F476385
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 258 | 704 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300061734|Ga0530510_0523958|Ga0530510_0523958_62_853 |
| Length | 263 |
| Sequence | MTPPGRRRVDGKVALISGGARGQGASHGRLLAEHGARVVLGDILDGPGADTAGWLRQEGLEVRYVHLDVTRPEDWDAAVAVAEQSYGKLDVLVNNAGITGSASIVDCPLEEWQSVVAVNQTGVFLGIQRAVPALRRAGGGSIINVASVVATLGTESMIAYQASKAAVHQLTRAAAVTLAPDIRVNTVTPGIVTGTAMAAGLDPAWLEARLAVYPMGRGARVEEVSHAVLFLASDESSFTTGADLRVDGGALAGVKRRRFRADP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 186 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 187 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 188 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 189 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 190 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 191 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 192 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 257 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.41 |
| Rhizosphere | 97.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10012005 | 3300002067 | Bacteria | 2741 |
| 2 | JGI26129J50193_1003564 | 3300003349 | Bacteria | 1094 |
| 3 | JGI25407J50210_10033392 | 3300003373 | Bacteria | 1328 |
| 4 | JGI26141J51220_1001422 | 3300003503 | Bacteria | 1447 |
| 5 | Ga0065704_10314564 | 3300005289 | Bacteria | 863 |
| 6 | Ga0065715_10369058 | 3300005293 | Bacteria | 924 |
| 7 | Ga0070676_10001508 | 3300005328 | Bacteria | 11783 |
| 8 | Ga0070683_100040464 | 3300005329 | Bacteria | 4286 |
| 9 | Ga0070690_100118531 | 3300005330 | Bacteria | 1774 |
| 10 | Ga0070690_100227937 | 3300005330 | Bacteria | 1309 |
| 11 | Ga0070690_100516391 | 3300005330 | Bacteria | 896 |
| 12 | Ga0070670_100005711 | 3300005331 | Bacteria | 10515 |
| 13 | Ga0068869_100001826 | 3300005334 | Bacteria | 12787 |
| 14 | Ga0068869_100002053 | 3300005334 | Bacteria | 12100 |
| 15 | Ga0070680_100011525 | 3300005336 | Bacteria | 6841 |
| 16 | Ga0070680_100029669 | 3300005336 | Bacteria | 4392 |
| 17 | Ga0070680_100034957 | 3300005336 | Bacteria | 4055 |
| 18 | Ga0070680_100346515 | 3300005336 | Bacteria | 1263 |
| 19 | Ga0070682_100010168 | 3300005337 | Bacteria | 5335 |
| 20 | Ga0068868_100186906 | 3300005338 | Bacteria | 1722 |
| 21 | Ga0070660_100006407 | 3300005339 | Bacteria | 8158 |
| 22 | Ga0070689_100086275 | 3300005340 | Bacteria | 2469 |
| 23 | Ga0070691_10001908 | 3300005341 | Bacteria | 9140 |
| 24 | Ga0070691_10004132 | 3300005341 | Bacteria | 6593 |
| 25 | Ga0070691_10023591 | 3300005341 | Bacteria | 2857 |
| 26 | Ga0070661_100004542 | 3300005344 | Bacteria | 9551 |
| 27 | Ga0070692_10096760 | 3300005345 | Bacteria | 1613 |
| 28 | Ga0070668_100158679 | 3300005347 | Bacteria | 1834 |
| 29 | Ga0070669_100009553 | 3300005353 | Bacteria | 6906 |
| 30 | Ga0070669_100383192 | 3300005353 | Bacteria | 1147 |
| 31 | Ga0070675_100096848 | 3300005354 | Bacteria | 2479 |
| 32 | Ga0070659_100000322 | 3300005366 | Bacteria | 36690 |
| 33 | Ga0070703_10000793 | 3300005406 | Bacteria | 10349 |
| 34 | Ga0070703_10005280 | 3300005406 | Bacteria | 3610 |
| 35 | Ga0070709_10045578 | 3300005434 | Bacteria | 2722 |
| 36 | Ga0070701_10055062 | 3300005438 | Bacteria | 2076 |
| 37 | Ga0070711_100462505 | 3300005439 | Bacteria | 1040 |
| 38 | Ga0070705_100002220 | 3300005440 | Bacteria | 9870 |
| 39 | Ga0070705_100019189 | 3300005440 | Bacteria | 3596 |
| 40 | Ga0070705_100048811 | 3300005440 | Bacteria | 2454 |
| 41 | Ga0070705_100068779 | 3300005440 | Bacteria | 2133 |
| 42 | Ga0070700_100019386 | 3300005441 | Bacteria | 3925 |
| 43 | Ga0070700_100054686 | 3300005441 | Bacteria | 2495 |
| 44 | Ga0070694_100000296 | 3300005444 | Bacteria | 26721 |
| 45 | Ga0070694_100000326 | 3300005444 | Bacteria | 25614 |
| 46 | Ga0070694_100020927 | 3300005444 | Bacteria | 4175 |
| 47 | Ga0070694_100054799 | 3300005444 | Bacteria | 2702 |
| 48 | Ga0070694_100145888 | 3300005444 | Bacteria | 1723 |
| 49 | Ga0070694_100468245 | 3300005444 | Bacteria | 998 |
| 50 | Ga0070708_100011197 | 3300005445 | Bacteria | 7295 |
| 51 | Ga0070708_100015611 | 3300005445 | Bacteria | 6276 |
| 52 | Ga0070708_100028675 | 3300005445 | Bacteria | 4793 |
| 53 | Ga0070708_100032014 | 3300005445 | Bacteria | 4557 |
| 54 | Ga0070708_100069682 | 3300005445 | Bacteria | 3163 |
| 55 | Ga0070708_100129176 | 3300005445 | Bacteria | 2338 |
| 56 | Ga0070708_100132915 | 3300005445 | Bacteria | 2304 |
| 57 | Ga0070708_100385405 | 3300005445 | Bacteria | 1322 |
| 58 | Ga0070663_100011713 | 3300005455 | Bacteria | 5518 |
| 59 | Ga0070662_100002852 | 3300005457 | Bacteria | 10713 |
| 60 | Ga0070662_100125151 | 3300005457 | Bacteria | 1975 |
| 61 | Ga0070662_100411032 | 3300005457 | Bacteria | 1118 |
| 62 | Ga0070662_100510981 | 3300005457 | Bacteria | 1003 |
| 63 | Ga0070681_10003875 | 3300005458 | Bacteria | 14078 |
| 64 | Ga0068867_100028261 | 3300005459 | Bacteria | 4037 |
| 65 | Ga0070706_100023384 | 3300005467 | Bacteria | 5691 |
| 66 | Ga0070706_100037683 | 3300005467 | Bacteria | 4464 |
| 67 | Ga0070706_100048189 | 3300005467 | Bacteria | 3933 |
| 68 | Ga0070706_100389021 | 3300005467 | Bacteria | 1298 |
| 69 | Ga0070706_100574269 | 3300005467 | Bacteria | 1048 |
| 70 | Ga0070707_100001990 | 3300005468 | Bacteria | 19558 |
| 71 | Ga0070707_100015361 | 3300005468 | Bacteria | 7184 |
| 72 | Ga0070707_100061601 | 3300005468 | Bacteria | 3599 |
| 73 | Ga0070707_100114959 | 3300005468 | Bacteria | 2611 |
| 74 | Ga0070707_100141390 | 3300005468 | Bacteria | 2342 |
| 75 | Ga0070707_100264879 | 3300005468 | Bacteria | 1672 |
| 76 | Ga0070707_100302553 | 3300005468 | Bacteria | 1554 |
| 77 | Ga0070707_100401665 | 3300005468 | Bacteria | 1330 |
| 78 | Ga0070707_100519354 | 3300005468 | Bacteria | 1153 |
| 79 | Ga0070698_100011688 | 3300005471 | Bacteria | 9312 |
| 80 | Ga0070698_100039746 | 3300005471 | Bacteria | 4839 |
| 81 | Ga0070698_100060267 | 3300005471 | Bacteria | 3829 |
| 82 | Ga0070698_100158187 | 3300005471 | Bacteria | 2211 |
| 83 | Ga0070698_100322269 | 3300005471 | Bacteria | 1476 |
| 84 | Ga0070698_100335321 | 3300005471 | Bacteria | 1444 |
| 85 | Ga0070699_100003494 | 3300005518 | Bacteria | 13891 |
| 86 | Ga0070699_100007127 | 3300005518 | Bacteria | 9714 |
| 87 | Ga0070699_100150214 | 3300005518 | Bacteria | 2060 |
| 88 | Ga0070699_100191765 | 3300005518 | Bacteria | 1816 |
| 89 | Ga0070699_100248325 | 3300005518 | Bacteria | 1589 |
| 90 | Ga0070699_100285229 | 3300005518 | Bacteria | 1479 |
| 91 | Ga0070679_100011577 | 3300005530 | Bacteria | 8405 |
| 92 | Ga0070684_100033110 | 3300005535 | Bacteria | 4410 |
| 93 | Ga0070697_100006412 | 3300005536 | Bacteria | 9108 |
| 94 | Ga0070697_100027540 | 3300005536 | Bacteria | 4548 |
| 95 | Ga0070697_100044734 | 3300005536 | Bacteria | 3586 |
| 96 | Ga0070697_100048855 | 3300005536 | Bacteria | 3431 |
| 97 | Ga0070697_100050530 | 3300005536 | Bacteria | 3375 |
| 98 | Ga0070697_100056999 | 3300005536 | Bacteria | 3179 |
| 99 | Ga0070697_100276740 | 3300005536 | Bacteria | 1439 |
| 100 | Ga0070697_100351576 | 3300005536 | Bacteria | 1273 |
| 101 | Ga0068853_100000518 | 3300005539 | Bacteria | 26167 |
| 102 | Ga0070672_100014519 | 3300005543 | Bacteria | 5585 |
| 103 | Ga0070672_100027044 | 3300005543 | Bacteria | 4276 |
| 104 | Ga0070695_100002363 | 3300005545 | Bacteria | 10833 |
| 105 | Ga0070695_100005039 | 3300005545 | Bacteria | 7784 |
| 106 | Ga0070695_100010470 | 3300005545 | Bacteria | 5537 |
| 107 | Ga0070695_100017187 | 3300005545 | Bacteria | 4386 |
| 108 | Ga0070696_100023696 | 3300005546 | Bacteria | 4173 |
| 109 | Ga0070696_100081933 | 3300005546 | Bacteria | 2287 |
| 110 | Ga0070696_100083494 | 3300005546 | Bacteria | 2266 |
| 111 | Ga0070696_100108877 | 3300005546 | Bacteria | 1993 |
| 112 | Ga0070696_100109916 | 3300005546 | Bacteria | 1984 |
| 113 | Ga0070696_100284506 | 3300005546 | Bacteria | 1262 |
| 114 | Ga0070693_100001092 | 3300005547 | Bacteria | 12169 |
| 115 | Ga0070693_100053471 | 3300005547 | Bacteria | 2319 |
| 116 | Ga0070704_100013935 | 3300005549 | Bacteria | 5008 |
| 117 | Ga0070704_100035814 | 3300005549 | Bacteria | 3377 |
| 118 | Ga0070704_100047033 | 3300005549 | Bacteria | 3013 |
| 119 | Ga0070704_100117534 | 3300005549 | Bacteria | 2035 |
| 120 | Ga0070704_100169678 | 3300005549 | Bacteria | 1734 |
| 121 | Ga0068855_100008473 | 3300005563 | Bacteria | 12431 |
| 122 | Ga0068855_100262322 | 3300005563 | Bacteria | 1924 |
| 123 | Ga0070664_100023335 | 3300005564 | Bacteria | 5109 |
| 124 | Ga0068857_100005198 | 3300005577 | Bacteria | 11076 |
| 125 | Ga0068857_100094490 | 3300005577 | Bacteria | 2678 |
| 126 | Ga0068857_100307625 | 3300005577 | Bacteria | 1462 |
| 127 | Ga0068854_100002526 | 3300005578 | Bacteria | 11320 |
| 128 | Ga0068856_100019528 | 3300005614 | Bacteria | 6578 |
| 129 | Ga0070702_100065431 | 3300005615 | Bacteria | 2129 |
| 130 | Ga0068852_100024867 | 3300005616 | Bacteria | 4845 |
| 131 | Ga0068859_100000976 | 3300005617 | Bacteria | 29307 |
| 132 | Ga0068859_100211864 | 3300005617 | Bacteria | 2024 |
| 133 | Ga0068864_100001266 | 3300005618 | Bacteria | 20986 |
| 134 | Ga0068870_10000987 | 3300005840 | Bacteria | 11236 |
| 135 | Ga0068863_100056203 | 3300005841 | Bacteria | 3727 |
| 136 | Ga0068858_100036781 | 3300005842 | Bacteria | 4540 |
| 137 | Ga0068860_100016087 | 3300005843 | Bacteria | 7298 |
| 138 | Ga0068860_100052318 | 3300005843 | Bacteria | 3885 |
| 139 | Ga0068860_100144646 | 3300005843 | Bacteria | 2287 |
| 140 | Ga0068860_100499276 | 3300005843 | Bacteria | 1214 |
| 141 | Ga0068862_100001929 | 3300005844 | Bacteria | 18827 |
| 142 | Ga0068862_100092664 | 3300005844 | Bacteria | 2634 |
| 143 | Ga0068862_100532795 | 3300005844 | Bacteria | 1119 |
| 144 | Ga0081455_10015861 | 3300005937 | Bacteria | 7295 |
| 145 | Ga0081538_10028407 | 3300005981 | Bacteria | 3847 |
| 146 | Ga0081540_1017503 | 3300005983 | Bacteria | 4434 |
| 147 | Ga0081540_1103207 | 3300005983 | Bacteria | 1223 |
| 148 | Ga0081539_10000044 | 3300005985 | Bacteria | 284021 |
| 149 | Ga0070712_100003253 | 3300006175 | Bacteria | 10001 |
| 150 | Ga0075428_100000409 | 3300006844 | Bacteria | 42695 |
| 151 | Ga0075428_100004007 | 3300006844 | Bacteria | 16168 |
| 152 | Ga0075428_100010083 | 3300006844 | Bacteria | 10496 |
| 153 | Ga0075428_100012600 | 3300006844 | Bacteria | 9401 |
| 154 | Ga0075428_100071289 | 3300006844 | Bacteria | 3798 |
| 155 | Ga0075428_100093499 | 3300006844 | Bacteria | 3278 |
| 156 | Ga0075428_100148280 | 3300006844 | Bacteria | 2549 |
| 157 | Ga0075428_100721192 | 3300006844 | Bacteria | 1062 |
| 158 | Ga0075428_100843780 | 3300006844 | Bacteria | 973 |
| 159 | Ga0075430_100000648 | 3300006846 | Bacteria | 26549 |
| 160 | Ga0075430_100002276 | 3300006846 | Bacteria | 15900 |
| 161 | Ga0075430_100006658 | 3300006846 | Bacteria | 9745 |
| 162 | Ga0075430_100041160 | 3300006846 | Bacteria | 3909 |
| 163 | Ga0075430_100059632 | 3300006846 | Bacteria | 3208 |
| 164 | Ga0075430_100420480 | 3300006846 | Bacteria | 1103 |
| 165 | Ga0075431_100000181 | 3300006847 | Bacteria | 45325 |
| 166 | Ga0075431_100001052 | 3300006847 | Bacteria | 24662 |
| 167 | Ga0075431_100003068 | 3300006847 | Bacteria | 16176 |
| 168 | Ga0075431_100003078 | 3300006847 | Bacteria | 16159 |
| 169 | Ga0075431_100009651 | 3300006847 | Bacteria | 9695 |
| 170 | Ga0075431_100080627 | 3300006847 | Bacteria | 3360 |
| 171 | Ga0075431_100093628 | 3300006847 | Bacteria | 3101 |
| 172 | Ga0075431_100203116 | 3300006847 | Bacteria | 2027 |
| 173 | Ga0075431_100311893 | 3300006847 | Bacteria | 1588 |
| 174 | Ga0075431_100473263 | 3300006847 | Bacteria | 1246 |
| 175 | Ga0075433_10001470 | 3300006852 | Bacteria | 17385 |
| 176 | Ga0075433_10002688 | 3300006852 | Bacteria | 13580 |
| 177 | Ga0075433_10017885 | 3300006852 | Bacteria | 5880 |
| 178 | Ga0075433_10025926 | 3300006852 | Bacteria | 4958 |
| 179 | Ga0075433_10067634 | 3300006852 | Bacteria | 3136 |
| 180 | Ga0075433_10073771 | 3300006852 | Bacteria | 3002 |
| 181 | Ga0075433_10100906 | 3300006852 | Bacteria | 2555 |
| 182 | Ga0075433_10221264 | 3300006852 | Bacteria | 1681 |
| 183 | Ga0075433_10229189 | 3300006852 | Bacteria | 1650 |
| 184 | Ga0075434_100006184 | 3300006871 | Bacteria | 10962 |
| 185 | Ga0075434_100010856 | 3300006871 | Bacteria | 8561 |
| 186 | Ga0075434_100037121 | 3300006871 | Bacteria | 4823 |
| 187 | Ga0075434_100045687 | 3300006871 | Bacteria | 4345 |
| 188 | Ga0075434_100078686 | 3300006871 | Bacteria | 3293 |
| 189 | Ga0075434_100122319 | 3300006871 | Bacteria | 2618 |
| 190 | Ga0075434_100125335 | 3300006871 | Bacteria | 2586 |
| 191 | Ga0075434_100134302 | 3300006871 | Bacteria | 2494 |
| 192 | Ga0075434_100213306 | 3300006871 | Bacteria | 1951 |
| 193 | Ga0075434_100640345 | 3300006871 | Bacteria | 1081 |
| 194 | Ga0075429_100000116 | 3300006880 | Bacteria | 45959 |
| 195 | Ga0075429_100006906 | 3300006880 | Bacteria | 9860 |
| 196 | Ga0075429_100009267 | 3300006880 | Bacteria | 8546 |
| 197 | Ga0075429_100010439 | 3300006880 | Bacteria | 8035 |
| 198 | Ga0075429_100010600 | 3300006880 | Bacteria | 7975 |
| 199 | Ga0075429_100011279 | 3300006880 | Bacteria | 7736 |
| 200 | Ga0075429_100042925 | 3300006880 | Bacteria | 3934 |
| 201 | Ga0075429_100100746 | 3300006880 | Bacteria | 2522 |
| 202 | Ga0075429_100141934 | 3300006880 | Bacteria | 2103 |
| 203 | Ga0075429_100430711 | 3300006880 | Bacteria | 1155 |
| 204 | Ga0068865_100098520 | 3300006881 | Bacteria | 2136 |
| 205 | Ga0068865_100100352 | 3300006881 | Bacteria | 2118 |
| 206 | Ga0075436_100027597 | 3300006914 | Bacteria | 3907 |
| 207 | Ga0075436_100035510 | 3300006914 | Bacteria | 3438 |
| 208 | Ga0075436_100179959 | 3300006914 | Bacteria | 1494 |
| 209 | Ga0097620_100000976 | 3300006931 | Bacteria | 29307 |
| 210 | Ga0097620_100211860 | 3300006931 | Bacteria | 2024 |
| 211 | Ga0075435_100005723 | 3300007076 | Bacteria | 8716 |
| 212 | Ga0075435_100006422 | 3300007076 | Bacteria | 8311 |
| 213 | Ga0075435_100010888 | 3300007076 | Bacteria | 6663 |
| 214 | Ga0075435_100042844 | 3300007076 | Bacteria | 3622 |
| 215 | Ga0075435_100160144 | 3300007076 | Bacteria | 1895 |
| 216 | Ga0075435_100400418 | 3300007076 | Bacteria | 1180 |
| 217 | Ga0099794_10045714 | 3300007265 | Bacteria | 2095 |
| 218 | Ga0111539_10001546 | 3300009094 | Bacteria | 30637 |
| 219 | Ga0111539_10016844 | 3300009094 | Bacteria | 9052 |
| 220 | Ga0111539_10029142 | 3300009094 | Bacteria | 6729 |
| 221 | Ga0111539_10059927 | 3300009094 | Bacteria | 4512 |
| 222 | Ga0111539_10086840 | 3300009094 | Bacteria | 3675 |
| 223 | Ga0105245_10061624 | 3300009098 | Bacteria | 3382 |
| 224 | Ga0114129_10001191 | 3300009147 | Bacteria | 34529 |
| 225 | Ga0114129_10012024 | 3300009147 | Bacteria | 12313 |
| 226 | Ga0114129_10012777 | 3300009147 | Bacteria | 11952 |
| 227 | Ga0114129_10016389 | 3300009147 | Bacteria | 10548 |
| 228 | Ga0114129_10017340 | 3300009147 | Bacteria | 10251 |
| 229 | Ga0114129_10022174 | 3300009147 | Bacteria | 9015 |
| 230 | Ga0114129_10036794 | 3300009147 | Bacteria | 6911 |
| 231 | Ga0114129_10073027 | 3300009147 | Bacteria | 4780 |
| 232 | Ga0114129_10082640 | 3300009147 | Bacteria | 4463 |
| 233 | Ga0114129_10127166 | 3300009147 | Bacteria | 3503 |
| 234 | Ga0114129_10152998 | 3300009147 | Bacteria | 3156 |
| 235 | Ga0114129_10244822 | 3300009147 | Bacteria | 2409 |
| 236 | Ga0114129_10285463 | 3300009147 | Bacteria | 2204 |
| 237 | Ga0114129_10294037 | 3300009147 | Bacteria | 2167 |
| 238 | Ga0114129_10321737 | 3300009147 | Bacteria | 2056 |
| 239 | Ga0114129_10363333 | 3300009147 | Bacteria | 1915 |
| 240 | Ga0114129_10831422 | 3300009147 | Bacteria | 1176 |
| 241 | Ga0114129_11337027 | 3300009147 | Bacteria | 887 |
| 242 | Ga0105243_10036440 | 3300009148 | Bacteria | 3819 |
| 243 | Ga0105243_10153032 | 3300009148 | Bacteria | 1981 |
| 244 | Ga0105243_10155987 | 3300009148 | Bacteria | 1963 |
| 245 | Ga0105243_10301713 | 3300009148 | Bacteria | 1452 |
| 246 | Ga0105241_10000602 | 3300009174 | Bacteria | 27099 |
| 247 | Ga0105241_10081082 | 3300009174 | Bacteria | 2541 |
| 248 | Ga0105241_10351278 | 3300009174 | Bacteria | 1280 |
| 249 | Ga0105242_10002560 | 3300009176 | Bacteria | 14248 |
| 250 | Ga0105242_10312952 | 3300009176 | Bacteria | 1437 |
| 251 | Ga0105237_10004996 | 3300009545 | Bacteria | 15108 |
| 252 | Ga0105238_10981169 | 3300009551 | Bacteria | 865 |
| 253 | Ga0105249_10022216 | 3300009553 | Bacteria | 5682 |
| 254 | Ga0105249_10101361 | 3300009553 | Bacteria | 2708 |
| 255 | Ga0105239_10002552 | 3300010375 | Bacteria | 23093 |
| 256 | Ga0105239_10255784 | 3300010375 | Bacteria | 1967 |
| 257 | Ga0105246_10031031 | 3300011119 | Bacteria | 3534 |
| 258 | Ga0157373_10001523 | 3300013100 | Bacteria | 17668 |
| 259 | Ga0157373_10280657 | 3300013100 | Bacteria | 1180 |
| 260 | Ga0157369_10003919 | 3300013105 | Bacteria | 17649 |
| 261 | Ga0157378_10103497 | 3300013297 | Bacteria | 2601 |
| 262 | Ga0157378_10260932 | 3300013297 | Bacteria | 1662 |
| 263 | Ga0157378_10438618 | 3300013297 | Bacteria | 1294 |
| 264 | Ga0163162_10628566 | 3300013306 | Bacteria | 1198 |
| 265 | Ga0163162_10669834 | 3300013306 | Bacteria | 1161 |
| 266 | Ga0157372_10000415 | 3300013307 | Bacteria | 46758 |
| 267 | Ga0157375_10024425 | 3300013308 | Bacteria | 5594 |
| 268 | Ga0157375_10715082 | 3300013308 | Bacteria | 1155 |
| 269 | Ga0157375_10982318 | 3300013308 | Bacteria | 985 |
| 270 | Ga0157375_11082745 | 3300013308 | Bacteria | 938 |
| 271 | Ga0163163_10075053 | 3300014325 | Bacteria | 3374 |
| 272 | Ga0157380_10175728 | 3300014326 | Bacteria | 1876 |
| 273 | Ga0157380_10680290 | 3300014326 | Bacteria | 1031 |
| 274 | Ga0182008_10038272 | 3300014497 | Bacteria | 2398 |
| 275 | Ga0207653_10001986 | 3300025885 | Bacteria | 6535 |
| 276 | Ga0207653_10004275 | 3300025885 | Bacteria | 4487 |
| 277 | Ga0207653_10017569 | 3300025885 | Bacteria | 2252 |
| 278 | Ga0207688_10022050 | 3300025901 | Bacteria | 3484 |
| 279 | Ga0207645_10000389 | 3300025907 | Bacteria | 36227 |
| 280 | Ga0207643_10000290 | 3300025908 | Bacteria | 35007 |
| 281 | Ga0207684_10000673 | 3300025910 | Bacteria | 40594 |
| 282 | Ga0207684_10004725 | 3300025910 | Bacteria | 12775 |
| 283 | Ga0207684_10007696 | 3300025910 | Bacteria | 9658 |
| 284 | Ga0207684_10013914 | 3300025910 | Bacteria | 6950 |
| 285 | Ga0207684_10019842 | 3300025910 | Bacteria | 5747 |
| 286 | Ga0207684_10024244 | 3300025910 | Bacteria | 5174 |
| 287 | Ga0207684_10049409 | 3300025910 | Bacteria | 3568 |
| 288 | Ga0207654_10005545 | 3300025911 | Bacteria | 6384 |
| 289 | Ga0207654_10018200 | 3300025911 | Bacteria | 3683 |
| 290 | Ga0207707_10000158 | 3300025912 | Bacteria | 71112 |
| 291 | Ga0207671_10002849 | 3300025914 | Bacteria | 17948 |
| 292 | Ga0207693_10004038 | 3300025915 | Bacteria | 12474 |
| 293 | Ga0207693_10164148 | 3300025915 | Bacteria | 1748 |
| 294 | Ga0207663_10563445 | 3300025916 | Bacteria | 892 |
| 295 | Ga0207660_10000987 | 3300025917 | Bacteria | 18878 |
| 296 | Ga0207660_10063986 | 3300025917 | Bacteria | 2654 |
| 297 | Ga0207660_10170079 | 3300025917 | Bacteria | 1686 |
| 298 | Ga0207660_10668382 | 3300025917 | Bacteria | 847 |
| 299 | Ga0207657_10000426 | 3300025919 | Bacteria | 44789 |
| 300 | Ga0207649_10002448 | 3300025920 | Bacteria | 10393 |
| 301 | Ga0207652_10000290 | 3300025921 | Bacteria | 52056 |
| 302 | Ga0207646_10003019 | 3300025922 | Bacteria | 19387 |
| 303 | Ga0207646_10004413 | 3300025922 | Bacteria | 15300 |
| 304 | Ga0207646_10094726 | 3300025922 | Bacteria | 2674 |
| 305 | Ga0207646_10116178 | 3300025922 | Bacteria | 2403 |
| 306 | Ga0207646_10194980 | 3300025922 | Bacteria | 1829 |
| 307 | Ga0207646_10202571 | 3300025922 | Bacteria | 1793 |
| 308 | Ga0207646_10422670 | 3300025922 | Bacteria | 1203 |
| 309 | Ga0207646_10476044 | 3300025922 | Bacteria | 1126 |
| 310 | Ga0207646_10484674 | 3300025922 | Bacteria | 1115 |
| 311 | Ga0207681_10016844 | 3300025923 | Bacteria | 4582 |
| 312 | Ga0207681_10351511 | 3300025923 | Bacteria | 1180 |
| 313 | Ga0207650_10256121 | 3300025925 | Bacteria | 1418 |
| 314 | Ga0207659_10025333 | 3300025926 | Bacteria | 3985 |
| 315 | Ga0207687_10035250 | 3300025927 | Bacteria | 3402 |
| 316 | Ga0207690_10002346 | 3300025932 | Bacteria | 11492 |
| 317 | Ga0207706_10003426 | 3300025933 | Bacteria | 15142 |
| 318 | Ga0207686_10015702 | 3300025934 | Bacteria | 4239 |
| 319 | Ga0207709_10014362 | 3300025935 | Bacteria | 4372 |
| 320 | Ga0207709_10032319 | 3300025935 | Bacteria | 3063 |
| 321 | Ga0207709_10059847 | 3300025935 | Bacteria | 2372 |
| 322 | Ga0207709_10072769 | 3300025935 | Bacteria | 2187 |
| 323 | Ga0207709_10184559 | 3300025935 | Bacteria | 1476 |
| 324 | Ga0207670_10111422 | 3300025936 | Bacteria | 1973 |
| 325 | Ga0207670_10118886 | 3300025936 | Bacteria | 1917 |
| 326 | Ga0207704_10106592 | 3300025938 | Bacteria | 1883 |
| 327 | Ga0207704_10178895 | 3300025938 | Bacteria | 1531 |
| 328 | Ga0207665_10003465 | 3300025939 | Bacteria | 10536 |
| 329 | Ga0207691_10076908 | 3300025940 | Bacteria | 3008 |
| 330 | Ga0207691_10086362 | 3300025940 | Bacteria | 2815 |
| 331 | Ga0207691_10356739 | 3300025940 | Bacteria | 1250 |
| 332 | Ga0207689_10000277 | 3300025942 | Bacteria | 46512 |
| 333 | Ga0207689_10002344 | 3300025942 | Bacteria | 17708 |
| 334 | Ga0207689_10052447 | 3300025942 | Bacteria | 3361 |
| 335 | Ga0207679_10000773 | 3300025945 | Bacteria | 20945 |
| 336 | Ga0207667_10003179 | 3300025949 | Bacteria | 20318 |
| 337 | Ga0207667_10724203 | 3300025949 | Bacteria | 996 |
| 338 | Ga0207712_10077000 | 3300025961 | Bacteria | 2416 |
| 339 | Ga0207668_10102555 | 3300025972 | Bacteria | 2129 |
| 340 | Ga0207668_10632273 | 3300025972 | Bacteria | 935 |
| 341 | Ga0207640_10001020 | 3300025981 | Bacteria | 15483 |
| 342 | Ga0207677_10082810 | 3300026023 | Bacteria | 2307 |
| 343 | Ga0207703_10041954 | 3300026035 | Bacteria | 3668 |
| 344 | Ga0207703_10449022 | 3300026035 | Bacteria | 1204 |
| 345 | Ga0207639_10001029 | 3300026041 | Bacteria | 18951 |
| 346 | Ga0207678_10022159 | 3300026067 | Bacteria | 5567 |
| 347 | Ga0207708_10004830 | 3300026075 | Bacteria | 9930 |
| 348 | Ga0207708_10061128 | 3300026075 | Bacteria | 2876 |
| 349 | Ga0207702_10003932 | 3300026078 | Bacteria | 13357 |
| 350 | Ga0207648_10042884 | 3300026089 | Bacteria | 3973 |
| 351 | Ga0207648_10046041 | 3300026089 | Bacteria | 3825 |
| 352 | Ga0207648_10123281 | 3300026089 | Bacteria | 2279 |
| 353 | Ga0207676_10033858 | 3300026095 | Bacteria | 3864 |
| 354 | Ga0207674_10001112 | 3300026116 | Bacteria | 34904 |
| 355 | Ga0207674_10324804 | 3300026116 | Bacteria | 1488 |
| 356 | Ga0207675_100003707 | 3300026118 | Bacteria | 14882 |
| 357 | Ga0207683_10382711 | 3300026121 | Bacteria | 1293 |
| 358 | Ga0207698_10409182 | 3300026142 | Bacteria | 1299 |
| 359 | Ga0209969_1005511 | 3300027360 | Bacteria | 1777 |
| 360 | Ga0209967_1013273 | 3300027364 | Bacteria | 1168 |
| 361 | Ga0209981_1003723 | 3300027378 | Bacteria | 1984 |
| 362 | Ga0209996_1000276 | 3300027395 | Bacteria | 6449 |
| 363 | Ga0210000_1005391 | 3300027462 | Bacteria | 1854 |
| 364 | Ga0209995_1000753 | 3300027471 | Bacteria | 4972 |
| 365 | Ga0209968_1002525 | 3300027526 | Bacteria | 2761 |
| 366 | Ga0209999_1001317 | 3300027543 | Bacteria | 4256 |
| 367 | Ga0209982_1002708 | 3300027552 | Bacteria | 2493 |
| 368 | Ga0209983_1000304 | 3300027665 | Bacteria | 10254 |
| 369 | Ga0209983_1019974 | 3300027665 | Bacteria | 1395 |
| 370 | Ga0209588_1021324 | 3300027671 | Bacteria | 2034 |
| 371 | Ga0209588_1029903 | 3300027671 | Bacteria | 1739 |
| 372 | Ga0209588_1036640 | 3300027671 | Bacteria | 1579 |
| 373 | Ga0209971_1000036 | 3300027682 | Bacteria | 46401 |
| 374 | Ga0209966_1000228 | 3300027695 | Bacteria | 21579 |
| 375 | Ga0209998_10000002 | 3300027717 | Bacteria | 126355 |
| 376 | Ga0209974_10012526 | 3300027876 | Bacteria | 2835 |
| 377 | Ga0207428_10000398 | 3300027907 | Bacteria | 54142 |
| 378 | Ga0207428_10000526 | 3300027907 | Bacteria | 45700 |
| 379 | Ga0207428_10069725 | 3300027907 | Bacteria | 2764 |
| 380 | Ga0268266_10502658 | 3300028379 | Bacteria | 1158 |
| 381 | Ga0268265_10011589 | 3300028380 | Bacteria | 5962 |
| 382 | Ga0268265_10024881 | 3300028380 | Bacteria | 4242 |
| 383 | Ga0268264_10032016 | 3300028381 | Bacteria | 4314 |
| 384 | Ga0268264_10045134 | 3300028381 | Bacteria | 3659 |
| 385 | Ga0268264_10086095 | 3300028381 | Bacteria | 2699 |
| 386 | Ga0268264_10210804 | 3300028381 | Bacteria | 1783 |
| 387 | Ga0307408_100003915 | 3300031548 | Bacteria | 10148 |
| 388 | Ga0307408_100101902 | 3300031548 | Bacteria | 2189 |
| 389 | Ga0307408_100246087 | 3300031548 | Bacteria | 1472 |
| 390 | Ga0307405_10031571 | 3300031731 | Bacteria | 3120 |
| 391 | Ga0307413_10002384 | 3300031824 | Bacteria | 7629 |
| 392 | Ga0307410_10215824 | 3300031852 | Bacteria | 1473 |
| 393 | Ga0307407_10370626 | 3300031903 | Bacteria | 1019 |
| 394 | Ga0307412_10013219 | 3300031911 | Bacteria | 4832 |
| 395 | Ga0307412_10074286 | 3300031911 | Bacteria | 2329 |
| 396 | Ga0307412_10404405 | 3300031911 | Bacteria | 1112 |
| 397 | Ga0307409_100271350 | 3300031995 | Bacteria | 1562 |
| 398 | Ga0307409_100361726 | 3300031995 | Bacteria | 1373 |
| 399 | Ga0307409_100556605 | 3300031995 | Bacteria | 1127 |
| 400 | Ga0307409_101296598 | 3300031995 | Bacteria | 753 |
| 401 | Ga0307416_100014018 | 3300032002 | Bacteria | 5471 |
| 402 | Ga0307411_10120923 | 3300032005 | Bacteria | 1894 |
| 403 | Ga0307415_100239906 | 3300032126 | Bacteria | 1466 |
| 404 | Ga0373950_0009574 | 3300034818 | Bacteria | 1550 |
| 405 | Ga0373928_0017528 | 3300035084 | Bacteria | 1475 |
| 406 | Ga0373940_0003877 | 3300035088 | Bacteria | 3106 |
| 407 | Ga0373949_0012139 | 3300035090 | Bacteria | 1902 |
| 408 | Ga0373949_0020438 | 3300035090 | Bacteria | 1515 |
| 409 | Ga0373949_0044645 | 3300035090 | Bacteria | 1100 |
| 410 | Ga0373951_0009267 | 3300035091 | Bacteria | 2218 |
| 411 | Ga0373952_0002583 | 3300035092 | Bacteria | 3261 |
| 412 | Ga0373932_0032119 | 3300035112 | Bacteria | 1467 |
| 413 | Ga0373939_0011216 | 3300035114 | Bacteria | 2257 |
| 414 | Ga0373939_0022929 | 3300035114 | Bacteria | 1725 |
| 415 | Ga0373931_0017773 | 3300035691 | Bacteria | 3523 |
| 416 | Ga0373931_0028538 | 3300035691 | Bacteria | 2858 |
| 417 | Ga0373931_0044914 | 3300035691 | Bacteria | 2331 |
| 418 | Ga0373931_0130007 | 3300035691 | Bacteria | 1448 |
| 419 | Ga0373931_0505477 | 3300035691 | Bacteria | 780 |
| 420 | Ga0395899_0228129 | 3300037312 | Bacteria | 1287 |
| 421 | Ga0395898_0110168 | 3300037466 | Bacteria | 2639 |
| 422 | Ga0395898_0758660 | 3300037466 | Bacteria | 911 |
| 423 | Ga0395901_0085204 | 3300038443 | Bacteria | 3303 |
| 424 | Ga0395901_0695613 | 3300038443 | Bacteria | 1015 |
| 425 | Ga0439443_021858 | 3300042003 | Bacteria | 1013 |
| 426 | Ga0439448_0007726 | 3300042005 | Bacteria | 3123 |
| 427 | Ga0439448_0034698 | 3300042005 | Bacteria | 1613 |
| 428 | Ga0439450_059040 | 3300042008 | Bacteria | 924 |
| 429 | Ga0439455_0036068 | 3300042012 | Bacteria | 1250 |
| 430 | Ga0439458_0031856 | 3300042157 | Bacteria | 1258 |
| 431 | Ga0439435_0074447 | 3300042436 | Bacteria | 1010 |
| 432 | Ga0439435_0096276 | 3300042436 | Bacteria | 905 |
| 433 | Ga0439464_0003187 | 3300042439 | Bacteria | 4116 |
| 434 | Ga0439460_0002670 | 3300042461 | Bacteria | 4304 |
| 435 | Ga0439460_0088913 | 3300042461 | Bacteria | 979 |
| 436 | Ga0451577_0000793 | 3300042876 | Bacteria | 47582 |
| 437 | Ga0451577_0007730 | 3300042876 | Bacteria | 10539 |
| 438 | Ga0451577_0014349 | 3300042876 | Bacteria | 7387 |
| 439 | Ga0451577_0968603 | 3300042876 | Bacteria | 765 |
| 440 | Ga0453683_0005071 | 3300044673 | Bacteria | 9240 |
| 441 | Ga0453683_0009470 | 3300044673 | Bacteria | 6500 |
| 442 | Ga0453683_0039670 | 3300044673 | Bacteria | 2959 |
| 443 | Ga0453683_0278141 | 3300044673 | Bacteria | 1069 |
| 444 | Ga0453684_0031081 | 3300044712 | Bacteria | 7519 |
| 445 | Ga0453684_0130819 | 3300044712 | Bacteria | 3011 |
| 446 | Ga0453684_0530748 | 3300044712 | Bacteria | 1299 |
| 447 | Ga0453684_0694702 | 3300044712 | Bacteria | 1106 |
| 448 | Ga0451576_0005173 | 3300045051 | Bacteria | 16502 |
| 449 | Ga0451576_0032025 | 3300045051 | Bacteria | 5603 |
| 450 | Ga0451576_0033529 | 3300045051 | Bacteria | 5458 |
| 451 | Ga0451576_0049699 | 3300045051 | Bacteria | 4401 |
| 452 | Ga0451576_0053559 | 3300045051 | Bacteria | 4226 |
| 453 | Ga0451576_0114215 | 3300045051 | Bacteria | 2811 |
| 454 | Ga0451576_0264864 | 3300045051 | Bacteria | 1796 |
| 455 | Ga0495603_0084563 | 3300046455 | Bacteria | 1858 |
| 456 | Ga0495580_0016661 | 3300046472 | Bacteria | 5514 |
| 457 | Ga0495580_0193068 | 3300046472 | Bacteria | 1404 |
| 458 | Ga0495584_0071647 | 3300046491 | Bacteria | 1742 |
| 459 | Ga0495584_0072783 | 3300046491 | Bacteria | 1727 |
| 460 | Ga0495642_0011189 | 3300046528 | Bacteria | 3442 |
| 461 | Ga0495633_0181734 | 3300046558 | Bacteria | 968 |
| 462 | Ga0495656_0053380 | 3300046615 | Bacteria | 1736 |
| 463 | Ga0495659_0037935 | 3300046664 | Bacteria | 1709 |
| 464 | Ga0495669_0027414 | 3300046684 | Bacteria | 2492 |
| 465 | Ga0495669_0038401 | 3300046684 | Bacteria | 2120 |
| 466 | Ga0495636_0058445 | 3300047318 | Bacteria | 1626 |
| 467 | Ga0495636_0098583 | 3300047318 | Bacteria | 1276 |
| 468 | Ga0495636_0188675 | 3300047318 | Bacteria | 938 |
| 469 | Ga0496102_0051899 | 3300048905 | Bacteria | 3736 |
| 470 | Ga0496103_0375382 | 3300048906 | Bacteria | 914 |
| 471 | Ga0496104_0253378 | 3300048907 | Bacteria | 1673 |
| 472 | Ga0496105_0061652 | 3300048908 | Bacteria | 3095 |
| 473 | Ga0496106_0037094 | 3300048909 | Bacteria | 3646 |
| 474 | Ga0496106_0287039 | 3300048909 | Bacteria | 1319 |
| 475 | Ga0496106_0394127 | 3300048909 | Bacteria | 1113 |
| 476 | Ga0496106_0514185 | 3300048909 | Bacteria | 962 |
| 477 | Ga0496108_0022804 | 3300048911 | Bacteria | 5150 |
| 478 | Ga0496108_0649067 | 3300048911 | Bacteria | 917 |
| 479 | Ga0496109_0442920 | 3300048912 | Bacteria | 1227 |
| 480 | Ga0496110_0018494 | 3300048913 | Bacteria | 5843 |
| 481 | Ga0496110_0806316 | 3300048913 | Bacteria | 843 |
| 482 | Ga0496111_0262286 | 3300048914 | Bacteria | 1282 |
| 483 | Ga0496112_0064810 | 3300048915 | Bacteria | 3606 |
| 484 | Ga0496113_0295158 | 3300048916 | Bacteria | 1297 |
| 485 | Ga0496114_0012272 | 3300048917 | Bacteria | 6857 |
| 486 | Ga0501031_0116012 | 3300049568 | Bacteria | 1749 |
| 487 | Ga0501031_0243676 | 3300049568 | Bacteria | 1168 |
| 488 | Ga0501032_0127389 | 3300049569 | Bacteria | 1681 |
| 489 | Ga0501033_0020667 | 3300049570 | Bacteria | 4974 |
| 490 | Ga0501033_0057423 | 3300049570 | Bacteria | 2877 |
| 491 | Ga0501033_0252405 | 3300049570 | Bacteria | 1250 |
| 492 | Ga0501036_0053635 | 3300049572 | Bacteria | 3414 |
| 493 | Ga0501036_0344199 | 3300049572 | Bacteria | 1245 |
| 494 | Ga0501038_0062853 | 3300049574 | Bacteria | 3171 |
| 495 | Ga0501039_0005533 | 3300049575 | Bacteria | 9562 |
| 496 | Ga0501039_0357622 | 3300049575 | Bacteria | 1147 |
| 497 | Ga0501039_0466292 | 3300049575 | Bacteria | 992 |
| 498 | Ga0501039_0636721 | 3300049575 | Bacteria | 835 |
| 499 | Ga0501040_0002756 | 3300049576 | Bacteria | 11323 |
| 500 | Ga0501040_0030056 | 3300049576 | Bacteria | 3668 |
| 501 | Ga0501040_0087287 | 3300049576 | Bacteria | 2166 |
| 502 | Ga0501040_0145261 | 3300049576 | Bacteria | 1672 |
| 503 | Ga0501040_0252876 | 3300049576 | Bacteria | 1257 |
| 504 | Ga0501041_0036477 | 3300049577 | Bacteria | 2978 |
| 505 | Ga0501041_0052173 | 3300049577 | Bacteria | 2493 |
| 506 | Ga0501041_0080929 | 3300049577 | Bacteria | 2000 |
| 507 | Ga0501041_0111594 | 3300049577 | Bacteria | 1696 |
| 508 | Ga0501041_0352247 | 3300049577 | Bacteria | 930 |
| 509 | Ga0501042_0000598 | 3300049578 | Bacteria | 19220 |
| 510 | Ga0501042_0065812 | 3300049578 | Bacteria | 2590 |
| 511 | Ga0501042_0148671 | 3300049578 | Bacteria | 1689 |
| 512 | Ga0501042_0279767 | 3300049578 | Bacteria | 1205 |
| 513 | Ga0501042_0358319 | 3300049578 | Bacteria | 1055 |
| 514 | Ga0501043_0033816 | 3300049579 | Bacteria | 4023 |
| 515 | Ga0501043_0122969 | 3300049579 | Bacteria | 2035 |
| 516 | Ga0501046_0000240 | 3300049580 | Bacteria | 56302 |
| 517 | Ga0501046_0055306 | 3300049580 | Bacteria | 3120 |
| 518 | Ga0501046_0055808 | 3300049580 | Bacteria | 3102 |
| 519 | Ga0501046_0093811 | 3300049580 | Bacteria | 2307 |
| 520 | Ga0501046_0142576 | 3300049580 | Bacteria | 1812 |
| 521 | Ga0501046_0576693 | 3300049580 | Bacteria | 800 |
| 522 | Ga0501047_0193410 | 3300049581 | Bacteria | 1897 |
| 523 | Ga0501048_0014851 | 3300049582 | Bacteria | 5758 |
| 524 | Ga0501048_0146719 | 3300049582 | Bacteria | 1668 |
| 525 | Ga0501048_0215869 | 3300049582 | Bacteria | 1360 |
| 526 | Ga0501067_0269534 | 3300049583 | Bacteria | 948 |
| 527 | Ga0501068_0047077 | 3300049584 | Bacteria | 2601 |
| 528 | Ga0501068_0307817 | 3300049584 | Bacteria | 1015 |
| 529 | Ga0501071_0029734 | 3300049587 | Bacteria | 3858 |
| 530 | Ga0501071_0062699 | 3300049587 | Bacteria | 2694 |
| 531 | Ga0501071_0089391 | 3300049587 | Bacteria | 2260 |
| 532 | Ga0501071_0282300 | 3300049587 | Bacteria | 1257 |
| 533 | Ga0501072_0010731 | 3300049588 | Bacteria | 6980 |
| 534 | Ga0501072_0011976 | 3300049588 | Bacteria | 6626 |
| 535 | Ga0501072_0019392 | 3300049588 | Bacteria | 5256 |
| 536 | Ga0501072_0024925 | 3300049588 | Bacteria | 4657 |
| 537 | Ga0501072_0143087 | 3300049588 | Bacteria | 1907 |
| 538 | Ga0501072_0213564 | 3300049588 | Bacteria | 1538 |
| 539 | Ga0501072_0563245 | 3300049588 | Bacteria | 899 |
| 540 | Ga0501073_0046661 | 3300049589 | Bacteria | 3046 |
| 541 | Ga0501073_0113279 | 3300049589 | Bacteria | 1881 |
| 542 | Ga0501073_0149774 | 3300049589 | Bacteria | 1617 |
| 543 | Ga0501074_0048490 | 3300049590 | Bacteria | 3068 |
| 544 | Ga0501074_0069840 | 3300049590 | Bacteria | 2526 |
| 545 | Ga0501074_0119473 | 3300049590 | Bacteria | 1884 |
| 546 | Ga0501075_0014499 | 3300049591 | Bacteria | 5649 |
| 547 | Ga0501075_0024646 | 3300049591 | Bacteria | 4416 |
| 548 | Ga0501075_0034507 | 3300049591 | Bacteria | 3767 |
| 549 | Ga0501075_0045394 | 3300049591 | Bacteria | 3298 |
| 550 | Ga0501075_0074095 | 3300049591 | Bacteria | 2575 |
| 551 | Ga0501075_0109511 | 3300049591 | Bacteria | 2100 |
| 552 | Ga0501075_0109520 | 3300049591 | Bacteria | 2100 |
| 553 | Ga0501075_0115461 | 3300049591 | Bacteria | 2041 |
| 554 | Ga0501075_0198999 | 3300049591 | Bacteria | 1528 |
| 555 | Ga0501076_0018260 | 3300049592 | Bacteria | 5344 |
| 556 | Ga0501076_0021228 | 3300049592 | Bacteria | 4980 |
| 557 | Ga0501076_0051267 | 3300049592 | Bacteria | 3266 |
| 558 | Ga0501076_0060391 | 3300049592 | Bacteria | 3016 |
| 559 | Ga0501076_0079350 | 3300049592 | Bacteria | 2634 |
| 560 | Ga0501076_0243552 | 3300049592 | Bacteria | 1471 |
| 561 | Ga0501076_0296881 | 3300049592 | Bacteria | 1324 |
| 562 | Ga0501076_0706975 | 3300049592 | Bacteria | 832 |
| 563 | Ga0501076_0910073 | 3300049592 | Bacteria | 725 |
| 564 | Ga0501077_0012026 | 3300049593 | Bacteria | 5418 |
| 565 | Ga0501077_0046909 | 3300049593 | Bacteria | 2745 |
| 566 | Ga0501077_0084986 | 3300049593 | Bacteria | 2006 |
| 567 | Ga0501077_0104873 | 3300049593 | Bacteria | 1791 |
| 568 | Ga0501077_0148829 | 3300049593 | Bacteria | 1485 |
| 569 | Ga0501077_0356827 | 3300049593 | Bacteria | 933 |
| 570 | Ga0501079_0000962 | 3300049741 | Bacteria | 19859 |
| 571 | Ga0501079_0022830 | 3300049741 | Bacteria | 4802 |
| 572 | Ga0501079_0028488 | 3300049741 | Bacteria | 4287 |
| 573 | Ga0501079_0044843 | 3300049741 | Bacteria | 3412 |
| 574 | Ga0501079_0110328 | 3300049741 | Bacteria | 2137 |
| 575 | Ga0501079_0115159 | 3300049741 | Bacteria | 2090 |
| 576 | Ga0501079_0186870 | 3300049741 | Bacteria | 1617 |
| 577 | Ga0501080_0013705 | 3300049742 | Bacteria | 7466 |
| 578 | Ga0501080_0061308 | 3300049742 | Bacteria | 3502 |
| 579 | Ga0501080_0229708 | 3300049742 | Bacteria | 1696 |
| 580 | Ga0501080_0239431 | 3300049742 | Bacteria | 1656 |
| 581 | Ga0501080_0277362 | 3300049742 | Bacteria | 1525 |
| 582 | Ga0501080_0565874 | 3300049742 | Bacteria | 1011 |
| 583 | Ga0501080_0584024 | 3300049742 | Bacteria | 993 |
| 584 | Ga0501081_0002065 | 3300049743 | Bacteria | 12525 |
| 585 | Ga0501081_0003003 | 3300049743 | Bacteria | 10711 |
| 586 | Ga0501081_0003043 | 3300049743 | Bacteria | 10641 |
| 587 | Ga0501081_0006739 | 3300049743 | Bacteria | 7466 |
| 588 | Ga0501081_0018202 | 3300049743 | Bacteria | 4663 |
| 589 | Ga0501081_0064719 | 3300049743 | Bacteria | 2540 |
| 590 | Ga0501083_0029430 | 3300049744 | Bacteria | 3777 |
| 591 | Ga0501083_0173718 | 3300049744 | Bacteria | 1408 |
| 592 | Ga0501035_0285826 | 3300049822 | Bacteria | 1393 |
| 593 | Ga0501035_0288301 | 3300049822 | Bacteria | 1386 |
| 594 | Ga0501035_0320692 | 3300049822 | Bacteria | 1302 |
| 595 | Ga0501045_0000542 | 3300049824 | Bacteria | 23648 |
| 596 | Ga0501045_0018403 | 3300049824 | Bacteria | 4970 |
| 597 | Ga0501045_0018570 | 3300049824 | Bacteria | 4947 |
| 598 | Ga0501045_0026245 | 3300049824 | Bacteria | 4189 |
| 599 | Ga0501045_0144679 | 3300049824 | Bacteria | 1768 |
| 600 | Ga0501045_0273232 | 3300049824 | Bacteria | 1258 |
| 601 | Ga0501045_0489812 | 3300049824 | Bacteria | 913 |
| 602 | nmdc:mga05p37_10296_c1 | 3300050507 | Bacteria | 11105 |
| 603 | nmdc:mga05p37_10313_c1 | 3300050507 | Bacteria | 11096 |
| 604 | nmdc:mga05p37_111793_c1 | 3300050507 | Bacteria | 3359 |
| 605 | nmdc:mga05p37_11771_c1 | 3300050507 | Bacteria | 9366 |
| 606 | nmdc:mga05p37_1188_c1 | 3300050507 | Bacteria | 30065 |
| 607 | nmdc:mga05p37_132550_c1 | 3300050507 | Bacteria | 3057 |
| 608 | nmdc:mga05p37_182465_c1 | 3300050507 | Bacteria | 2553 |
| 609 | nmdc:mga05p37_212_c1 | 3300050507 | Bacteria | 58811 |
| 610 | nmdc:mga05p37_270065_c1 | 3300050507 | Bacteria | 2033 |
| 611 | nmdc:mga05p37_335410_c1 | 3300050507 | Bacteria | 1785 |
| 612 | nmdc:mga05p37_403887_c1 | 3300050507 | Bacteria | 1594 |
| 613 | nmdc:mga05p37_41471_c1 | 3300050507 | Bacteria | 5651 |
| 614 | nmdc:mga05p37_7876_c1 | 3300050507 | Bacteria | 12576 |
| 615 | nmdc:mga09592_11174_c1 | 3300050508 | Bacteria | 7306 |
| 616 | nmdc:mga09592_134764_c1 | 3300050508 | Bacteria | 2127 |
| 617 | nmdc:mga09592_212597_c1 | 3300050508 | Bacteria | 1676 |
| 618 | nmdc:mga09592_265_c1 | 3300050508 | Bacteria | 38165 |
| 619 | nmdc:mga09592_32798_c1 | 3300050508 | Bacteria | 4330 |
| 620 | nmdc:mga09592_38645_c1 | 3300050508 | Bacteria | 4007 |
| 621 | nmdc:mga09592_3999_c1 | 3300050508 | Bacteria | 11886 |
| 622 | nmdc:mga09592_413686_c1 | 3300050508 | Bacteria | 1165 |
| 623 | nmdc:mga09592_7616_c1 | 3300050508 | Bacteria | 8809 |
| 624 | nmdc:mga09592_92363_c1 | 3300050508 | Bacteria | 2587 |
| 625 | nmdc:mga09592_992_c1 | 3300050508 | Bacteria | 22474 |
| 626 | nmdc:mga0qj67_162838_c1 | 3300050509 | Bacteria | 1811 |
| 627 | nmdc:mga0qj67_2490_c1 | 3300050509 | Bacteria | 13137 |
| 628 | nmdc:mga0qj67_426286_c1 | 3300050509 | Bacteria | 1069 |
| 629 | nmdc:mga0qj67_6600_c1 | 3300050509 | Bacteria | 8527 |
| 630 | nmdc:mga0qj67_72017_c1 | 3300050509 | Bacteria | 2758 |
| 631 | nmdc:mga06r32_100340_c1 | 3300050510 | Bacteria | 2840 |
| 632 | nmdc:mga06r32_102516_c1 | 3300050510 | Bacteria | 2809 |
| 633 | nmdc:mga06r32_179862_c1 | 3300050510 | Bacteria | 2100 |
| 634 | nmdc:mga06r32_1850_c1 | 3300050510 | Bacteria | 18813 |
| 635 | nmdc:mga06r32_2420_c1 | 3300050510 | Bacteria | 16703 |
| 636 | nmdc:mga06r32_26143_c1 | 3300050510 | Bacteria | 5439 |
| 637 | nmdc:mga06r32_30435_c1 | 3300050510 | Bacteria | 5064 |
| 638 | nmdc:mga06r32_455607_c1 | 3300050510 | Bacteria | 1258 |
| 639 | nmdc:mga06r32_52930_c1 | 3300050510 | Bacteria | 3889 |
| 640 | nmdc:mga06r32_63311_c1 | 3300050510 | Bacteria | 3565 |
| 641 | nmdc:mga06r32_749782_c1 | 3300050510 | Bacteria | 940 |
| 642 | nmdc:mga06r32_886_c1 | 3300050510 | Bacteria | 26660 |
| 643 | nmdc:mga08y16_1163552_c1 | 3300050511 | Bacteria | 744 |
| 644 | nmdc:mga08y16_350387_c1 | 3300050511 | Bacteria | 1517 |
| 645 | nmdc:mga08y16_5536_c1 | 3300050511 | Bacteria | 13220 |
| 646 | nmdc:mga08y16_6014_c1 | 3300050511 | Bacteria | 12718 |
| 647 | nmdc:mga0n895_10268_c1 | 3300050512 | Bacteria | 8255 |
| 648 | nmdc:mga0n895_139945_c1 | 3300050512 | Bacteria | 2448 |
| 649 | nmdc:mga0n895_24612_c1 | 3300050512 | Bacteria | 5676 |
| 650 | nmdc:mga0n895_270470_c1 | 3300050512 | Bacteria | 1724 |
| 651 | nmdc:mga0n895_286848_c1 | 3300050512 | Bacteria | 1669 |
| 652 | nmdc:mga0n895_3081_c1 | 3300050512 | Bacteria | 13264 |
| 653 | nmdc:mga0n895_33586_c1 | 3300050512 | Bacteria | 4932 |
| 654 | nmdc:mga0n895_353404_c1 | 3300050512 | Bacteria | 1488 |
| 655 | nmdc:mga0n895_35372_c1 | 3300050512 | Bacteria | 4816 |
| 656 | nmdc:mga0n895_42945_c1 | 3300050512 | Bacteria | 4403 |
| 657 | nmdc:mga0n895_459722_c1 | 3300050512 | Bacteria | 1285 |
| 658 | nmdc:mga0rr50_1061_c1 | 3300050513 | Bacteria | 14938 |
| 659 | nmdc:mga0rr50_147245_c1 | 3300050513 | Bacteria | 1900 |
| 660 | nmdc:mga0rr50_153051_c1 | 3300050513 | Bacteria | 1866 |
| 661 | nmdc:mga0rr50_168928_c1 | 3300050513 | Bacteria | 1781 |
| 662 | nmdc:mga0rr50_2266_c1 | 3300050513 | Bacteria | 10791 |
| 663 | nmdc:mga0rr50_401764_c1 | 3300050513 | Bacteria | 1157 |
| 664 | nmdc:mga0rr50_65858_c1 | 3300050513 | Bacteria | 2746 |
| 665 | nmdc:mga0rr50_7012_c1 | 3300050513 | Bacteria | 6914 |
| 666 | nmdc:mga08x19_116540_c1 | 3300050514 | Bacteria | 1786 |
| 667 | nmdc:mga08x19_23888_c1 | 3300050514 | Bacteria | 3795 |
| 668 | nmdc:mga08x19_361440_c1 | 3300050514 | Bacteria | 1015 |
| 669 | nmdc:mga08x19_546158_c1 | 3300050514 | Bacteria | 820 |
| 670 | nmdc:mga0a205_1419_c1 | 3300050515 | Bacteria | 20361 |
| 671 | nmdc:mga0a205_153847_c1 | 3300050515 | Bacteria | 2199 |
| 672 | nmdc:mga0a205_15574_c1 | 3300050515 | Bacteria | 7107 |
| 673 | nmdc:mga0a205_17378_c1 | 3300050515 | Bacteria | 6740 |
| 674 | nmdc:mga0a205_173969_c1 | 3300050515 | Bacteria | 2049 |
| 675 | nmdc:mga0a205_259714_c1 | 3300050515 | Bacteria | 1615 |
| 676 | nmdc:mga0a205_3138_c2 | 3300050515 | Bacteria | 13217 |
| 677 | nmdc:mga0a205_3294_c1 | 3300050515 | Bacteria | 14365 |
| 678 | nmdc:mga0a205_353382_c1 | 3300050515 | Bacteria | 1337 |
| 679 | nmdc:mga0a205_60234_c1 | 3300050515 | Bacteria | 3667 |
| 680 | nmdc:mga0a205_669355_c1 | 3300050515 | Bacteria | 889 |
| 681 | nmdc:mga0a205_69079_c1 | 3300050515 | Bacteria | 3412 |
| 682 | nmdc:mga0a205_7770_c1 | 3300050515 | Bacteria | 9735 |
| 683 | Ga0501084_0011863 | 3300054114 | Bacteria | 7214 |
| 684 | Ga0501084_0043575 | 3300054114 | Bacteria | 3753 |
| 685 | Ga0501084_0060512 | 3300054114 | Bacteria | 3170 |
| 686 | Ga0501084_0064742 | 3300054114 | Bacteria | 3059 |
| 687 | Ga0501084_0109738 | 3300054114 | Bacteria | 2318 |
| 688 | Ga0501084_0113893 | 3300054114 | Bacteria | 2273 |
| 689 | Ga0501084_0202675 | 3300054114 | Bacteria | 1674 |
| 690 | Ga0590074_010689 | 3300059423 | Bacteria | 1535 |
| 691 | Ga0501082_0000590 | 3300060353 | Bacteria | 32111 |
| 692 | Ga0501082_0007107 | 3300060353 | Bacteria | 9659 |
| 693 | Ga0501082_0010275 | 3300060353 | Bacteria | 8058 |
| 694 | Ga0501082_0059775 | 3300060353 | Bacteria | 3284 |
| 695 | Ga0501082_0105500 | 3300060353 | Bacteria | 2438 |
| 696 | Ga0501082_0158908 | 3300060353 | Bacteria | 1964 |
| 697 | Ga0501082_0167219 | 3300060353 | Bacteria | 1911 |
| 698 | Ga0501082_0253139 | 3300060353 | Bacteria | 1532 |
| 699 | Ga0501082_0508353 | 3300060353 | Bacteria | 1053 |
| 700 | Ga0530510_0015192 | 3300061734 | Bacteria | 5437 |
| 701 | Ga0530510_0032811 | 3300061734 | Bacteria | 3737 |
| 702 | Ga0530510_0231024 | 3300061734 | Bacteria | 1376 |
| 703 | Ga0530510_0232407 | 3300061734 | Bacteria | 1372 |
| 704 | Ga0530510_0523958 | 3300061734 | Bacteria | 899 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0968603 | Ga0451577_0968603_15_635 | 196 |
| 2 | 3300013306 | Ga0163162_10669834 | Ga0163162_106698341 | 206 |
| 3 | 3300005293 | Ga0065715_10369058 | Ga0065715_103690581 | 208 |
| 4 | 3300005328 | Ga0070676_10001508 | Ga0070676_100015085 | 208 |
| 5 | 3300005329 | Ga0070683_100040464 | Ga0070683_1000404643 | 208 |
| 6 | 3300005330 | Ga0070690_100227937 | Ga0070690_1002279371 | 208 |
| 7 | 3300005331 | Ga0070670_100005711 | Ga0070670_1000057112 | 208 |
| 8 | 3300005334 | Ga0068869_100001826 | Ga0068869_1000018269 | 208 |
| 9 | 3300005336 | Ga0070680_100011525 | Ga0070680_1000115254 | 208 |
| 10 | 3300005337 | Ga0070682_100010168 | Ga0070682_1000101683 | 208 |
| 11 | 3300005338 | Ga0068868_100186906 | Ga0068868_1001869062 | 208 |
| 12 | 3300005339 | Ga0070660_100006407 | Ga0070660_1000064074 | 208 |
| 13 | 3300005340 | Ga0070689_100086275 | Ga0070689_1000862752 | 208 |
| 14 | 3300005341 | Ga0070691_10004132 | Ga0070691_100041323 | 208 |
| 15 | 3300005344 | Ga0070661_100004542 | Ga0070661_1000045426 | 208 |
| 16 | 3300005345 | Ga0070692_10096760 | Ga0070692_100967602 | 208 |
| 17 | 3300005354 | Ga0070675_100096848 | Ga0070675_1000968482 | 208 |
| 18 | 3300005366 | Ga0070659_100000322 | Ga0070659_10000032218 | 208 |
| 19 | 3300005406 | Ga0070703_10000793 | Ga0070703_100007937 | 208 |
| 20 | 3300005438 | Ga0070701_10055062 | Ga0070701_100550622 | 208 |
| 21 | 3300005440 | Ga0070705_100002220 | Ga0070705_1000022206 | 208 |
| 22 | 3300005441 | Ga0070700_100054686 | Ga0070700_1000546862 | 208 |
| 23 | 3300005444 | Ga0070694_100000296 | Ga0070694_1000002961 | 208 |
| 24 | 3300005445 | Ga0070708_100385405 | Ga0070708_1003854052 | 208 |
| 25 | 3300005455 | Ga0070663_100011713 | Ga0070663_1000117132 | 208 |
| 26 | 3300005457 | Ga0070662_100002852 | Ga0070662_1000028526 | 208 |
| 27 | 3300005458 | Ga0070681_10003875 | Ga0070681_100038756 | 208 |
| 28 | 3300005459 | Ga0068867_100028261 | Ga0068867_1000282612 | 208 |
| 29 | 3300005530 | Ga0070679_100011577 | Ga0070679_1000115776 | 208 |
| 30 | 3300005535 | Ga0070684_100033110 | Ga0070684_1000331104 | 208 |
| 31 | 3300005539 | Ga0068853_100000518 | Ga0068853_1000005186 | 208 |
| 32 | 3300005543 | Ga0070672_100014519 | Ga0070672_1000145194 | 208 |
| 33 | 3300005545 | Ga0070695_100017187 | Ga0070695_1000171875 | 208 |
| 34 | 3300005547 | Ga0070693_100001092 | Ga0070693_1000010924 | 208 |
| 35 | 3300005549 | Ga0070704_100013935 | Ga0070704_1000139354 | 208 |
| 36 | 3300005563 | Ga0068855_100008473 | Ga0068855_10000847310 | 208 |
| 37 | 3300005564 | Ga0070664_100023335 | Ga0070664_1000233351 | 208 |
| 38 | 3300005577 | Ga0068857_100005198 | Ga0068857_1000051983 | 208 |
| 39 | 3300005578 | Ga0068854_100002526 | Ga0068854_10000252610 | 208 |
| 40 | 3300005614 | Ga0068856_100019528 | Ga0068856_1000195286 | 208 |
| 41 | 3300005616 | Ga0068852_100024867 | Ga0068852_1000248672 | 208 |
| 42 | 3300005617 | Ga0068859_100000976 | Ga0068859_10000097617 | 208 |
| 43 | 3300005618 | Ga0068864_100001266 | Ga0068864_10000126617 | 208 |
| 44 | 3300005840 | Ga0068870_10000987 | Ga0068870_100009874 | 208 |
| 45 | 3300005842 | Ga0068858_100036781 | Ga0068858_1000367814 | 208 |
| 46 | 3300005843 | Ga0068860_100016087 | Ga0068860_1000160876 | 208 |
| 47 | 3300005844 | Ga0068862_100001929 | Ga0068862_1000019295 | 208 |
| 48 | 3300006852 | Ga0075433_10100906 | Ga0075433_101009062 | 208 |
| 49 | 3300006871 | Ga0075434_100045687 | Ga0075434_1000456872 | 208 |
| 50 | 3300006931 | Ga0097620_100000976 | Ga0097620_10000097613 | 208 |
| 51 | 3300007076 | Ga0075435_100042844 | Ga0075435_1000428445 | 208 |
| 52 | 3300009147 | Ga0114129_10127166 | Ga0114129_101271662 | 208 |
| 53 | 3300009148 | Ga0105243_10155987 | Ga0105243_101559871 | 208 |
| 54 | 3300009174 | Ga0105241_10000602 | Ga0105241_1000060210 | 208 |
| 55 | 3300009551 | Ga0105238_10981169 | Ga0105238_109811691 | 208 |
| 56 | 3300010375 | Ga0105239_10255784 | Ga0105239_102557842 | 208 |
| 57 | 3300011119 | Ga0105246_10031031 | Ga0105246_100310313 | 208 |
| 58 | 3300013100 | Ga0157373_10001523 | Ga0157373_1000152313 | 208 |
| 59 | 3300013105 | Ga0157369_10003919 | Ga0157369_1000391916 | 208 |
| 60 | 3300013307 | Ga0157372_10000415 | Ga0157372_1000041520 | 208 |
| 61 | 3300013308 | Ga0157375_10024425 | Ga0157375_100244256 | 208 |
| 62 | 3300014325 | Ga0163163_10075053 | Ga0163163_100750533 | 208 |
| 63 | 3300014497 | Ga0182008_10038272 | Ga0182008_100382722 | 208 |
| 64 | 3300025885 | Ga0207653_10001986 | Ga0207653_100019862 | 208 |
| 65 | 3300025901 | Ga0207688_10022050 | Ga0207688_100220501 | 208 |
| 66 | 3300025907 | Ga0207645_10000389 | Ga0207645_1000038913 | 208 |
| 67 | 3300025908 | Ga0207643_10000290 | Ga0207643_1000029017 | 208 |
| 68 | 3300025911 | Ga0207654_10005545 | Ga0207654_100055454 | 208 |
| 69 | 3300025912 | Ga0207707_10000158 | Ga0207707_1000015848 | 208 |
| 70 | 3300025917 | Ga0207660_10000987 | Ga0207660_1000098710 | 208 |
| 71 | 3300025919 | Ga0207657_10000426 | Ga0207657_1000042621 | 208 |
| 72 | 3300025920 | Ga0207649_10002448 | Ga0207649_100024487 | 208 |
| 73 | 3300025921 | Ga0207652_10000290 | Ga0207652_100002904 | 208 |
| 74 | 3300025923 | Ga0207681_10016844 | Ga0207681_100168445 | 208 |
| 75 | 3300025925 | Ga0207650_10256121 | Ga0207650_102561212 | 208 |
| 76 | 3300025926 | Ga0207659_10025333 | Ga0207659_100253335 | 208 |
| 77 | 3300025932 | Ga0207690_10002346 | Ga0207690_1000234610 | 208 |
| 78 | 3300025933 | Ga0207706_10003426 | Ga0207706_100034266 | 208 |
| 79 | 3300025935 | Ga0207709_10032319 | Ga0207709_100323192 | 208 |
| 80 | 3300025936 | Ga0207670_10118886 | Ga0207670_101188863 | 208 |
| 81 | 3300025940 | Ga0207691_10076908 | Ga0207691_100769081 | 208 |
| 82 | 3300025942 | Ga0207689_10000277 | Ga0207689_1000027713 | 208 |
| 83 | 3300025945 | Ga0207679_10000773 | Ga0207679_1000077317 | 208 |
| 84 | 3300025949 | Ga0207667_10003179 | Ga0207667_1000317916 | 208 |
| 85 | 3300025981 | Ga0207640_10001020 | Ga0207640_100010206 | 208 |
| 86 | 3300026023 | Ga0207677_10082810 | Ga0207677_100828103 | 208 |
| 87 | 3300026035 | Ga0207703_10041954 | Ga0207703_100419543 | 208 |
| 88 | 3300026041 | Ga0207639_10001029 | Ga0207639_1000102916 | 208 |
| 89 | 3300026067 | Ga0207678_10022159 | Ga0207678_100221592 | 208 |
| 90 | 3300026075 | Ga0207708_10061128 | Ga0207708_100611282 | 208 |
| 91 | 3300026078 | Ga0207702_10003932 | Ga0207702_100039326 | 208 |
| 92 | 3300026089 | Ga0207648_10046041 | Ga0207648_100460414 | 208 |
| 93 | 3300026095 | Ga0207676_10033858 | Ga0207676_100338584 | 208 |
| 94 | 3300026116 | Ga0207674_10001112 | Ga0207674_1000111220 | 208 |
| 95 | 3300026118 | Ga0207675_100003707 | Ga0207675_10000370715 | 208 |
| 96 | 3300026142 | Ga0207698_10409182 | Ga0207698_104091821 | 208 |
| 97 | 3300028380 | Ga0268265_10024881 | Ga0268265_100248811 | 208 |
| 98 | 3300028381 | Ga0268264_10032016 | Ga0268264_100320165 | 208 |
| 99 | 3300034818 | Ga0373950_0009574 | Ga0373950_0009574_239_991 | 208 |
| 100 | 3300035090 | Ga0373949_0012139 | Ga0373949_0012139_267_1019 | 208 |
| 101 | 3300035091 | Ga0373951_0009267 | Ga0373951_0009267_1249_2001 | 208 |
| 102 | 3300035092 | Ga0373952_0002583 | Ga0373952_0002583_2470_3222 | 208 |
| 103 | 3300035112 | Ga0373932_0032119 | Ga0373932_0032119_476_1228 | 208 |
| 104 | 3300035691 | Ga0373931_0044914 | Ga0373931_0044914_191_943 | 208 |
| 105 | 3300042005 | Ga0439448_0007726 | Ga0439448_0007726_74_826 | 208 |
| 106 | 3300042012 | Ga0439455_0036068 | Ga0439455_0036068_272_1024 | 208 |
| 107 | 3300042157 | Ga0439458_0031856 | Ga0439458_0031856_480_1232 | 208 |
| 108 | 3300042876 | Ga0451577_0007730 | Ga0451577_0007730_6345_7097 | 208 |
| 109 | 3300048905 | Ga0496102_0051899 | Ga0496102_0051899_367_1119 | 208 |
| 110 | 3300048907 | Ga0496104_0253378 | Ga0496104_0253378_835_1587 | 208 |
| 111 | 3300048911 | Ga0496108_0649067 | Ga0496108_0649067_62_814 | 208 |
| 112 | 3300048912 | Ga0496109_0442920 | Ga0496109_0442920_253_1005 | 208 |
| 113 | 3300048915 | Ga0496112_0064810 | Ga0496112_0064810_2695_3447 | 208 |
| 114 | 3300048916 | Ga0496113_0295158 | Ga0496113_0295158_355_1107 | 208 |
| 115 | 3300049572 | Ga0501036_0344199 | Ga0501036_0344199_17_673 | 208 |
| 116 | 3300049591 | Ga0501075_0198999 | Ga0501075_0198999_808_1464 | 208 |
| 117 | 3300049592 | Ga0501076_0910073 | Ga0501076_0910073_52_708 | 208 |
| 118 | 3300049742 | Ga0501080_0229708 | Ga0501080_0229708_510_1166 | 208 |
| 119 | 3300050513 | nmdc:mga0rr50_147245_c1 | nmdc:mga0rr50_147245_c1_260_1012 | 208 |
| 120 | 3300050515 | nmdc:mga0a205_173969_c1 | nmdc:mga0a205_173969_c1_426_1178 | 208 |
| 121 | 3300025940 | Ga0207691_10356739 | Ga0207691_103567392 | 209 |
| 122 | 3300049568 | Ga0501031_0243676 | Ga0501031_0243676_498_1157 | 209 |
| 123 | 3300050507 | nmdc:mga05p37_132550_c1 | nmdc:mga05p37_132550_c1_1308_2060 | 210 |
| 124 | 3300025917 | Ga0207660_10668382 | Ga0207660_106683821 | 216 |
| 125 | 3300049742 | Ga0501080_0565874 | Ga0501080_0565874_11_697 | 218 |
| 126 | 3300049576 | Ga0501040_0087287 | Ga0501040_0087287_305_1057 | 219 |
| 127 | 3300049578 | Ga0501042_0279767 | Ga0501042_0279767_280_1032 | 219 |
| 128 | 3300049588 | Ga0501072_0019392 | Ga0501072_0019392_925_1677 | 219 |
| 129 | 3300049592 | Ga0501076_0060391 | Ga0501076_0060391_1221_1973 | 219 |
| 130 | 3300049742 | Ga0501080_0239431 | Ga0501080_0239431_661_1413 | 219 |
| 131 | 3300049824 | Ga0501045_0018570 | Ga0501045_0018570_3880_4632 | 219 |
| 132 | 3300054114 | Ga0501084_0064742 | Ga0501084_0064742_599_1351 | 219 |
| 133 | 3300061734 | Ga0530510_0032811 | Ga0530510_0032811_592_1344 | 219 |
| 134 | 3300049580 | Ga0501046_0093811 | Ga0501046_0093811_1088_1840 | 220 |
| 135 | 3300049575 | Ga0501039_0466292 | Ga0501039_0466292_187_939 | 221 |
| 136 | 3300049588 | Ga0501072_0143087 | Ga0501072_0143087_209_961 | 221 |
| 137 | 3300049588 | Ga0501072_0563245 | Ga0501072_0563245_56_808 | 221 |
| 138 | 3300049592 | Ga0501076_0079350 | Ga0501076_0079350_185_937 | 221 |
| 139 | 3300049743 | Ga0501081_0064719 | Ga0501081_0064719_261_1013 | 221 |
| 140 | 3300061734 | Ga0530510_0015192 | Ga0530510_0015192_1559_2311 | 221 |
| 141 | 3300061734 | Ga0530510_0231024 | Ga0530510_0231024_108_860 | 221 |
| 142 | 3300050509 | nmdc:mga0qj67_72017_c1 | nmdc:mga0qj67_72017_c1_59_826 | 222 |
| 143 | 3300031995 | Ga0307409_101296598 | Ga0307409_1012965981 | 223 |
| 144 | 3300049575 | Ga0501039_0636721 | Ga0501039_0636721_117_818 | 223 |
| 145 | 3300049580 | Ga0501046_0576693 | Ga0501046_0576693_15_716 | 223 |
| 146 | 3300042876 | Ga0451577_0014349 | Ga0451577_0014349_2530_3234 | 224 |
| 147 | 3300044673 | Ga0453683_0005071 | Ga0453683_0005071_3386_4090 | 224 |
| 148 | 3300044712 | Ga0453684_0130819 | Ga0453684_0130819_2112_2816 | 224 |
| 149 | 3300045051 | Ga0451576_0114215 | Ga0451576_0114215_856_1560 | 224 |
| 150 | 3300046472 | Ga0495580_0193068 | Ga0495580_0193068_681_1385 | 224 |
| 151 | 3300049575 | Ga0501039_0005533 | Ga0501039_0005533_8845_9549 | 224 |
| 152 | 3300049578 | Ga0501042_0358319 | Ga0501042_0358319_29_733 | 224 |
| 153 | 3300049822 | Ga0501035_0285826 | Ga0501035_0285826_301_1005 | 224 |
| 154 | 3300050511 | nmdc:mga08y16_1163552_c1 | nmdc:mga08y16_1163552_c1_26_730 | 224 |
| 155 | 3300050512 | nmdc:mga0n895_270470_c1 | nmdc:mga0n895_270470_c1_1016_1711 | 224 |
| 156 | 3300050514 | nmdc:mga08x19_546158_c1 | nmdc:mga08x19_546158_c1_34_738 | 224 |
| 157 | 3300009147 | Ga0114129_10363333 | Ga0114129_103633333 | 228 |
| 158 | 3300027552 | Ga0209982_1002708 | Ga0209982_10027081 | 229 |
| 159 | 3300049592 | Ga0501076_0706975 | Ga0501076_0706975_20_739 | 232 |
| 160 | 3300005289 | Ga0065704_10314564 | Ga0065704_103145641 | 233 |
| 161 | 3300005334 | Ga0068869_100002053 | Ga0068869_1000020538 | 233 |
| 162 | 3300005347 | Ga0070668_100158679 | Ga0070668_1001586792 | 233 |
| 163 | 3300005406 | Ga0070703_10005280 | Ga0070703_100052802 | 233 |
| 164 | 3300005444 | Ga0070694_100145888 | Ga0070694_1001458882 | 233 |
| 165 | 3300005471 | Ga0070698_100322269 | Ga0070698_1003222691 | 233 |
| 166 | 3300005545 | Ga0070695_100010470 | Ga0070695_1000104705 | 233 |
| 167 | 3300005546 | Ga0070696_100108877 | Ga0070696_1001088771 | 233 |
| 168 | 3300005547 | Ga0070693_100053471 | Ga0070693_1000534711 | 233 |
| 169 | 3300005549 | Ga0070704_100047033 | Ga0070704_1000470332 | 233 |
| 170 | 3300005843 | Ga0068860_100499276 | Ga0068860_1004992761 | 233 |
| 171 | 3300005844 | Ga0068862_100092664 | Ga0068862_1000926642 | 233 |
| 172 | 3300006847 | Ga0075431_100311893 | Ga0075431_1003118932 | 233 |
| 173 | 3300009098 | Ga0105245_10061624 | Ga0105245_100616244 | 233 |
| 174 | 3300009147 | Ga0114129_11337027 | Ga0114129_113370271 | 233 |
| 175 | 3300009174 | Ga0105241_10351278 | Ga0105241_103512781 | 233 |
| 176 | 3300009176 | Ga0105242_10312952 | Ga0105242_103129522 | 233 |
| 177 | 3300013306 | Ga0163162_10628566 | Ga0163162_106285662 | 233 |
| 178 | 3300025885 | Ga0207653_10017569 | Ga0207653_100175693 | 233 |
| 179 | 3300025917 | Ga0207660_10063986 | Ga0207660_100639862 | 233 |
| 180 | 3300025922 | Ga0207646_10484674 | Ga0207646_104846741 | 233 |
| 181 | 3300025927 | Ga0207687_10035250 | Ga0207687_100352504 | 233 |
| 182 | 3300025935 | Ga0207709_10059847 | Ga0207709_100598473 | 233 |
| 183 | 3300025942 | Ga0207689_10002344 | Ga0207689_100023442 | 233 |
| 184 | 3300025972 | Ga0207668_10632273 | Ga0207668_106322732 | 233 |
| 185 | 3300026035 | Ga0207703_10449022 | Ga0207703_104490222 | 233 |
| 186 | 3300026089 | Ga0207648_10123281 | Ga0207648_101232813 | 233 |
| 187 | 3300028380 | Ga0268265_10011589 | Ga0268265_100115893 | 233 |
| 188 | 3300042008 | Ga0439450_059040 | Ga0439450_059040_83_832 | 233 |
| 189 | 3300044673 | Ga0453683_0039670 | Ga0453683_0039670_1487_2236 | 233 |
| 190 | 3300046491 | Ga0495584_0072783 | Ga0495584_0072783_607_1356 | 233 |
| 191 | 3300048909 | Ga0496106_0514185 | Ga0496106_0514185_95_844 | 233 |
| 192 | 3300049575 | Ga0501039_0357622 | Ga0501039_0357622_230_979 | 233 |
| 193 | 3300049577 | Ga0501041_0080929 | Ga0501041_0080929_936_1685 | 233 |
| 194 | 3300049578 | Ga0501042_0065812 | Ga0501042_0065812_1767_2516 | 233 |
| 195 | 3300049580 | Ga0501046_0142576 | Ga0501046_0142576_157_906 | 233 |
| 196 | 3300049584 | Ga0501068_0047077 | Ga0501068_0047077_1483_2232 | 233 |
| 197 | 3300049587 | Ga0501071_0089391 | Ga0501071_0089391_470_1219 | 233 |
| 198 | 3300049589 | Ga0501073_0113279 | Ga0501073_0113279_232_981 | 233 |
| 199 | 3300049590 | Ga0501074_0119473 | Ga0501074_0119473_292_1041 | 233 |
| 200 | 3300049591 | Ga0501075_0024646 | Ga0501075_0024646_3529_4278 | 233 |
| 201 | 3300049591 | Ga0501075_0109520 | Ga0501075_0109520_1101_1850 | 233 |
| 202 | 3300049591 | Ga0501075_0115461 | Ga0501075_0115461_998_1747 | 233 |
| 203 | 3300049592 | Ga0501076_0243552 | Ga0501076_0243552_135_884 | 233 |
| 204 | 3300049593 | Ga0501077_0104873 | Ga0501077_0104873_149_898 | 233 |
| 205 | 3300049741 | Ga0501079_0110328 | Ga0501079_0110328_432_1181 | 233 |
| 206 | 3300049742 | Ga0501080_0013705 | Ga0501080_0013705_5990_6739 | 233 |
| 207 | 3300049743 | Ga0501081_0002065 | Ga0501081_0002065_9586_10335 | 233 |
| 208 | 3300049744 | Ga0501083_0173718 | Ga0501083_0173718_462_1211 | 233 |
| 209 | 3300049822 | Ga0501035_0320692 | Ga0501035_0320692_121_870 | 233 |
| 210 | 3300049824 | Ga0501045_0144679 | Ga0501045_0144679_307_1056 | 233 |
| 211 | 3300050507 | nmdc:mga05p37_403887_c1 | nmdc:mga05p37_403887_c1_192_932 | 233 |
| 212 | 3300054114 | Ga0501084_0011863 | Ga0501084_0011863_3144_3893 | 233 |
| 213 | 3300060353 | Ga0501082_0059775 | Ga0501082_0059775_847_1596 | 233 |
| 214 | 3300060353 | Ga0501082_0105500 | Ga0501082_0105500_1138_1887 | 233 |
| 215 | 3300060353 | Ga0501082_0158908 | Ga0501082_0158908_1098_1847 | 233 |
| 216 | 3300003349 | JGI26129J50193_1003564 | JGI26129J50193_10035642 | 234 |
| 217 | 3300003373 | JGI25407J50210_10033392 | JGI25407J50210_100333922 | 234 |
| 218 | 3300003503 | JGI26141J51220_1001422 | JGI26141J51220_10014222 | 234 |
| 219 | 3300005330 | Ga0070690_100118531 | Ga0070690_1001185313 | 234 |
| 220 | 3300005330 | Ga0070690_100516391 | Ga0070690_1005163911 | 234 |
| 221 | 3300005336 | Ga0070680_100029669 | Ga0070680_1000296695 | 234 |
| 222 | 3300005336 | Ga0070680_100034957 | Ga0070680_1000349572 | 234 |
| 223 | 3300005336 | Ga0070680_100346515 | Ga0070680_1003465152 | 234 |
| 224 | 3300005341 | Ga0070691_10001908 | Ga0070691_100019087 | 234 |
| 225 | 3300005341 | Ga0070691_10023591 | Ga0070691_100235912 | 234 |
| 226 | 3300005353 | Ga0070669_100009553 | Ga0070669_1000095535 | 234 |
| 227 | 3300005353 | Ga0070669_100383192 | Ga0070669_1003831922 | 234 |
| 228 | 3300005434 | Ga0070709_10045578 | Ga0070709_100455784 | 234 |
| 229 | 3300005439 | Ga0070711_100462505 | Ga0070711_1004625051 | 234 |
| 230 | 3300005440 | Ga0070705_100019189 | Ga0070705_1000191892 | 234 |
| 231 | 3300005440 | Ga0070705_100048811 | Ga0070705_1000488112 | 234 |
| 232 | 3300005440 | Ga0070705_100068779 | Ga0070705_1000687792 | 234 |
| 233 | 3300005441 | Ga0070700_100019386 | Ga0070700_1000193862 | 234 |
| 234 | 3300005444 | Ga0070694_100000326 | Ga0070694_10000032616 | 234 |
| 235 | 3300005444 | Ga0070694_100020927 | Ga0070694_1000209274 | 234 |
| 236 | 3300005444 | Ga0070694_100054799 | Ga0070694_1000547994 | 234 |
| 237 | 3300005444 | Ga0070694_100468245 | Ga0070694_1004682451 | 234 |
| 238 | 3300005445 | Ga0070708_100011197 | Ga0070708_1000111978 | 234 |
| 239 | 3300005445 | Ga0070708_100015611 | Ga0070708_1000156114 | 234 |
| 240 | 3300005445 | Ga0070708_100028675 | Ga0070708_1000286752 | 234 |
| 241 | 3300005445 | Ga0070708_100032014 | Ga0070708_1000320144 | 234 |
| 242 | 3300005445 | Ga0070708_100069682 | Ga0070708_1000696824 | 234 |
| 243 | 3300005445 | Ga0070708_100129176 | Ga0070708_1001291762 | 234 |
| 244 | 3300005445 | Ga0070708_100132915 | Ga0070708_1001329152 | 234 |
| