| 374 | Ga0207712_10002372 | 3300025961 | Bacteria | 12208 |
| 375 | Ga0207712_10061613 | 3300025961 | Bacteria | 2663 |
| 376 | Ga0207668_10144150 | 3300025972 | Bacteria | 1835 |
| 377 | Ga0207640_10011600 | 3300025981 | Bacteria | 4994 |
| 378 | Ga0207640_10044473 | 3300025981 | Bacteria | 2846 |
| 379 | Ga0207640_10319859 | 3300025981 | Unclassified | 1235 |
| 380 | Ga0207658_10177109 | 3300025986 | Bacteria | 1762 |
| 381 | Ga0207677_10004653 | 3300026023 | Bacteria | 7386 |
| 382 | Ga0207677_10183465 | 3300026023 | Bacteria | 1648 |
| 383 | Ga0207677_10390406 | 3300026023 | Unclassified | 1177 |
| 384 | Ga0207677_10495012 | 3300026023 | Bacteria | 1056 |
| 385 | Ga0207703_10220236 | 3300026035 | Unclassified | 1696 |
| 386 | Ga0207703_10275059 | 3300026035 | Bacteria | 1527 |
| 387 | Ga0207639_10017896 | 3300026041 | Bacteria | 5027 |
| 388 | Ga0207639_10098869 | 3300026041 | Bacteria | 2353 |
| 389 | Ga0207639_10216017 | 3300026041 | Bacteria | 1653 |
| 390 | Ga0207639_10434971 | 3300026041 | Bacteria | 1188 |
| 391 | Ga0207678_10029562 | 3300026067 | Bacteria | 4783 |
| 392 | Ga0207708_10051481 | 3300026075 | Bacteria | 3135 |
| 393 | Ga0207702_10008491 | 3300026078 | Bacteria | 8661 |
| 394 | Ga0207702_10036343 | 3300026078 | Bacteria | 4120 |
| 395 | Ga0207702_10400771 | 3300026078 | Bacteria | 1323 |
| 396 | Ga0207641_10000730 | 3300026088 | Bacteria | 35276 |
| 397 | Ga0207641_10029778 | 3300026088 | Bacteria | 4515 |
| 398 | Ga0207641_10095484 | 3300026088 | Bacteria | 2610 |
| 399 | Ga0207648_10008178 | 3300026089 | Bacteria | 10169 |
| 400 | Ga0207648_10016701 | 3300026089 | Bacteria | 6698 |
| 401 | Ga0207648_10025061 | 3300026089 | Bacteria | 5317 |
| 402 | Ga0207648_10042119 | 3300026089 | Bacteria | 4009 |
| 403 | Ga0207648_10224246 | 3300026089 | Bacteria | 1671 |
| 404 | Ga0207676_10008125 | 3300026095 | Bacteria | 7459 |
| 405 | Ga0207676_10195523 | 3300026095 | Bacteria | 1783 |
| 406 | Ga0207674_10015776 | 3300026116 | Bacteria | 8288 |
| 407 | Ga0207674_10021519 | 3300026116 | Bacteria | 6943 |
| 408 | Ga0207674_10022873 | 3300026116 | Bacteria | 6707 |
| 409 | Ga0207674_10051391 | 3300026116 | Bacteria | 4206 |
| 410 | Ga0207675_100031951 | 3300026118 | Bacteria | 4904 |
| 411 | Ga0207675_100060240 | 3300026118 | Bacteria | 3544 |
| 412 | Ga0207675_100101239 | 3300026118 | Bacteria | 2714 |
| 413 | Ga0207675_100228341 | 3300026118 | Bacteria | 1795 |
| 414 | Ga0207675_100351759 | 3300026118 | Bacteria | 1444 |
| 415 | Ga0207683_10004324 | 3300026121 | Bacteria | 12267 |
| 416 | Ga0207683_10011177 | 3300026121 | Bacteria | 7654 |
| 417 | Ga0207698_10007210 | 3300026142 | Bacteria | 6966 |
| 418 | Ga0207698_10032743 | 3300026142 | Bacteria | 3769 |
| 419 | Ga0207698_10050386 | 3300026142 | Unclassified | 3176 |
| 420 | Ga0207698_10398620 | 3300026142 | Unclassified | 1314 |
| 421 | Ga0268266_10000149 | 3300028379 | Bacteria | 134809 |
| 422 | Ga0268266_10002951 | 3300028379 | Bacteria | 17546 |
| 423 | Ga0268266_10068183 | 3300028379 | Bacteria | 3080 |
| 424 | Ga0268266_10282131 | 3300028379 | Bacteria | 1545 |
| 425 | Ga0268265_10200528 | 3300028380 | Bacteria | 1731 |
| 426 | Ga0268265_10205583 | 3300028380 | Bacteria | 1711 |
| 427 | Ga0268264_10000064 | 3300028381 | Bacteria | 301274 |
| 428 | Ga0268264_10056103 | 3300028381 | Bacteria | 3292 |
| 429 | Ga0265334_10017059 | 3300028573 | Unclassified | 3004 |
| 430 | Ga0307517_10007088 | 3300028786 | Bacteria | 16436 |
| 431 | Ga0307517_10113612 | 3300028786 | Bacteria | 2043 |
| 432 | Ga0307515_10000223 | 3300028794 | Bacteria | 140434 |
| 433 | Ga0307515_10002152 | 3300028794 | Bacteria | 43253 |
| 434 | Ga0307515_10002588 | 3300028794 | Bacteria | 39033 |
| 435 | Ga0265340_10089548 | 3300031247 | Bacteria | 1440 |
| 436 | Ga0265327_10000022 | 3300031251 | Bacteria | 402724 |
| 437 | Ga0265327_10000692 | 3300031251 | Bacteria | 53756 |
| 438 | Ga0265327_10023225 | 3300031251 | Bacteria | 3678 |
| 439 | Ga0307408_100000183 | 3300031548 | Bacteria | 69517 |
| 440 | Ga0307516_10000659 | 3300031730 | Bacteria | 46694 |
| 441 | Ga0307410_10040892 | 3300031852 | Bacteria | 3054 |
| 442 | Ga0307412_10000007 | 3300031911 | Bacteria | 486267 |
| 443 | Ga0307412_10000077 | 3300031911 | Bacteria | 96375 |
| 444 | Ga0307412_10004787 | 3300031911 | Bacteria | 7555 |
| 445 | Ga0307416_100000039 | 3300032002 | Bacteria | 133298 |
| 446 | Ga0307416_100021338 | 3300032002 | Bacteria | 4648 |
| 447 | Ga0307414_10000009 | 3300032004 | Bacteria | 359782 |
| 448 | Ga0307414_10000967 | 3300032004 | Bacteria | 14631 |
| 449 | Ga0307414_10001475 | 3300032004 | Bacteria | 12239 |
| 450 | Ga0307414_10002260 | 3300032004 | Bacteria | 10066 |
| 451 | Ga0307414_10018460 | 3300032004 | Bacteria | 4295 |
| 452 | Ga0307414_10063996 | 3300032004 | Bacteria | 2616 |
| 453 | Ga0307414_10132054 | 3300032004 | Bacteria | 1940 |
| 454 | Ga0307414_10185034 | 3300032004 | Bacteria | 1679 |
| 455 | Ga0307414_10241423 | 3300032004 | Bacteria | 1496 |
| 456 | Ga0307411_10306347 | 3300032005 | Bacteria | 1276 |
| 457 | Ga0307411_10339218 | 3300032005 | Bacteria | 1221 |
| 458 | Ga0307507_10000170 | 3300033179 | Bacteria | 116878 |
| 459 | Ga0373937_0043275 | 3300036401 | Bacteria | 4109 |
| 460 | Ga0395899_0000025 | 3300037312 | Bacteria | 350927 |
| 461 | Ga0395900_0117419 | 3300037418 | Bacteria | 2730 |
| 462 | Ga0395900_0194251 | 3300037418 | Bacteria | 2057 |
| 463 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 464 | Ga0395905_0000580 | 3300037471 | Bacteria | 49303 |
| 465 | Ga0395905_0016411 | 3300037471 | Bacteria | 7038 |
| 466 | Ga0395905_0083520 | 3300037471 | Bacteria | 2992 |
| 467 | Ga0395901_0003783 | 3300038443 | Bacteria | 15246 |
| 468 | Ga0436365_0518983 | 3300039437 | Bacteria | 1949 |
| 469 | Ga0439466_0024551 | 3300041411 | Bacteria | 2111 |
| 470 | Ga0439465_0008983 | 3300041413 | Bacteria | 3149 |
| 471 | Ga0439445_0001630 | 3300042004 | Bacteria | 4907 |
| 472 | Ga0439449_0010736 | 3300042007 | Unclassified | 3459 |
| 473 | Ga0450923_002279 | 3300042125 | Bacteria | 2728 |
| 474 | Ga0450894_004100 | 3300042131 | Bacteria | 1899 |
| 475 | Ga0450898_004923 | 3300042134 | Bacteria | 1996 |
| 476 | Ga0466972_0005319 | 3300044658 | Bacteria | 6445 |
| 477 | Ga0453684_0003103 | 3300044712 | Bacteria | 38279 |
| 478 | Ga0466970_0034986 | 3300044765 | Bacteria | 2661 |
| 479 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 480 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 481 | Ga0495627_008622 | 3300046453 | Bacteria | 3804 |
| 482 | Ga0495590_0008967 | 3300046457 | Bacteria | 3801 |
| 483 | Ga0495638_0037665 | 3300046460 | Bacteria | 3076 |
| 484 | Ga0495638_0094936 | 3300046460 | Bacteria | 1792 |
| 485 | Ga0495650_0000238 | 3300046471 | Bacteria | 110217 |
| 486 | Ga0495650_0040117 | 3300046471 | Bacteria | 2014 |
| 487 | Ga0495605_0082384 | 3300046474 | Bacteria | 1503 |
| 488 | Ga0495585_0000585 | 3300046492 | Bacteria | 34224 |
| 489 | Ga0495585_0001267 | 3300046492 | Bacteria | 20233 |
| 490 | Ga0495596_0010477 | 3300046500 | Bacteria | 4033 |
| 491 | Ga0495583_0060132 | 3300046506 | Bacteria | 1700 |
| 492 | Ga0495606_0000008 | 3300046507 | Bacteria | 321373 |
| 493 | Ga0495606_0166249 | 3300046507 | Bacteria | 1283 |
| 494 | Ga0495608_0062593 | 3300046511 | Bacteria | 2444 |
| 495 | Ga0495610_0000032 | 3300046512 | Bacteria | 216443 |
| 496 | Ga0495610_0001853 | 3300046512 | Bacteria | 18322 |
| 497 | Ga0495610_0109259 | 3300046512 | Bacteria | 1227 |
| 498 | Ga0495616_0006304 | 3300046513 | Bacteria | 7196 |
| 499 | Ga0495616_0007243 | 3300046513 | Bacteria | 6644 |
| 500 | Ga0495616_0059868 | 3300046513 | Bacteria | 1872 |
| 501 | Ga0495628_0013015 | 3300046516 | Bacteria | 7007 |
| 502 | Ga0495630_0021568 | 3300046517 | Bacteria | 4756 |
| 503 | Ga0495632_0072158 | 3300046519 | Bacteria | 1657 |
| 504 | Ga0495637_0069894 | 3300046520 | Bacteria | 1419 |
| 505 | Ga0495643_0041170 | 3300046522 | Bacteria | 2520 |
| 506 | Ga0495643_0041186 | 3300046522 | Bacteria | 2519 |
| 507 | Ga0495648_0001120 | 3300046524 | Bacteria | 27151 |
| 508 | Ga0495648_0010757 | 3300046524 | Bacteria | 6948 |
| 509 | Ga0495648_0036130 | 3300046524 | Bacteria | 3193 |
| 510 | Ga0495663_0000124 | 3300046525 | Bacteria | 32076 |
| 511 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 512 | Ga0495586_0017743 | 3300046535 | Bacteria | 3787 |
| 513 | Ga0495598_0022800 | 3300046537 | Bacteria | 1679 |
| 514 | Ga0495609_0000225 | 3300046538 | Bacteria | 55731 |
| 515 | Ga0495609_0001651 | 3300046538 | Bacteria | 14544 |
| 516 | Ga0495609_0029633 | 3300046538 | Bacteria | 2492 |
| 517 | Ga0495633_0000109 | 3300046558 | Bacteria | 110841 |
| 518 | Ga0495633_0000388 | 3300046558 | Bacteria | 46365 |
| 519 | Ga0495633_0013488 | 3300046558 | Bacteria | 4305 |
| 520 | Ga0495633_0046683 | 3300046558 | Bacteria | 2048 |
| 521 | Ga0495668_0000068 | 3300046616 | Bacteria | 176297 |
| 522 | Ga0495668_0000127 | 3300046616 | Bacteria | 114097 |
| 523 | Ga0495634_0071196 | 3300046642 | Bacteria | 2290 |
| 524 | Ga0495625_0000017 | 3300046660 | Bacteria | 299728 |
| 525 | Ga0495625_0000542 | 3300046660 | Bacteria | 55319 |
| 526 | Ga0495625_0000691 | 3300046660 | Bacteria | 48010 |
| 527 | Ga0495625_0001121 | 3300046660 | Bacteria | 34662 |
| 528 | Ga0495625_0003593 | 3300046660 | Bacteria | 15258 |
| 529 | Ga0495625_0010781 | 3300046660 | Bacteria | 7521 |
| 530 | Ga0495625_0088404 | 3300046660 | Bacteria | 2146 |
| 531 | Ga0495635_0016878 | 3300046663 | Bacteria | 5099 |
| 532 | Ga0495661_0008349 | 3300046665 | Bacteria | 7167 |
| 533 | Ga0495661_0016032 | 3300046665 | Bacteria | 4978 |
| 534 | Ga0495657_0109673 | 3300046675 | Bacteria | 1750 |
| 535 | Ga0495658_0034975 | 3300046683 | Bacteria | 2760 |
| 536 | Ga0495613_0023524 | 3300046689 | Bacteria | 4591 |
| 537 | Ga0495649_0000008 | 3300046694 | Bacteria | 483706 |
| 538 | Ga0495589_0107703 | 3300046794 | Bacteria | 1346 |
| 539 | Ga0495636_0000028 | 3300047318 | Bacteria | 60595 |
| 540 | Ga0495672_0012808 | 3300047320 | Bacteria | 5827 |
| 541 | Ga0495672_0072999 | 3300047320 | Bacteria | 1936 |
| 542 | Ga0495687_000158 | 3300047443 | Bacteria | 103129 |
| 543 | Ga0495687_002605 | 3300047443 | Bacteria | 14184 |
| 544 | Ga0495673_0010133 | 3300047469 | Bacteria | 5154 |
| 545 | Ga0495686_0000253 | 3300047472 | Bacteria | 96076 |
| 546 | Ga0495686_0000261 | 3300047472 | Bacteria | 94540 |
| 547 | Ga0495686_0000299 | 3300047472 | Bacteria | 85384 |
| 548 | Ga0495686_0007933 | 3300047472 | Bacteria | 7881 |
| 549 | Ga0495686_0019848 | 3300047472 | Bacteria | 4486 |
| 550 | Ga0495686_0048500 | 3300047472 | Bacteria | 2677 |
| 551 | Ga0495686_0056490 | 3300047472 | Bacteria | 2452 |
| 552 | Ga0496102_0073354 | 3300048905 | Bacteria | 3145 |
| 553 | Ga0496110_0076570 | 3300048913 | Bacteria | 2975 |
| 554 | Ga0496114_0002061 | 3300048917 | Bacteria | 15306 |
| 555 | Ga0496115_0001812 | 3300048918 | Bacteria | 15277 |
| 556 | Ga0496116_0000022 | 3300048919 | Bacteria | 482506 |
| 557 | Ga0496117_0000064 | 3300048920 | Bacteria | 254248 |
| 558 | Ga0496118_0000147 | 3300048921 | Bacteria | 123467 |
| 559 | Ga0496119_0000025 | 3300048922 | Bacteria | 257069 |
| 560 | Ga0496122_0000433 | 3300048925 | Bacteria | 87562 |
| 561 | Ga0496122_0000554 | 3300048925 | Bacteria | 77013 |
| 562 | Ga0496122_0000746 | 3300048925 | Bacteria | 63466 |
| 563 | Ga0496122_0002432 | 3300048925 | Bacteria | 26482 |
| 564 | Ga0496122_0003237 | 3300048925 | Bacteria | 21629 |
| 565 | Ga0496122_0007430 | 3300048925 | Bacteria | 12183 |
| 566 | Ga0496123_0003730 | 3300048926 | Bacteria | 16731 |
| 567 | Ga0496123_0037741 | 3300048926 | Bacteria | 3407 |
| 568 | Ga0496123_0109822 | 3300048926 | Bacteria | 1579 |
| 569 | Ga0496124_0001842 | 3300048927 | Bacteria | 29277 |
| 570 | Ga0496124_0132563 | 3300048927 | Bacteria | 1978 |
| 571 | Ga0496125_0001531 | 3300048928 | Bacteria | 33182 |
| 572 | Ga0496125_0007660 | 3300048928 | Bacteria | 11444 |
| 573 | Ga0496125_0058743 | 3300048928 | Bacteria | 3105 |
| 574 | Ga0496125_0102632 | 3300048928 | Bacteria | 2101 |
| 575 | Ga0496126_0000922 | 3300048929 | Bacteria | 50884 |
| 576 | Ga0501290_002932 | 3300049513 | Bacteria | 2170 |
| 577 | Ga0501293_002582 | 3300049516 | Bacteria | 1378 |
| 578 | Ga0501335_000488 | 3300049551 | Bacteria | 2559 |
| 579 | Ga0501031_0001600 | 3300049568 | Bacteria | 14146 |
| 580 | Ga0501032_0050991 | 3300049569 | Bacteria | 2790 |
| 581 | Ga0501032_0065140 | 3300049569 | Bacteria | 2438 |
| 582 | Ga0501034_0014477 | 3300049571 | Bacteria | 8123 |
| 583 | Ga0501034_0050622 | 3300049571 | Bacteria | 4189 |
| 584 | Ga0501034_0087078 | 3300049571 | Bacteria | 3123 |
| 585 | Ga0501036_0005556 | 3300049572 | Bacteria | 10227 |
| 586 | Ga0501036_0005726 | 3300049572 | Bacteria | 10077 |
| 587 | Ga0501037_0027053 | 3300049573 | Bacteria | 4237 |
| 588 | Ga0501038_0034595 | 3300049574 | Bacteria | 4441 |
| 589 | Ga0501039_0005269 | 3300049575 | Bacteria | 9792 |
| 590 | Ga0501043_0015546 | 3300049579 | Bacteria | 5964 |
| 591 | Ga0501043_0037488 | 3300049579 | Bacteria | 3813 |
| 592 | Ga0501043_0075016 | 3300049579 | Bacteria | 2657 |
| 593 | Ga0501046_0039611 | 3300049580 | Bacteria | 3772 |
| 594 | Ga0501046_0094373 | 3300049580 | Bacteria | 2299 |
| 595 | Ga0501047_0027972 | 3300049581 | Bacteria | 5434 |
| 596 | Ga0501047_0041618 | 3300049581 | Bacteria | 4440 |
| 597 | Ga0501072_0058117 | 3300049588 | Bacteria | 3049 |
| 598 | Ga0501073_0023518 | 3300049589 | Bacteria | 4424 |
| 599 | Ga0501074_0000591 | 3300049590 | Bacteria | 22526 |
| 600 | Ga0501198_002065 | 3300049649 | Bacteria | 2676 |
| 601 | Ga0501217_005896 | 3300049661 | Bacteria | 2579 |
| 602 | Ga0501223_002142 | 3300049663 | Bacteria | 4425 |
| 603 | Ga0501233_004133 | 3300049668 | Bacteria | 2644 |
| 604 | Ga0501235_012149 | 3300049669 | Unclassified | 1892 |
| 605 | Ga0501235_016090 | 3300049669 | Bacteria | 1651 |
| 606 | Ga0501243_004110 | 3300049675 | Bacteria | 2175 |
| 607 | Ga0501252_002421 | 3300049682 | Bacteria | 1850 |
| 608 | Ga0501259_002506 | 3300049688 | Bacteria | 2969 |
| 609 | Ga0501259_002880 | 3300049688 | Bacteria | 2764 |
| 610 | Ga0501261_003913 | 3300049690 | Bacteria | 1827 |
| 611 | Ga0501225_0001741 | 3300049705 | Bacteria | 6822 |
| 612 | Ga0501234_000344 | 3300049707 | Bacteria | 6865 |
| 613 | Ga0501234_012990 | 3300049707 | Unclassified | 1307 |
| 614 | Ga0501080_0111345 | 3300049742 | Bacteria | 2537 |
| 615 | Ga0501241_000114 | 3300049758 | Bacteria | 17450 |
| 616 | Ga0501266_002788 | 3300049763 | Bacteria | 2187 |
| 617 | Ga0501268_007439 | 3300049765 | Bacteria | 1634 |
| 618 | Ga0501269_000702 | 3300049766 | Bacteria | 5545 |
| 619 | Ga0501271_005263 | 3300049768 | Bacteria | 1255 |
| 620 | Ga0501035_0006079 | 3300049822 | Bacteria | 11367 |
| 621 | Ga0501035_0057398 | 3300049822 | Bacteria | 3471 |
| 622 | Ga0501044_0035878 | 3300049823 | Bacteria | 5190 |
| 623 | Ga0501044_0166347 | 3300049823 | Bacteria | 2179 |
| 624 | Ga0501284_00033 | 3300050005 | Bacteria | 63455 |
| 625 | nmdc:mga0k408_48831_c1 | 3300050493 | Bacteria | 2449 |
| 626 | nmdc:mga0k408_6928_c1 | 3300050493 | Bacteria | 6044 |
| 627 | nmdc:mga05p37_222343_c1 | 3300050507 | Bacteria | 2278 |
| 628 | nmdc:mga05p37_76696_c1 | 3300050507 | Bacteria | 2866 |
| 629 | nmdc:mga09592_105905_c1 | 3300050508 | Bacteria | 2412 |
| 630 | nmdc:mga0qj67_34474_c1 | 3300050509 | Bacteria | 3954 |
| 631 | nmdc:mga06r32_250475_c1 | 3300050510 | Bacteria | 1759 |
| 632 | nmdc:mga08y16_533070_c1 | 3300050511 | Bacteria | 1190 |
| 633 | nmdc:mga08x19_35271_c1 | 3300050514 | Bacteria | 3164 |
| 634 | nmdc:mga0a205_10623_c1 | 3300050515 | Bacteria | 8465 |
| 635 | nmdc:mga0a205_106747_c1 | 3300050515 | Bacteria | 2698 |
| 636 | Ga0500583_0024788 | 3300053092 | Unclassified | 2550 |
| 637 | Ga0500651_0000127 | 3300053093 | Bacteria | 47010 |
| 638 | Ga0500614_037545 | 3300053123 | Bacteria | 1216 |
| 639 | Ga0500618_000009 | 3300053125 | Bacteria | 209970 |
| 640 | Ga0500559_0010090 | 3300053136 | Bacteria | 4065 |
| 641 | Ga0500568_0002946 | 3300053139 | Bacteria | 9744 |
| 642 | Ga0500616_0004954 | 3300053153 | Bacteria | 9243 |
| 643 | Ga0500622_0001133 | 3300053156 | Bacteria | 22246 |
| 644 | Ga0500624_000382 | 3300053157 | Bacteria | 14094 |
| 645 | Ga0500627_0005143 | 3300053158 | Bacteria | 4306 |
| 646 | Ga0500611_000011 | 3300053727 | Bacteria | 141259 |
| 647 | Ga0501084_0092724 | 3300054114 | Bacteria | 2536 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10003668 | Ga0075433_100036684 | 254 |
| 2 | 3300007076 | Ga0075435_100018506 | Ga0075435_1000185065 | 254 |
| 3 | 3300050515 | nmdc:mga0a205_10623_c1 | nmdc:mga0a205_10623_c1_2961_3839 | 254 |
| 4 | 3300005364 | Ga0070673_100280301 | Ga0070673_1002803012 | 256 |
| 5 | 3300050514 | nmdc:mga08x19_35271_c1 | nmdc:mga08x19_35271_c1_1728_2612 | 256 |
| 6 | 3300050515 | nmdc:mga0a205_106747_c1 | nmdc:mga0a205_106747_c1_393_1277 | 256 |
| 7 | 3300050510 | nmdc:mga06r32_250475_c1 | nmdc:mga06r32_250475_c1_13_891 | 258 |
| 8 | 3300005329 | Ga0070683_100002228 | Ga0070683_1000022288 | 264 |
| 9 | 3300005344 | Ga0070661_100010109 | Ga0070661_1000101092 | 264 |
| 10 | 3300005366 | Ga0070659_100002840 | Ga0070659_1000028408 | 264 |
| 11 | 3300005535 | Ga0070684_100001451 | Ga0070684_10000145120 | 264 |
| 12 | 3300005539 | Ga0068853_100001183 | Ga0068853_10000118317 | 264 |
| 13 | 3300005564 | Ga0070664_100010568 | Ga0070664_1000105687 | 264 |
| 14 | 3300005577 | Ga0068857_100009246 | Ga0068857_1000092469 | 264 |
| 15 | 3300025932 | Ga0207690_10027835 | Ga0207690_100278351 | 264 |
| 16 | 3300025944 | Ga0207661_10004373 | Ga0207661_100043734 | 264 |
| 17 | 3300025945 | Ga0207679_10003487 | Ga0207679_100034878 | 264 |
| 18 | 3300026041 | Ga0207639_10017896 | Ga0207639_100178964 | 264 |
| 19 | 3300046471 | Ga0495650_0040117 | Ga0495650_0040117_11_925 | 265 |
| 20 | 3300017792 | Ga0163161_10088946 | Ga0163161_100889463 | 266 |
| 21 | 3300025904 | Ga0207647_10001309 | Ga0207647_1000130910 | 267 |
| 22 | 3300005617 | Ga0068859_100166052 | Ga0068859_1001660522 | 269 |
| 23 | 3300005843 | Ga0068860_100000006 | Ga0068860_100000006126 | 269 |
| 24 | 3300006931 | Ga0097620_100166062 | Ga0097620_1001660622 | 269 |
| 25 | 3300013306 | Ga0163162_10000355 | Ga0163162_1000035538 | 269 |
| 26 | 3300028381 | Ga0268264_10000064 | Ga0268264_1000006468 | 269 |
| 27 | 3300028786 | Ga0307517_10113612 | Ga0307517_101136122 | 269 |
| 28 | 3300046460 | Ga0495638_0037665 | Ga0495638_0037665_1941_2906 | 269 |
| 29 | 3300046524 | Ga0495648_0001120 | Ga0495648_0001120_8707_9672 | 269 |
| 30 | 3300047443 | Ga0495687_000158 | Ga0495687_000158_70385_71350 | 269 |
| 31 | 3300048917 | Ga0496114_0002061 | Ga0496114_0002061_5707_6684 | 269 |
| 32 | 3300053092 | Ga0500583_0024788 | Ga0500583_0024788_528_1493 | 269 |
| 33 | 3300005548 | Ga0070665_100000016 | Ga0070665_100000016109 | 270 |
| 34 | 3300013297 | Ga0157378_10461484 | Ga0157378_104614842 | 270 |
| 35 | 3300028379 | Ga0268266_10000149 | Ga0268266_10000149108 | 270 |
| 36 | 3300031251 | Ga0265327_10000692 | Ga0265327_1000069242 | 270 |
| 37 | 3300046460 | Ga0495638_0094936 | Ga0495638_0094936_192_1208 | 270 |
| 38 | 3300005563 | Ga0068855_100587769 | Ga0068855_1005877691 | 271 |
| 39 | 3300006847 | Ga0075431_100015087 | Ga0075431_1000150878 | 271 |
| 40 | 3300009093 | Ga0105240_10048728 | Ga0105240_100487282 | 271 |
| 41 | 3300009147 | Ga0114129_10059718 | Ga0114129_100597184 | 271 |
| 42 | 3300025913 | Ga0207695_10022735 | Ga0207695_100227356 | 271 |
| 43 | 3300050507 | nmdc:mga05p37_76696_c1 | nmdc:mga05p37_76696_c1_1723_2676 | 271 |
| 44 | 3300044658 | Ga0466972_0005319 | Ga0466972_0005319_1150_2115 | 272 |
| 45 | 3300047318 | Ga0495636_0000028 | Ga0495636_0000028_56428_57405 | 272 |
| 46 | 3300005614 | Ga0068856_100260275 | Ga0068856_1002602752 | 273 |
| 47 | 3300032004 | Ga0307414_10018460 | Ga0307414_100184604 | 273 |
| 48 | 3300003316 | rootH1_10166102 | rootH1_101661023 | 274 |
| 49 | 3300049669 | Ga0501235_012149 | Ga0501235_012149_291_1253 | 275 |
| 50 | 3300014497 | Ga0182008_10009150 | Ga0182008_100091501 | 276 |
| 51 | 3300005329 | Ga0070683_100301568 | Ga0070683_1003015682 | 277 |
| 52 | 3300005563 | Ga0068855_100003016 | Ga0068855_10000301620 | 277 |
| 53 | 3300005616 | Ga0068852_100038113 | Ga0068852_1000381133 | 277 |
| 54 | 3300009093 | Ga0105240_10003256 | Ga0105240_1000325621 | 277 |
| 55 | 3300010375 | Ga0105239_10128503 | Ga0105239_101285032 | 277 |
| 56 | 3300013104 | Ga0157370_10029298 | Ga0157370_100292983 | 277 |
| 57 | 3300013105 | Ga0157369_10047939 | Ga0157369_100479393 | 277 |
| 58 | 3300013307 | Ga0157372_10100160 | Ga0157372_101001602 | 277 |
| 59 | 3300025250 | Ga0209026_1002337 | Ga0209026_10023372 | 277 |
| 60 | 3300025913 | Ga0207695_10000245 | Ga0207695_1000024554 | 277 |
| 61 | 3300025944 | Ga0207661_10212879 | Ga0207661_102128792 | 277 |
| 62 | 3300025949 | Ga0207667_10008361 | Ga0207667_100083613 | 277 |
| 63 | 3300026142 | Ga0207698_10032743 | Ga0207698_100327433 | 277 |
| 64 | 3300031548 | Ga0307408_100000183 | Ga0307408_10000018317 | 277 |
| 65 | 3300049690 | Ga0501261_003913 | Ga0501261_003913_584_1600 | 277 |
| 66 | 3300053157 | Ga0500624_000382 | Ga0500624_000382_2208_3185 | 277 |
| 67 | iso_pu_bacteria | 2511231000 | 2511233822 | 277 |
| 68 | iso_pu_bacteria | 2523533629 | 2524005998 | 277 |
| 69 | iso_pu_bacteria | 2582581278 | 2585141301 | 277 |
| 70 | iso_pu_bacteria | 2582581281 | 2585158890 | 277 |
| 71 | iso_pu_bacteria | 2582581282 | 2585163178 | 277 |
| 72 | iso_pu_bacteria | 2582581873 | 2585424632 | 277 |
| 73 | iso_pu_bacteria | 2585428045 | 2587681362 | 277 |
| 74 | iso_pu_bacteria | 2585428060 | 2587749367 | 277 |
| 75 | iso_pu_bacteria | 2585428061 | 2587750483 | 277 |
| 76 | iso_pu_bacteria | 2585428095 | 2587866934 | 277 |
| 77 | iso_pu_bacteria | 2585428115 | 2587942724 | 277 |
| 78 | iso_pu_bacteria | 2585428182 | 2588207854 | 277 |
| 79 | iso_pu_bacteria | 2585428183 | 2588213592 | 277 |
| 80 | iso_pu_bacteria | 2585428184 | 2588221474 | 277 |
| 81 | iso_pu_bacteria | 2585428185 | 2588223592 | 277 |
| 82 | iso_pu_bacteria | 2585428187 | 2588233272 | 277 |
| 83 | iso_pu_bacteria | 2588253712 | 2588446754 | 277 |
| 84 | iso_pu_bacteria | 2588254255 | 2590600388 | 277 |
| 85 | iso_pu_bacteria | 2588254257 | 2590612220 | 277 |
| 86 | iso_pu_bacteria | 2728369107 | 2729198856 | 277 |
| 87 | iso_pu_bacteria | 2738541273 | 2738699418 | 277 |
| 88 | iso_pu_bacteria | 2738543014 | 2739255385 | 277 |
| 89 | iso_pu_bacteria | 2739367874 | 2740058007 | 277 |
| 90 | iso_pu_bacteria | 2751185877 | 2753672380 | 277 |
| 91 | iso_pu_bacteria | 2765235839 | 2765572906 | 277 |
| 92 | iso_pu_bacteria | 2772190705 | 2772607602 | 277 |
| 93 | iso_pu_bacteria | 2775506739 | 2775672732 | 277 |
| 94 | iso_pu_bacteria | 2816332188 | 2816873362 | 277 |
| 95 | iso_pu_bacteria | 2842083920 | 2842086765 | 277 |
| 96 | iso_pu_bacteria | 2871720351 | 2871721138 | 277 |
| 97 | iso_pu_bacteria | 2889290771 | 2889291379 | 277 |
| 98 | iso_pu_bacteria | 2905999023 | 2906001802 | 277 |
| 99 | iso_pu_bacteria | 2919097161 | 2919100384 | 277 |
| 100 | iso_pu_bacteria | 2919399522 | 2919404266 | 277 |
| 101 | iso_pu_bacteria | 2945924605 | 2945927110 | 277 |
| 102 | iso_pu_bacteria | 2946019816 | 2946021665 | 277 |
| 103 | iso_pu_bacteria | 2977243572 | 2977245989 | 277 |
| 104 | iso_pu_bacteria | 2984572630 | 2984576140 | 277 |
| 105 | iso_pu_bacteria | 2984606641 | 2984609595 | 277 |
| 106 | iso_pu_bacteria | 2993372514 | 2993373332 | 277 |
| 107 | iso_pu_bacteria | 2993480792 | 2993484014 | 277 |
| 108 | 3300003322 | rootL2_10171436 | rootL2_101714362 | 279 |
| 109 | 3300014326 | Ga0157380_10208958 | Ga0157380_102089581 | 279 |
| 110 | iso_pu_bacteria | 2881955468 | 2881956657 | 280 |
| 111 | 2162886007 | SwRhRL2b_contig_2062776 | SwRhRL2b_0412.00004720 | 281 |
| 112 | 3300001915 | JGI24741J21665_1006007 | JGI24741J21665_10060073 | 281 |
| 113 | 3300003320 | rootH2_10196964 | rootH2_101969642 | 281 |
| 114 | 3300003322 | rootL2_10089539 | rootL2_100895393 | 281 |
| 115 | 3300003323 | rootH1_10044553 | rootH1_100445537 | 281 |
| 116 | 3300003578 | Ga0006562J51391_1004223 | Ga0006562J51391_10042234 | 281 |
| 117 | 3300003784 | Ga0055534_1005024 | Ga0055534_10050243 | 281 |
| 118 | 3300005288 | Ga0065714_10070550 | Ga0065714_100705502 | 281 |
| 119 | 3300005289 | Ga0065704_10079391 | Ga0065704_100793912 | 281 |
| 120 | 3300005289 | Ga0065704_10079664 | Ga0065704_100796643 | 281 |
| 121 | 3300005329 | Ga0070683_100006944 | Ga0070683_1000069444 | 281 |
| 122 | 3300005337 | Ga0070682_100199376 | Ga0070682_1001993761 | 281 |
| 123 | 3300009036 | Ga0105244_10000049 | Ga0105244_1000004965 | 281 |
| 124 | 3300009148 | Ga0105243_10002732 | Ga0105243_100027329 | 281 |
| 125 | 3300009553 | Ga0105249_10048976 | Ga0105249_100489763 | 281 |
| 126 | 3300013100 | Ga0157373_10000107 | Ga0157373_1000010734 | 281 |
| 127 | 3300013102 | Ga0157371_10000201 | Ga0157371_1000020173 | 281 |
| 128 | 3300013104 | Ga0157370_10005377 | Ga0157370_1000537711 | 281 |
| 129 | 3300013104 | Ga0157370_10022329 | Ga0157370_100223297 | 281 |
| 130 | 3300013104 | Ga0157370_10039262 | Ga0157370_100392625 | 281 |
| 131 | 3300013105 | Ga0157369_10000759 | Ga0157369_1000075918 | 281 |
| 132 | 3300013308 | Ga0157375_10000759 | Ga0157375_1000075916 | 281 |
| 133 | 3300014497 | Ga0182008_10000011 | Ga0182008_10000011222 | 281 |
| 134 | 3300015261 | Ga0182006_1000012 | Ga0182006_1000012345 | 281 |
| 135 | 3300017792 | Ga0163161_10006037 | Ga0163161_100060373 | 281 |
| 136 | 3300017792 | Ga0163161_10097987 | Ga0163161_100979873 | 281 |
| 137 | 3300025291 | Ga0209675_1000035 | Ga0209675_1000035139 | 281 |
| 138 | 3300025728 | Ga0207655_1000254 | Ga0207655_100025426 | 281 |
| 139 | 3300025935 | Ga0207709_10005255 | Ga0207709_100052557 | 281 |
| 140 | 3300025961 | Ga0207712_10061613 | Ga0207712_100616133 | 281 |
| 141 | 3300031911 | Ga0307412_10000007 | Ga0307412_1000000757 | 281 |
| 142 | 3300031911 | Ga0307412_10004787 | Ga0307412_100047874 | 281 |
| 143 | 3300032002 | Ga0307416_100000039 | Ga0307416_10000003944 | 281 |
| 144 | 3300032004 | Ga0307414_10000009 | Ga0307414_100000097 | 281 |
| 145 | 3300032004 | Ga0307414_10063996 | Ga0307414_100639961 | 281 |
| 146 | 3300032004 | Ga0307414_10185034 | Ga0307414_101850342 | 281 |
| 147 | 3300032004 | Ga0307414_10241423 | Ga0307414_102414232 | 281 |
| 148 | 3300041411 | Ga0439466_0024551 | Ga0439466_0024551_326_1273 | 281 |
| 149 | 3300041413 | Ga0439465_0008983 | Ga0439465_0008983_1409_2407 | 281 |
| 150 | 3300042004 | Ga0439445_0001630 | Ga0439445_0001630_22_969 | 281 |
| 151 | 3300046453 | Ga0495627_000003 | Ga0495627_000003_222326_223273 | 281 |
| 152 | 3300046457 | Ga0495590_0008967 | Ga0495590_0008967_1059_2006 | 281 |
| 153 | 3300046500 | Ga0495596_0010477 | Ga0495596_0010477_1310_2257 | 281 |
| 154 | 3300046512 | Ga0495610_0000032 | Ga0495610_0000032_128039_128986 | 281 |
| 155 | 3300046519 | Ga0495632_0072158 | Ga0495632_0072158_198_1145 | 281 |
| 156 | 3300046522 | Ga0495643_0041170 | Ga0495643_0041170_1442_2389 | 281 |
| 157 | 3300046522 | Ga0495643_0041186 | Ga0495643_0041186_877_1824 | 281 |
| 158 | 3300046525 | Ga0495663_0000124 | Ga0495663_0000124_4547_5494 | 281 |
| 159 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_897004_897951 | 281 |
| 160 | 3300046538 | Ga0495609_0000225 | Ga0495609_0000225_1278_2225 | 281 |
| 161 | 3300046558 | Ga0495633_0000109 | Ga0495633_0000109_57328_58275 | 281 |
| 162 | 3300046558 | Ga0495633_0013488 | Ga0495633_0013488_1524_2471 | 281 |
| 163 | 3300046660 | Ga0495625_0000542 | Ga0495625_0000542_49655_50602 | 281 |
| 164 | 3300047472 | Ga0495686_0048500 | Ga0495686_0048500_1536_2483 | 281 |
| 165 | 3300048905 | Ga0496102_0073354 | Ga0496102_0073354_1420_2367 | 281 |
| 166 | 3300048919 | Ga0496116_0000022 | Ga0496116_0000022_363883_364830 | 281 |
| 167 | 3300048920 | Ga0496117_0000064 | Ga0496117_0000064_129830_130777 | 281 |
| 168 | 3300048921 | Ga0496118_0000147 | Ga0496118_0000147_14453_15400 | 281 |
| 169 | 3300048922 | Ga0496119_0000025 | Ga0496119_0000025_126280_127227 | 281 |
| 170 | 3300048925 | Ga0496122_0000433 | Ga0496122_0000433_30609_31556 | 281 |
| 171 | 3300048925 | Ga0496122_0000554 | Ga0496122_0000554_60274_61221 | 281 |
| 172 | 3300048925 | Ga0496122_0002432 | Ga0496122_0002432_6802_7749 | 281 |
| 173 | 3300048925 | Ga0496122_0003237 | Ga0496122_0003237_5491_6438 | 281 |
| 174 | 3300048925 | Ga0496122_0007430 | Ga0496122_0007430_5321_6268 | 281 |
| 175 | 3300048926 | Ga0496123_0003730 | Ga0496123_0003730_9009_9956 | 281 |
| 176 | 3300048926 | Ga0496123_0109822 | Ga0496123_0109822_309_1256 | 281 |
| 177 | 3300048927 | Ga0496124_0001842 | Ga0496124_0001842_3230_4177 | 281 |
| 178 | 3300048927 | Ga0496124_0132563 | Ga0496124_0132563_133_1080 | 281 |
| 179 | 3300048928 | Ga0496125_0001531 | Ga0496125_0001531_21861_22808 | 281 |
| 180 | 3300048928 | Ga0496125_0007660 | Ga0496125_0007660_4475_5422 | 281 |
| 181 | 3300048928 | Ga0496125_0058743 | Ga0496125_0058743_2096_3043 | 281 |
| 182 | 3300048929 | Ga0496126_0000922 | Ga0496126_0000922_32822_33769 | 281 |
| 183 | 3300049551 | Ga0501335_000488 | Ga0501335_000488_986_1984 | 281 |
| 184 | 3300049758 | Ga0501241_000114 | Ga0501241_000114_7103_8050 | 281 |
| 185 | 3300049765 | Ga0501268_007439 | Ga0501268_007439_177_1199 | 281 |
| 186 | 3300049766 | Ga0501269_000702 | Ga0501269_000702_2540_3538 | 281 |
| 187 | iso_pu_bacteria | 2818991444 | 2819586756 | 281 |
| 188 | iso_pu_bacteria | 2599185184 | 2599476807 | 282 |
| 189 | iso_pu_bacteria | 2919437846 | 2919441233 | 282 |
| 190 | iso_pu_bacteria | 2928078545 | 2928078715 | 282 |
| 191 | iso_pu_bacteria | 2928147474 | 2928151607 | 282 |
| 192 | iso_pu_bacteria | 2932082852 | 2932084240 | 282 |
| 193 | 3300013102 | Ga0157371_10056805 | Ga0157371_100568053 | 283 |
| 194 | 3300013307 | Ga0157372_10007563 | Ga0157372_100075634 | 283 |
| 195 | 3300028794 | Ga0307515_10000223 | Ga0307515_1000022359 | 283 |
| 196 | 3300032004 | Ga0307414_10002260 | Ga0307414_1000226010 | 283 |
| 197 | 3300046453 | Ga0495627_008622 | Ga0495627_008622_204_1157 | 283 |
| 198 | 3300046660 | Ga0495625_0003593 | Ga0495625_0003593_12204_13181 | 283 |
| 199 | 3300047472 | Ga0495686_0000253 | Ga0495686_0000253_91560_92513 | 283 |
| 200 | 3300049581 | Ga0501047_0041618 | Ga0501047_0041618_2277_3245 | 283 |
| 201 | 3300049822 | Ga0501035_0006079 | Ga0501035_0006079_1287_2255 | 283 |
| 202 | iso_pu_bacteria | 2738541283 | 2738755059 | 283 |
| 203 | iso_pu_bacteria | 2738541284 | 2738760974 | 283 |
| 204 | iso_pu_bacteria | 2738543023 | 2739301213 | 283 |
| 205 | iso_pu_bacteria | 2775506987 | 2776613161 | 283 |
| 206 | iso_pu_bacteria | 2852627209 | 2852631311 | 283 |
| 207 | iso_pu_bacteria | 2896317667 | 2896319610 | 283 |
| 208 | iso_pu_bacteria | 2896344016 | 2896346681 | 283 |
| 209 | iso_pu_bacteria | 2919186247 | 2919187250 | 283 |
| 210 | iso_pu_bacteria | 2939664404 | 2939665481 | 283 |
| 211 | iso_pu_bacteria | 3003233435 | 3003237088 | 283 |
| 212 | 3300003322 | rootL2_10179839 | rootL2_101798392 | 284 |
| 213 | 3300005578 | Ga0068854_100360845 | Ga0068854_1003608452 | 284 |
| 214 | 3300010375 | Ga0105239_10157001 | Ga0105239_101570011 | 284 |
| 215 | 3300013307 | Ga0157372_10352147 | Ga0157372_103521471 | 284 |
| 216 | 3300028786 | Ga0307517_10007088 | Ga0307517_1000708814 | 284 |
| 217 | 3300031730 | Ga0307516_10000659 | Ga0307516_1000065932 | 284 |
| 218 | 3300031852 | Ga0307410_10040892 | Ga0307410_100408924 | 284 |
| 219 | 3300032002 | Ga0307416_100021338 | Ga0307416_1000213385 | 284 |
| 220 | 3300039437 | Ga0436365_0518983 | Ga0436365_0518983_392_1351 | 284 |
| 221 | 3300046616 | Ga0495668_0000068 | Ga0495668_0000068_96414_97394 | 284 |
| 222 | 3300047472 | Ga0495686_0000261 | Ga0495686_0000261_34273_35304 | 284 |
| 223 | 3300049661 | Ga0501217_005896 | Ga0501217_005896_1037_1999 | 284 |
| 224 | 3300053153 | Ga0500616_0004954 | Ga0500616_0004954_2231_3211 | 284 |
| 225 | 3300053158 | Ga0500627_0005143 | Ga0500627_0005143_1671_2651 | 284 |
| 226 | 2162886011 | MRS1b_contig_8964951 | MRS1b_0151.00001590 | 285 |
| 227 | 3300003322 | rootL2_10138794 | rootL2_101387944 | 285 |
| 228 | 3300003323 | rootH1_10193885 | rootH1_101938851 | 285 |
| 229 | 3300005290 | Ga0065712_10001395 | Ga0065712_100013955 | 285 |
| 230 | 3300005290 | Ga0065712_10004793 | Ga0065712_100047932 | 285 |
| 231 | 3300005293 | Ga0065715_10104240 | Ga0065715_101042402 | 285 |
| 232 | 3300005295 | Ga0065707_10101916 | Ga0065707_101019162 | 285 |
| 233 | 3300005328 | Ga0070676_10038836 | Ga0070676_100388364 | 285 |
| 234 | 3300005329 | Ga0070683_100023606 | Ga0070683_1000236067 | 285 |
| 235 | 3300005329 | Ga0070683_100256092 | Ga0070683_1002560922 | 285 |
| 236 | 3300005330 | Ga0070690_100027165 | Ga0070690_1000271653 | 285 |
| 237 | 3300005330 | Ga0070690_100176209 | Ga0070690_1001762092 | 285 |
| 238 | 3300005331 | Ga0070670_100004989 | Ga0070670_10000498910 | 285 |
| 239 | 3300005331 | Ga0070670_100050676 | Ga0070670_1000506764 | 285 |
| 240 | 3300005331 | Ga0070670_100076556 | Ga0070670_1000765562 | 285 |
| 241 | 3300005334 | Ga0068869_100001288 | Ga0068869_10000128815 | 285 |
| 242 | 3300005334 | Ga0068869_100025626 | Ga0068869_1000256264 | 285 |
| 243 | 3300005334 | Ga0068869_100139809 | Ga0068869_1001398091 | 285 |
| 244 | 3300005335 | Ga0070666_10111904 | Ga0070666_101119042 | 285 |
| 245 | 3300005337 | Ga0070682_100042657 | Ga0070682_1000426572 | 285 |
| 246 | 3300005338 | Ga0068868_100004534 | Ga0068868_10000453411 | 285 |
| 247 | 3300005338 | Ga0068868_100038212 | Ga0068868_1000382122 | 285 |
| 248 | 3300005338 | Ga0068868_100105694 | Ga0068868_1001056942 | 285 |
| 249 | 3300005338 | Ga0068868_100223500 | Ga0068868_1002235002 | 285 |
| 250 | 3300005340 | Ga0070689_100003775 | Ga0070689_10000377511 | 285 |
| 251 | 3300005340 | Ga0070689_100034123 | Ga0070689_1000341234 | 285 |
| 252 | 3300005340 | Ga0070689_100173822 | Ga0070689_1001738222 | 285 |
| 253 | 3300005340 | Ga0070689_100395705 | Ga0070689_1003957051 | 285 |
| 254 | 3300005343 | Ga0070687_100043718 | Ga0070687_1000437182 | 285 |
| 255 | 3300005343 | Ga0070687_100056043 | Ga0070687_1000560433 | 285 |
| 256 | 3300005347 | Ga0070668_100011326 | Ga0070668_1000113267 | 285 |
| 257 | 3300005347 | Ga0070668_100139384 | Ga0070668_1001393841 | 285 |
| 258 | 3300005347 | Ga0070668_100217632 | Ga0070668_1002176321 | 285 |
| 259 | 3300005353 | Ga0070669_100000874 | Ga0070669_10000087419 | 285 |
| 260 | 3300005353 | Ga0070669_100219157 | Ga0070669_1002191572 | 285 |
| 261 | 3300005354 | Ga0070675_100023401 | Ga0070675_1000234013 | 285 |
| 262 | 3300005354 | Ga0070675_100040444 | Ga0070675_1000404442 | 285 |
| 263 | 3300005354 | Ga0070675_100054876 | Ga0070675_1000548762 | 285 |
| 264 | 3300005354 | Ga0070675_100098547 | Ga0070675_1000985473 | 285 |
| 265 | 3300005354 | Ga0070675_100274360 | Ga0070675_1002743602 | 285 |
| 266 | 3300005354 | Ga0070675_100455540 | Ga0070675_1004555401 | 285 |
| 267 | 3300005356 | Ga0070674_100013146 | Ga0070674_1000131466 | 285 |
| 268 | 3300005364 | Ga0070673_100019243 | Ga0070673_1000192436 | 285 |
| 269 | 3300005364 | Ga0070673_100048333 | Ga0070673_1000483331 | 285 |
| 270 | 3300005365 | Ga0070688_100001369 | Ga0070688_10000136913 | 285 |
| 271 | 3300005365 | Ga0070688_100051441 | Ga0070688_1000514412 | 285 |
| 272 | 3300005366 | Ga0070659_100013207 | Ga0070659_1000132073 | 285 |
| 273 | 3300005367 | Ga0070667_100033888 | Ga0070667_1000338882 | 285 |
| 274 | 3300005367 | Ga0070667_100197088 | Ga0070667_1001970882 | 285 |
| 275 | 3300005456 | Ga0070678_100022366 | Ga0070678_1000223662 | 285 |
| 276 | 3300005457 | Ga0070662_100013466 | Ga0070662_1000134664 | 285 |
| 277 | 3300005457 | Ga0070662_100021109 | Ga0070662_1000211095 | 285 |
| 278 | 3300005457 | Ga0070662_100075421 | Ga0070662_1000754213 | 285 |
| 279 | 3300005458 | Ga0070681_10006746 | Ga0070681_100067468 | 285 |
| 280 | 3300005459 | Ga0068867_100022653 | Ga0068867_1000226534 | 285 |
| 281 | 3300005459 | Ga0068867_100033639 | Ga0068867_1000336393 | 285 |
| 282 | 3300005459 | Ga0068867_100035811 | Ga0068867_1000358114 | 285 |
| 283 | 3300005459 | Ga0068867_100080041 | Ga0068867_1000800413 | 285 |
| 284 | 3300005459 | Ga0068867_100091658 | Ga0068867_1000916582 | 285 |
| 285 | 3300005466 | Ga0070685_10040904 | Ga0070685_100409042 | 285 |
| 286 | 3300005466 | Ga0070685_10233509 | Ga0070685_102335091 | 285 |
| 287 | 3300005471 | Ga0070698_100000936 | Ga0070698_10000093623 | 285 |
| 288 | 3300005471 | Ga0070698_100003346 | Ga0070698_1000033467 | 285 |
| 289 | 3300005535 | Ga0070684_100033002 | Ga0070684_1000330025 | 285 |
| 290 | 3300005539 | Ga0068853_100046722 | Ga0068853_1000467223 | 285 |
| 291 | 3300005539 | Ga0068853_100070624 | Ga0068853_1000706245 | 285 |
| 292 | 3300005543 | Ga0070672_100175560 | Ga0070672_1001755602 | 285 |
| 293 | 3300005544 | Ga0070686_100014676 | Ga0070686_1000146764 | 285 |
| 294 | 3300005544 | Ga0070686_100195727 | Ga0070686_1001957272 | 285 |
| 295 | 3300005549 | Ga0070704_100219681 | Ga0070704_1002196811 | 285 |
| 296 | 3300005563 | Ga0068855_100348302 | Ga0068855_1003483021 | 285 |
| 297 | 3300005564 | Ga0070664_100003972 | Ga0070664_1000039727 | 285 |
| 298 | 3300005564 | Ga0070664_100013148 | Ga0070664_1000131485 | 285 |
| 299 | 3300005564 | Ga0070664_100124706 | Ga0070664_1001247062 | 285 |
| 300 | 3300005564 | Ga0070664_100187689 | Ga0070664_1001876892 | 285 |
| 301 | 3300005564 | Ga0070664_100473572 | Ga0070664_1004735721 | 285 |
| 302 | 3300005577 | Ga0068857_100058936 | Ga0068857_1000589363 | 285 |
| 303 | 3300005577 | Ga0068857_100584040 | Ga0068857_1005840401 | 285 |
| 304 | 3300005578 | Ga0068854_100007114 | Ga0068854_1000071148 | 285 |
| 305 | 3300005578 | Ga0068854_100058975 | Ga0068854_1000589753 | 285 |
| 306 | 3300005578 | Ga0068854_100073472 | Ga0068854_1000734722 | 285 |
| 307 | 3300005614 | Ga0068856_100152701 | Ga0068856_1001527012 | 285 |
| 308 | 3300005614 | Ga0068856_100263112 | Ga0068856_1002631122 | 285 |
| 309 | 3300005615 | Ga0070702_100148462 | Ga0070702_1001484621 | 285 |
| 310 | 3300005616 | Ga0068852_100005008 | Ga0068852_1000050084 | 285 |
| 311 | 3300005616 | Ga0068852_100005930 | Ga0068852_1000059307 | 285 |
| 312 | 3300005616 | Ga0068852_100048616 | Ga0068852_1000486163 | 285 |
| 313 | 3300005617 | Ga0068859_100050663 | Ga0068859_1000506632 | 285 |
| 314 | 3300005617 | Ga0068859_100058045 | Ga0068859_1000580455 | 285 |
| 315 | 3300005617 | Ga0068859_100102936 | Ga0068859_1001029361 | 285 |
| 316 | 3300005617 | Ga0068859_100132306 | Ga0068859_1001323062 | 285 |
| 317 | 3300005617 | Ga0068859_100181666 | Ga0068859_1001816662 | 285 |
| 318 | 3300005617 | Ga0068859_100369522 | Ga0068859_1003695222 | 285 |
| 319 | 3300005618 | Ga0068864_100005936 | Ga0068864_10000593613 | 285 |
| 320 | 3300005618 | Ga0068864_100057224 | Ga0068864_1000572242 | 285 |
| 321 | 3300005618 | Ga0068864_100073871 | Ga0068864_1000738713 | 285 |
| 322 | 3300005618 | Ga0068864_100181639 | Ga0068864_1001816392 | 285 |
| 323 | 3300005718 | Ga0068866_10012173 | Ga0068866_100121733 | 285 |
| 324 | 3300005718 | Ga0068866_10017509 | Ga0068866_100175094 | 285 |
| 325 | 3300005719 | Ga0068861_100002657 | Ga0068861_1000026579 | 285 |
| 326 | 3300005719 | Ga0068861_100053413 | Ga0068861_1000534132 | 285 |
| 327 | 3300005834 | Ga0068851_10060841 | Ga0068851_100608412 | 285 |
| 328 | 3300005840 | Ga0068870_10024468 | Ga0068870_100244682 | 285 |
| 329 | 3300005841 | Ga0068863_100035606 | Ga0068863_1000356065 | 285 |
| 330 | 3300005841 | Ga0068863_100309792 | Ga0068863_1003097922 | 285 |
| 331 | 3300005843 | Ga0068860_100304548 | Ga0068860_1003045482 | 285 |
| 332 | 3300005844 | Ga0068862_100013727 | Ga0068862_1000137278 | 285 |
| 333 | 3300005844 | Ga0068862_100103861 | Ga0068862_1001038613 | 285 |
| 334 | 3300005844 | Ga0068862_100269983 | Ga0068862_1002699832 | 285 |
| 335 | 3300006195 | Ga0075366_10033092 | Ga0075366_100330923 | 285 |
| 336 | 3300006844 | Ga0075428_100004467 | Ga0075428_1000044673 | 285 |
| 337 | 3300006844 | Ga0075428_100045987 | Ga0075428_1000459874 | 285 |
| 338 | 3300006844 | Ga0075428_100500532 | Ga0075428_1005005321 | 285 |
| 339 | 3300006846 | Ga0075430_100005032 | Ga0075430_1000050329 | 285 |
| 340 | 3300006847 | Ga0075431_100018066 | Ga0075431_1000180662 | 285 |
| 341 | 3300006880 | Ga0075429_100108610 | Ga0075429_1001086103 | 285 |
| 342 | 3300006881 | Ga0068865_100018228 | Ga0068865_1000182283 | 285 |
| 343 | 3300006881 | Ga0068865_100405711 | Ga0068865_1004057111 | 285 |
| 344 | 3300006931 | Ga0097620_100016642 | Ga0097620_1000166423 | 285 |
| 345 | 3300006931 | Ga0097620_100050660 | Ga0097620_1000506602 | 285 |
| 346 | 3300006931 | Ga0097620_100058044 | Ga0097620_1000580445 | 285 |
| 347 | 3300006931 | Ga0097620_100102944 | Ga0097620_1001029441 | 285 |
| 348 | 3300006931 | Ga0097620_100132315 | Ga0097620_1001323152 | 285 |
| 349 | 3300006931 | Ga0097620_100181670 | Ga0097620_1001816702 | 285 |
| 350 | 3300006931 | Ga0097620_100369492 | Ga0097620_1003694922 | 285 |
| 351 | 3300009093 | Ga0105240_10010049 | Ga0105240_1001004910 | 285 |
| 352 | 3300009093 | Ga0105240_10032954 | Ga0105240_100329546 | 285 |
| 353 | 3300009093 | Ga0105240_10046443 | Ga0105240_100464436 | 285 |
| 354 | 3300009093 | Ga0105240_10079202 | Ga0105240_100792024 | 285 |
| 355 | 3300009094 | Ga0111539_10016041 | Ga0111539_100160416 | 285 |
| 356 | 3300009094 | Ga0111539_10452493 | Ga0111539_104524932 | 285 |
| 357 | 3300009101 | Ga0105247_10014759 | Ga0105247_100147595 | 285 |
| 358 | 3300009147 | Ga0114129_10225572 | Ga0114129_102255723 | 285 |
| 359 | 3300009174 | Ga0105241_10256888 | Ga0105241_102568881 | 285 |
| 360 | 3300009176 | Ga0105242_10016107 | Ga0105242_100161077 | 285 |
| 361 | 3300009176 | Ga0105242_10031148 | Ga0105242_100311481 | 285 |
| 362 | 3300009176 | Ga0105242_10051408 | Ga0105242_100514085 | 285 |
| 363 | 3300009545 | Ga0105237_10153726 | Ga0105237_101537262 | 285 |
| 364 | 3300009545 | Ga0105237_10164721 | Ga0105237_101647212 | 285 |
| 365 | 3300009551 | Ga0105238_10010139 | Ga0105238_100101398 | 285 |
| 366 | 3300009553 | Ga0105249_10001693 | Ga0105249_1000169313 | 285 |
| 367 | 3300009553 | Ga0105249_10008239 | Ga0105249_100082392 | 285 |
| 368 | 3300009553 | Ga0105249_10528850 | Ga0105249_105288501 | 285 |
| 369 | 3300010375 | Ga0105239_10282818 | Ga0105239_102828182 | 285 |
| 370 | 3300011119 | Ga0105246_10058498 | Ga0105246_100584982 | 285 |
| 371 | 3300011119 | Ga0105246_10076639 | Ga0105246_100766392 | 285 |
| 372 | 3300013102 | Ga0157371_10007473 | Ga0157371_100074738 | 285 |
| 373 | 3300013102 | Ga0157371_10039565 | Ga0157371_100395651 | 285 |
| 374 | 3300013104 | Ga0157370_10008393 | Ga0157370_100083939 | 285 |
| 375 | 3300013296 | Ga0157374_10000411 | Ga0157374_1000041133 | 285 |
| 376 | 3300013296 | Ga0157374_10004791 | Ga0157374_100047913 | 285 |
| 377 | 3300013296 | Ga0157374_10125752 | Ga0157374_101257522 | 285 |
| 378 | 3300013296 | Ga0157374_10228006 | Ga0157374_102280062 | 285 |
| 379 | 3300013296 | Ga0157374_10318835 | Ga0157374_103188352 | 285 |
| 380 | 3300013297 | Ga0157378_10069191 | Ga0157378_100691912 | 285 |
| 381 | 3300013297 | Ga0157378_10371451 | Ga0157378_103714512 | 285 |
| 382 | 3300013306 | Ga0163162_10009885 | Ga0163162_100098855 | 285 |
| 383 | 3300013306 | Ga0163162_10063705 | Ga0163162_100637052 | 285 |
| 384 | 3300013307 | Ga0157372_10001647 | Ga0157372_1000164711 | 285 |
| 385 | 3300013307 | Ga0157372_10002968 | Ga0157372_1000296811 | 285 |
| 386 | 3300013307 | Ga0157372_10044507 | Ga0157372_100445074 | 285 |
| 387 | 3300013307 | Ga0157372_10093380 | Ga0157372_100933804 | 285 |
| 388 | 3300013307 | Ga0157372_10504270 | Ga0157372_105042702 | 285 |
| 389 | 3300013308 | Ga0157375_10006455 | Ga0157375_100064554 | 285 |
| 390 | 3300013308 | Ga0157375_10040868 | Ga0157375_100408685 | 285 |
| 391 | 3300013308 | Ga0157375_10071769 | Ga0157375_100717691 | 285 |
| 392 | 3300013308 | Ga0157375_10105335 | Ga0157375_101053353 | 285 |
| 393 | 3300013308 | Ga0157375_10108483 | Ga0157375_101084833 | 285 |
| 394 | 3300014325 | Ga0163163_10000261 | Ga0163163_1000026159 | 285 |
| 395 | 3300014325 | Ga0163163_10024337 | Ga0163163_100243375 | 285 |
| 396 | 3300014325 | Ga0163163_10270258 | Ga0163163_102702582 | 285 |
| 397 | 3300014325 | Ga0163163_10286702 | Ga0163163_102867023 | 285 |
| 398 | 3300014325 | Ga0163163_10494458 | Ga0163163_104944581 | 285 |
| 399 | 3300014326 | Ga0157380_10018714 | Ga0157380_100187145 | 285 |
| 400 | 3300014326 | Ga0157380_10065958 | Ga0157380_100659584 | 285 |
| 401 | 3300014745 | Ga0157377_10002452 | Ga0157377_100024523 | 285 |
| 402 | 3300014745 | Ga0157377_10128308 | Ga0157377_101283081 | 285 |
| 403 | 3300014968 | Ga0157379_10047163 | Ga0157379_100471631 | 285 |
| 404 | 3300014969 | Ga0157376_10129922 | Ga0157376_101299223 | 285 |
| 405 | 3300014969 | Ga0157376_10167760 | Ga0157376_101677602 | 285 |
| 406 | 3300017792 | Ga0163161_10020600 | Ga0163161_100206005 | 285 |
| 407 | 3300017792 | Ga0163161_10089199 | Ga0163161_100891992 | 285 |
| 408 | 3300017792 | Ga0163161_10193274 | Ga0163161_101932742 | 285 |
| 409 | 3300025899 | Ga0207642_10006099 | Ga0207642_100060994 | 285 |
| 410 | 3300025899 | Ga0207642_10103891 | Ga0207642_101038912 | 285 |
| 411 | 3300025900 | Ga0207710_10007865 | Ga0207710_100078654 | 285 |
| 412 | 3300025901 | Ga0207688_10034972 | Ga0207688_100349722 | 285 |
| 413 | 3300025903 | Ga0207680_10087750 | Ga0207680_100877502 | 285 |
| 414 | 3300025904 | Ga0207647_10000988 | Ga0207647_1000098832 | 285 |
| 415 | 3300025904 | Ga0207647_10029961 | Ga0207647_100299612 | 285 |
| 416 | 3300025907 | Ga0207645_10005943 | Ga0207645_100059438 | 285 |
| 417 | 3300025907 | Ga0207645_10009020 | Ga0207645_100090203 | 285 |
| 418 | 3300025907 | Ga0207645_10077619 | Ga0207645_100776193 | 285 |
| 419 | 3300025907 | Ga0207645_10143876 | Ga0207645_101438761 | 285 |
| 420 | 3300025908 | Ga0207643_10006271 | Ga0207643_100062713 | 285 |
| 421 | 3300025911 | Ga0207654_10153253 | Ga0207654_101532532 | 285 |
| 422 | 3300025912 | Ga0207707_10012028 | Ga0207707_100120288 | 285 |
| 423 | 3300025913 | Ga0207695_10038847 | Ga0207695_100388472 | 285 |
| 424 | 3300025913 | Ga0207695_10045424 | Ga0207695_100454244 | 285 |
| 425 | 3300025913 | Ga0207695_10045638 | Ga0207695_100456384 | 285 |
| 426 | 3300025914 | Ga0207671_10003985 | Ga0207671_1000398511 | 285 |
| 427 | 3300025918 | Ga0207662_10022813 | Ga0207662_100228133 | 285 |
| 428 | 3300025918 | Ga0207662_10081303 | Ga0207662_100813033 | 285 |
| 429 | 3300025920 | Ga0207649_10048701 | Ga0207649_100487012 | 285 |
| 430 | 3300025920 | Ga0207649_10113493 | Ga0207649_101134931 | 285 |
| 431 | 3300025920 | Ga0207649_10282129 | Ga0207649_102821291 | 285 |
| 432 | 3300025923 | Ga0207681_10046332 | Ga0207681_100463322 | 285 |
| 433 | 3300025925 | Ga0207650_10004584 | Ga0207650_100045846 | 285 |
| 434 | 3300025925 | Ga0207650_10013375 | Ga0207650_100133758 | 285 |
| 435 | 3300025925 | Ga0207650_10035392 | Ga0207650_100353924 | 285 |
| 436 | 3300025925 | Ga0207650_10228083 | Ga0207650_102280831 | 285 |
| 437 | 3300025925 | Ga0207650_10235119 | Ga0207650_102351191 | 285 |
| 438 | 3300025925 | Ga0207650_10253565 | Ga0207650_102535651 | 285 |
| 439 | 3300025926 | Ga0207659_10059732 | Ga0207659_100597324 | 285 |
| 440 | 3300025926 | Ga0207659_10061397 | Ga0207659_100613973 | 285 |
| 441 | 3300025926 | Ga0207659_10075625 | Ga0207659_100756251 | 285 |
| 442 | 3300025926 | Ga0207659_10269293 | Ga0207659_102692931 | 285 |
| 443 | 3300025931 | Ga0207644_10117869 | Ga0207644_101178692 | 285 |
| 444 | 3300025931 | Ga0207644_10177274 | Ga0207644_101772742 | 285 |
| 445 | 3300025931 | Ga0207644_10190364 | Ga0207644_101903642 | 285 |
| 446 | 3300025932 | Ga0207690_10169661 | Ga0207690_101696611 | 285 |
| 447 | 3300025933 | Ga0207706_10024096 | Ga0207706_100240965 | 285 |
| 448 | 3300025936 | Ga0207670_10005679 | Ga0207670_100056792 | 285 |
| 449 | 3300025936 | Ga0207670_10103032 | Ga0207670_101030322 | 285 |
| 450 | 3300025936 | Ga0207670_10113090 | Ga0207670_101130902 | 285 |
| 451 | 3300025938 | Ga0207704_10215667 | Ga0207704_102156671 | 285 |
| 452 | 3300025940 | Ga0207691_10036383 | Ga0207691_100363832 | 285 |
| 453 | 3300025940 | Ga0207691_10164519 | Ga0207691_101645192 | 285 |
| 454 | 3300025942 | Ga0207689_10012068 | Ga0207689_100120689 | 285 |
| 455 | 3300025942 | Ga0207689_10036012 | Ga0207689_100360122 | 285 |
| 456 | 3300025942 | Ga0207689_10089859 | Ga0207689_100898593 | 285 |
| 457 | 3300025944 | Ga0207661_10043402 | Ga0207661_100434022 | 285 |
| 458 | 3300025945 | Ga0207679_10067552 | Ga0207679_100675523 | 285 |
| 459 | 3300025945 | Ga0207679_10208953 | Ga0207679_102089532 | 285 |
| 460 | 3300025949 | Ga0207667_10000419 | Ga0207667_100004199 | 285 |
| 461 | 3300025960 | Ga0207651_10023076 | Ga0207651_100230765 | 285 |
| 462 | 3300025960 | Ga0207651_10035166 | Ga0207651_100351663 | 285 |
| 463 | 3300025961 | Ga0207712_10001641 | Ga0207712_1000164113 | 285 |
| 464 | 3300025961 | Ga0207712_10001938 | Ga0207712_100019385 | 285 |
| 465 | 3300025961 | Ga0207712_10002372 | Ga0207712_100023726 | 285 |
| 466 | 3300025972 | Ga0207668_10144150 | Ga0207668_101441501 | 285 |
| 467 | 3300025981 | Ga0207640_10011600 | Ga0207640_100116002 | 285 |
| 468 | 3300025981 | Ga0207640_10044473 | Ga0207640_100444733 | 285 |
| 469 | 3300025981 | Ga0207640_10319859 | Ga0207640_103198592 | 285 |
| 470 | 3300025986 | Ga0207658_10177109 | Ga0207658_101771092 | 285 |
| 471 | 3300026023 | Ga0207677_10004653 | Ga0207677_100046534 | 285 |
| 472 | 3300026023 | Ga0207677_10183465 | Ga0207677_101834651 | 285 |
| 473 | 3300026023 | Ga0207677_10390406 | Ga0207677_103904061 | 285 |
| 474 | 3300026023 | Ga0207677_10495012 | Ga0207677_104950121 | 285 |
| 475 | 3300026035 | Ga0207703_10220236 | Ga0207703_102202362 | 285 |
| 476 | 3300026035 | Ga0207703_10275059 | Ga0207703_102750591 | 285 |
| 477 | 3300026041 | Ga0207639_10098869 | Ga0207639_100988692 | 285 |
| 478 | 3300026041 | Ga0207639_10216017 | Ga0207639_102160172 | 285 |
| 479 | 3300026041 | Ga0207639_10434971 | Ga0207639_104349711 | 285 |
| 480 | 3300026067 | Ga0207678_10029562 | Ga0207678_100295623 | 285 |
| 481 | 3300026075 | Ga0207708_10051481 | Ga0207708_100514812 | 285 |
| 482 | 3300026078 | Ga0207702_10036343 | Ga0207702_100363433 | 285 |
| 483 | 3300026078 | Ga0207702_10400771 | Ga0207702_104007711 | 285 |
| 484 | 3300026088 | Ga0207641_10000730 | Ga0207641_100007309 | 285 |
| 485 | 3300026088 | Ga0207641_10029778 | Ga0207641_100297784 | 285 |
| 486 | 3300026088 | Ga0207641_10095484 | Ga0207641_100954843 | 285 |
| 487 | 3300026089 | Ga0207648_10008178 | Ga0207648_100081787 | 285 |
| 488 | 3300026089 | Ga0207648_10016701 | Ga0207648_100167017 | 285 |
| 489 | 3300026089 | Ga0207648_10025061 | Ga0207648_100250616 | 285 |
| 490 | 3300026089 | Ga0207648_10042119 | Ga0207648_100421193 | 285 |
| 491 | 3300026089 | Ga0207648_10224246 | Ga0207648_102242462 | 285 |
| 492 | 3300026095 | Ga0207676_10008125 | Ga0207676_100081253 | 285 |
| 493 | 3300026095 | Ga0207676_10195523 | Ga0207676_101955232 | 285 |
| 494 | 3300026116 | Ga0207674_10015776 | Ga0207674_100157768 | 285 |
| 495 | 3300026116 | Ga0207674_10021519 | Ga0207674_100215198 | 285 |
| 496 | 3300026116 | Ga0207674_10022873 | Ga0207674_100228738 | 285 |
| 497 | 3300026116 | Ga0207674_10051391 | Ga0207674_100513914 | 285 |
| 498 | 3300026118 | Ga0207675_100031951 | Ga0207675_1000319513 | 285 |
| 499 | 3300026118 | Ga0207675_100060240 | Ga0207675_1000602403 | 285 |
| 500 | 3300026118 | Ga0207675_100101239 | Ga0207675_1001012394 | 285 |
| 501 | 3300026118 | Ga0207675_100228341 | Ga0207675_1002283412 | 285 |
| 502 | 3300026121 | Ga0207683_10004324 | Ga0207683_100043245 | 285 |
| 503 | 3300026121 | Ga0207683_10011177 | Ga0207683_100111777 | 285 |
| 504 | 3300026142 | Ga0207698_10007210 | Ga0207698_100072105 | 285 |
| 505 | 3300026142 | Ga0207698_10050386 | Ga0207698_100503863 | 285 |
| 506 | 3300026142 | Ga0207698_10398620 | Ga0207698_103986202 | 285 |
| 507 | 3300028379 | Ga0268266_10068183 | Ga0268266_100681831 | 285 |
| 508 | 3300028379 | Ga0268266_10282131 | Ga0268266_102821311 | 285 |
| 509 | 3300028380 | Ga0268265_10200528 | Ga0268265_102005281 | 285 |
| 510 | 3300028380 | Ga0268265_10205583 | Ga0268265_102055833 | 285 |
| 511 | 3300028381 | Ga0268264_10056103 | Ga0268264_100561032 | 285 |
| 512 | 3300031247 | Ga0265340_10089548 | Ga0265340_100895482 | 285 |
| 513 | 3300032005 | Ga0307411_10306347 | Ga0307411_103063472 | 285 |
| 514 | 3300032005 | Ga0307411_10339218 | Ga0307411_103392181 | 285 |
| 515 | 3300033179 | Ga0307507_10000170 | Ga0307507_1000017026 | 285 |
| 516 | 3300036401 | Ga0373937_0043275 | Ga0373937_0043275_1653_2612 | 285 |
| 517 | 3300037418 | Ga0395900_0117419 | Ga0395900_0117419_416_1381 | 285 |
| 518 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_436877_437854 | 285 |
| 519 | 3300037471 | Ga0395905_0016411 | Ga0395905_0016411_5082_6047 | 285 |
| 520 | 3300037471 | Ga0395905_0083520 | Ga0395905_0083520_12_977 | 285 |
| 521 | 3300038443 | Ga0395901_0003783 | Ga0395901_0003783_11941_12921 | 285 |
| 522 | 3300042007 | Ga0439449_0010736 | Ga0439449_0010736_1393_2358 | 285 |
| 523 | 3300042125 | Ga0450923_002279 | Ga0450923_002279_1372_2331 | 285 |
| 524 | 3300042131 | Ga0450894_004100 | Ga0450894_004100_831_1796 | 285 |
| 525 | 3300042134 | Ga0450898_004923 | Ga0450898_004923_1018_1983 | 285 |
| 526 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_1516999_1517979 | 285 |
| 527 | 3300046511 | Ga0495608_0062593 | Ga0495608_0062593_1424_2383 | 285 |
| 528 | 3300046516 | Ga0495628_0013015 | Ga0495628_0013015_5866_6825 | 285 |
| 529 | 3300046517 | Ga0495630_0021568 | Ga0495630_0021568_1205_2164 | 285 |
| 530 | 3300046535 | Ga0495586_0017743 | Ga0495586_0017743_888_1847 | 285 |
| 531 | 3300046537 | Ga0495598_0022800 | Ga0495598_0022800_75_1034 | 285 |
| 532 | 3300046642 | Ga0495634_0071196 | Ga0495634_0071196_1150_2109 | 285 |
| 533 | 3300046663 | Ga0495635_0016878 | Ga0495635_0016878_573_1532 | 285 |
| 534 | 3300046675 | Ga0495657_0109673 | Ga0495657_0109673_190_1149 | 285 |
| 535 | 3300046689 | Ga0495613_0023524 | Ga0495613_0023524_742_1701 | 285 |
| 536 | 3300047320 | Ga0495672_0012808 | Ga0495672_0012808_2645_3607 | 285 |
| 537 | 3300047320 | Ga0495672_0072999 | Ga0495672_0072999_304_1269 | 285 |
| 538 | 3300047472 | Ga0495686_0007933 | Ga0495686_0007933_2140_3105 | 285 |
| 539 | 3300047472 | Ga0495686_0019848 | Ga0495686_0019848_1770_2735 | 285 |
| 540 | 3300048913 | Ga0496110_0076570 | Ga0496110_0076570_544_1503 | 285 |
| 541 | 3300049513 | Ga0501290_002932 | Ga0501290_002932_715_1755 | 285 |
| 542 | 3300049516 | Ga0501293_002582 | Ga0501293_002582_53_1093 | 285 |
| 543 | 3300049568 | Ga0501031_0001600 | Ga0501031_0001600_11981_12946 | 285 |
| 544 | 3300049569 | Ga0501032_0050991 | Ga0501032_0050991_1049_2014 | 285 |
| 545 | 3300049569 | Ga0501032_0065140 | Ga0501032_0065140_334_1299 | 285 |
| 546 | 3300049571 | Ga0501034_0050622 | Ga0501034_0050622_810_1775 | 285 |
| 547 | 3300049571 | Ga0501034_0087078 | Ga0501034_0087078_919_1884 | 285 |
| 548 | 3300049572 | Ga0501036_0005556 | Ga0501036_0005556_1416_2381 | 285 |
| 549 | 3300049572 | Ga0501036_0005726 | Ga0501036_0005726_1584_2549 | 285 |
| 550 | 3300049573 | Ga0501037_0027053 | Ga0501037_0027053_1915_2880 | 285 |
| 551 | 3300049574 | Ga0501038_0034595 | Ga0501038_0034595_2218_3183 | 285 |
| 552 | 3300049575 | Ga0501039_0005269 | Ga0501039_0005269_6566_7531 | 285 |
| 553 | 3300049579 | Ga0501043_0015546 | Ga0501043_0015546_3487_4452 | 285 |
| 554 | 3300049579 | Ga0501043_0037488 | Ga0501043_0037488_1530_2495 | 285 |
| 555 | 3300049579 | Ga0501043_0075016 | Ga0501043_0075016_170_1138 | 285 |
| 556 | 3300049580 | Ga0501046_0039611 | Ga0501046_0039611_851_1816 | 285 |
| 557 | 3300049580 | Ga0501046_0094373 | Ga0501046_0094373_343_1308 | 285 |
| 558 | 3300049581 | Ga0501047_0027972 | Ga0501047_0027972_1537_2502 | 285 |
| 559 | 3300049588 | Ga0501072_0058117 | Ga0501072_0058117_864_1823 | 285 |
| 560 | 3300049589 | Ga0501073_0023518 | Ga0501073_0023518_1936_2901 | 285 |
| 561 | 3300049590 | Ga0501074_0000591 | Ga0501074_0000591_16894_17859 | 285 |
| 562 | 3300049649 | Ga0501198_002065 | Ga0501198_002065_746_1786 | 285 |
| 563 | 3300049663 | Ga0501223_002142 | Ga0501223_002142_2303_3343 | 285 |
| 564 | 3300049668 | Ga0501233_004133 | Ga0501233_004133_525_1565 | 285 |
| 565 | 3300049669 | Ga0501235_016090 | Ga0501235_016090_624_1589 | 285 |
| 566 | 3300049675 | Ga0501243_004110 | Ga0501243_004110_25_990 | 285 |
| 567 | 3300049682 | Ga0501252_002421 | Ga0501252_002421_169_1218 | 285 |
| 568 | 3300049688 | Ga0501259_002506 | Ga0501259_002506_715_1677 | 285 |
| 569 | 3300049688 | Ga0501259_002880 | Ga0501259_002880_128_1177 | 285 |
| 570 | 3300049705 | Ga0501225_0001741 | Ga0501225_0001741_2676_3716 | 285 |
| 571 | 3300049707 | Ga0501234_000344 | Ga0501234_000344_1085_2134 | 285 |
| 572 | 3300049707 | Ga0501234_012990 | Ga0501234_012990_12_977 | 285 |
| 573 | 3300049742 | Ga0501080_0111345 | Ga0501080_0111345_399_1364 | 285 |
| 574 | 3300049763 | Ga0501266_002788 | Ga0501266_002788_25_987 | 285 |
| 575 | 3300049768 | Ga0501271_005263 | Ga0501271_005263_28_1077 | 285 |
| 576 | 3300049822 | Ga0501035_0057398 | Ga0501035_0057398_2035_3000 | 285 |
| 577 | 3300049823 | Ga0501044_0035878 | Ga0501044_0035878_2563_3528 | 285 |
| 578 | 3300049823 | Ga0501044_0166347 | Ga0501044_0166347_357_1322 | 285 |
| 579 | 3300050005 | Ga0501284_00033 | Ga0501284_00033_40930_41895 | 285 |
| 580 | 3300050493 | nmdc:mga0k408_48831_c1 | nmdc:mga0k408_48831_c1_413_1378 | 285 |
| 581 | 3300050507 | nmdc:mga05p37_222343_c1 | nmdc:mga05p37_222343_c1_505_1464 | 285 |
| 582 | 3300050508 | nmdc:mga09592_105905_c1 | nmdc:mga09592_105905_c1_165_1124 | 285 |
| 583 | 3300050509 | nmdc:mga0qj67_34474_c1 | nmdc:mga0qj67_34474_c1_2218_3177 | 285 |
| 584 | 3300050511 | nmdc:mga08y16_533070_c1 | nmdc:mga08y16_533070_c1_186_1145 | 285 |
| 585 | 3300053139 | Ga0500568_0002946 | Ga0500568_0002946_4442_5404 | 285 |
| 586 | 3300053727 | Ga0500611_000011 | Ga0500611_000011_95262_96227 | 285 |
| 587 | 3300054114 | Ga0501084_0092724 | Ga0501084_0092724_1011_1976 | 285 |
| 588 | 2162886007 | SwRhRL2b_contig_1762462 | SwRhRL2b_0592.00004040 | 286 |
| 589 | 3300001990 | JGI24737J22298_10000171 | JGI24737J22298_100001711 | 286 |
| 590 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_100000065 | 286 |
| 591 | 3300002737 | JGI25162J39368_1000180 | JGI25162J39368_100018048 | 286 |
| 592 | 3300003316 | rootH1_10084579 | rootH1_100845792 | 286 |
| 593 | 3300003320 | rootH2_10016295 | rootH2_1001629525 | 286 |
| 594 | 3300003320 | rootH2_10295593 | rootH2_102955932 | 286 |
| 595 | 3300003322 | rootL2_10004550 | rootL2_100045505 | 286 |
| 596 | 3300003323 | rootH1_10010249 | rootH1_100102493 | 286 |
| 597 | 3300003323 | rootH1_10187770 | rootH1_101877704 | 286 |
| 598 | 3300005289 | Ga0065704_10000188 | Ga0065704_10000188214 | 286 |
| 599 | 3300005456 | Ga0070678_100135362 | Ga0070678_1001353622 | 286 |
| 600 | 3300005548 | Ga0070665_100003187 | Ga0070665_10000318713 | 286 |
| 601 | 3300005563 | Ga0068855_100124705 | Ga0068855_1001247052 | 286 |
| 602 | 3300005578 | Ga0068854_100079315 | Ga0068854_1000793152 | 286 |
| 603 | 3300005614 | Ga0068856_100544908 | Ga0068856_1005449082 | 286 |
| 604 | 3300006195 | Ga0075366_10009372 | Ga0075366_100093726 | 286 |
| 605 | 3300009093 | Ga0105240_10324552 | Ga0105240_103245522 | 286 |
| 606 | 3300009545 | Ga0105237_10002313 | Ga0105237_100023137 | 286 |
| 607 | 3300009545 | Ga0105237_10025406 | Ga0105237_100254064 | 286 |
| 608 | 3300009545 | Ga0105237_10037120 | Ga0105237_100371202 | 286 |
| 609 | 3300010375 | Ga0105239_10000190 | Ga0105239_1000019067 | 286 |
| 610 | 3300010375 | Ga0105239_10004108 | Ga0105239_1000410813 | 286 |
| 611 | 3300010375 | Ga0105239_10459259 | Ga0105239_104592591 | 286 |
| 612 | 3300013102 | Ga0157371_10013504 | Ga0157371_100135042 | 286 |
| 613 | 3300013297 | Ga0157378_10055697 | Ga0157378_100556972 | 286 |
| 614 | 3300013297 | Ga0157378_10073212 | Ga0157378_100732122 | 286 |
| 615 | 3300013306 | Ga0163162_10043246 | Ga0163162_100432465 | 286 |
| 616 | 3300013307 | Ga0157372_10041645 | Ga0157372_100416452 | 286 |
| 617 | 3300013307 | Ga0157372_10184526 | Ga0157372_101845262 | 286 |
| 618 | 3300014326 | Ga0157380_10000466 | Ga0157380_1000046620 | 286 |
| 619 | 3300025233 | Ga0209437_100148 | Ga0209437_10014815 | 286 |
| 620 | 3300025904 | Ga0207647_10131530 | Ga0207647_101315302 | 286 |
| 621 | 3300025914 | Ga0207671_10000130 | Ga0207671_1000013084 | 286 |
| 622 | 3300025914 | Ga0207671_10001167 | Ga0207671_100011677 | 286 |
| 623 | 3300025914 | Ga0207671_10023941 | Ga0207671_100239413 | 286 |
| 624 | 3300025949 | Ga0207667_10096730 | Ga0207667_100967302 | 286 |
| 625 | 3300026078 | Ga0207702_10008491 | Ga0207702_100084912 | 286 |
| 626 | 3300028379 | Ga0268266_10002951 | Ga0268266_1000295110 | 286 |
| 627 | 3300028573 | Ga0265334_10017059 | Ga0265334_100170593 | 286 |
| 628 | 3300028794 | Ga0307515_10002152 | Ga0307515_100021526 | 286 |
| 629 | 3300028794 | Ga0307515_10002588 | Ga0307515_1000258827 | 286 |
| 630 | 3300031251 | Ga0265327_10000022 | Ga0265327_10000022177 | 286 |
| 631 | 3300031251 | Ga0265327_10023225 | Ga0265327_100232252 | 286 |
| 632 | 3300037312 | Ga0395899_0000025 | Ga0395899_0000025_123746_124726 | 286 |
| 633 | 3300037418 | Ga0395900_0194251 | Ga0395900_0194251_878_1861 | 286 |
| 634 | 3300037471 | Ga0395905_0000580 | Ga0395905_0000580_26927_27904 | 286 |
| 635 | 3300044712 | Ga0453684_0003103 | Ga0453684_0003103_8355_9326 | 286 |
| 636 | 3300044765 | Ga0466970_0034986 | Ga0466970_0034986_1308_2285 | 286 |
| 637 | 3300046471 | Ga0495650_0000238 | Ga0495650_0000238_82059_83036 | 286 |
| 638 | 3300046474 | Ga0495605_0082384 | Ga0495605_0082384_247_1224 | 286 |
| 639 | 3300046492 | Ga0495585_0000585 | Ga0495585_0000585_11685_12662 | 286 |
| 640 | 3300046492 | Ga0495585_0001267 | Ga0495585_0001267_14096_15073 | 286 |
| 641 | 3300046507 | Ga0495606_0000008 | Ga0495606_0000008_308875_309852 | 286 |
| 642 | 3300046512 | Ga0495610_0001853 | Ga0495610_0001853_5352_6404 | 286 |
| 643 | 3300046512 | Ga0495610_0109259 | Ga0495610_0109259_189_1166 | 286 |
| 644 | 3300046513 | Ga0495616_0006304 | Ga0495616_0006304_5898_6935 | 286 |
| 645 | 3300046513 | Ga0495616_0007243 | Ga0495616_0007243_4757_5734 | 286 |
| 646 | 3300046513 | Ga0495616_0059868 | Ga0495616_0059868_783_1760 | 286 |
| 647 | 3300046520 | Ga0495637_0069894 | Ga0495637_0069894_242_1219 | 286 |
| 648 | 3300046524 | Ga0495648_0010757 | Ga0495648_0010757_3717_4694 | 286 |
| 649 | 3300046524 | Ga0495648_0036130 | Ga0495648_0036130_1759_2736 | 286 |
| 650 | 3300046538 | Ga0495609_0001651 | Ga0495609_0001651_9418_10395 | 286 |
| 651 | 3300046538 | Ga0495609_0029633 | Ga0495609_0029633_1459_2436 | 286 |
| 652 | 3300046558 | Ga0495633_0000388 | Ga0495633_0000388_37906_38883 | 286 |
| 653 | 3300046558 | Ga0495633_0046683 | Ga0495633_0046683_528_1580 | 286 |
| 654 | 3300046616 | Ga0495668_0000127 | Ga0495668_0000127_91824_92801 | 286 |
| 655 | 3300046660 | Ga0495625_0000017 | Ga0495625_0000017_9358_10395 | 286 |
| 656 | 3300046660 | Ga0495625_0000691 | Ga0495625_0000691_29293_30270 | 286 |
| 657 | 3300046660 | Ga0495625_0001121 | Ga0495625_0001121_11731_12708 | 286 |
| 658 | 3300046660 | Ga0495625_0010781 | Ga0495625_0010781_1240_2217 | 286 |
| 659 | 3300046660 | Ga0495625_0088404 | Ga0495625_0088404_1054_2031 | 286 |
| 660 | 3300046665 | Ga0495661_0016032 | Ga0495661_0016032_3130_4107 | 286 |
| 661 | 3300046683 | Ga0495658_0034975 | Ga0495658_0034975_584_1561 | 286 |
| 662 | 3300046694 | Ga0495649_0000008 | Ga0495649_0000008_261112_262149 | 286 |
| 663 | 3300046794 | Ga0495589_0107703 | Ga0495589_0107703_109_1086 | 286 |
| 664 | 3300047443 | Ga0495687_002605 | Ga0495687_002605_132_1109 | 286 |
| 665 | 3300047469 | Ga0495673_0010133 | Ga0495673_0010133_1198_2175 | 286 |
| 666 | 3300047472 | Ga0495686_0000299 | Ga0495686_0000299_54383_55360 | 286 |
| 667 | 3300047472 | Ga0495686_0056490 | Ga0495686_0056490_439_1416 | 286 |
| 668 | 3300048918 | Ga0496115_0001812 | Ga0496115_0001812_1137_2114 | 286 |
| 669 | 3300049571 | Ga0501034_0014477 | Ga0501034_0014477_3249_4220 | 286 |
| 670 | 3300050493 | nmdc:mga0k408_6928_c1 | nmdc:mga0k408_6928_c1_2432_3409 | 286 |
| 671 | 3300053123 | Ga0500614_037545 | Ga0500614_037545_125_1102 | 286 |
| 672 | 3300053125 | Ga0500618_000009 | Ga0500618_000009_179667_180677 | 286 |
| 673 | 3300053136 | Ga0500559_0010090 | Ga0500559_0010090_2569_3603 | 286 |
| 674 | 3300053156 | Ga0500622_0001133 | Ga0500622_0001133_17503_18480 | 286 |
| 675 | 2162886007 | SwRhRL2b_contig_1411852 | SwRhRL2b_0097.00004800 | 287 |
| 676 | 3300005288 | Ga0065714_10002212 | Ga0065714_1000221242 | 287 |
| 677 | 3300005288 | Ga0065714_10065485 | Ga0065714_1006548510 | 287 |
| 678 | 3300005288 | Ga0065714_10083187 | Ga0065714_100831872 | 287 |
| 679 | 3300005289 | Ga0065704_10000193 | Ga0065704_1000019340 | 287 |
| 680 | 3300005719 | Ga0068861_100280177 | Ga0068861_1002801772 | 287 |
| 681 | 3300013100 | Ga0157373_10000121 | Ga0157373_1000012141 | 287 |
| 682 | 3300013102 | Ga0157371_10002317 | Ga0157371_100023179 | 287 |
| 683 | 3300013102 | Ga0157371_10004753 | Ga0157371_100047532 | 287 |
| 684 | 3300013104 | Ga0157370_10002315 | Ga0157370_100023155 | 287 |
| 685 | 3300013104 | Ga0157370_10006844 | Ga0157370_100068445 | 287 |
| 686 | 3300013104 | Ga0157370_10036657 | Ga0157370_100366574 | 287 |
| 687 | 3300014497 | Ga0182008_10000018 | Ga0182008_10000018161 | 287 |
| 688 | 3300014497 | Ga0182008_10000378 | Ga0182008_1000037821 | 287 |
| 689 | 3300014968 | Ga0157379_10221478 | Ga0157379_102214782 | 287 |
| 690 | 3300015261 | Ga0182006_1000382 | Ga0182006_10003828 | 287 |
| 691 | 3300015261 | Ga0182006_1009184 | Ga0182006_10091844 | 287 |
| 692 | 3300017792 | Ga0163161_10001631 | Ga0163161_100016312 | 287 |
| 693 | 3300026118 | Ga0207675_100351759 | Ga0207675_1003517592 | 287 |
| 694 | 3300031911 | Ga0307412_10000077 | Ga0307412_1000007749 | 287 |
| 695 | 3300032004 | Ga0307414_10000967 | Ga0307414_100009675 | 287 |
| 696 | 3300032004 | Ga0307414_10001475 | Ga0307414_1000147511 | 287 |
| 697 | 3300032004 | Ga0307414_10132054 | Ga0307414_101320542 | 287 |
| 698 | 3300046506 | Ga0495583_0060132 | Ga0495583_0060132_259_1236 | 287 |
| 699 | 3300046507 | Ga0495606_0166249 | Ga0495606_0166249_197_1174 | 287 |
| 700 | 3300046665 | Ga0495661_0008349 | Ga0495661_0008349_4202_5179 | 287 |
| 701 | 3300048925 | Ga0496122_0000746 | Ga0496122_0000746_24355_25326 | 287 |
| 702 | 3300048926 | Ga0496123_0037741 | Ga0496123_0037741_1304_2275 | 287 |
| 703 | 3300048928 | Ga0496125_0102632 | Ga0496125_0102632_888_1859 | 287 |
| 704 | 3300053093 | Ga0500651_0000127 | Ga0500651_0000127_23952_24923 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.9005 | 1 | 149 |
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.88 | 1 | 146 |
| 3ih5-assembly1.cif.gz_B | crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron | 0.8639 | 2 | 146 |
| 7qh2-assembly1.cif.gz_E | cryo-em structure of ldh-etfab complex from acetobacterium woodii | 0.7991 | 3 | 147 |
| 5ol2-assembly2.cif.gz_E | the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile | 0.7817 | 1 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9769 | 158 | 287 | 3.40.50.1220 |
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9552 | 158 | 287 | 3.40.50.1220 |
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9349 | 157 | 283 | 3.40.50.1220 |
| 1o97D02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9172 | 169 | 285 | 3.40.50.1220 |
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9138 | 157 | 283 | 3.40.50.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2ZBZ4-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9906 | 174 | 286 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A662D2H4-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9903 | 180 | 287 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-X0S2B0-F1-model_v4 | Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein | 0.9898 | 163 | 286 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A6J7HL09-F1-model_v4 | Unannotated protein | 0.9897 | 171 | 284 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A355RCY1-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9886 | 177 | 282 |
GO:0009055
GO:0033539 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar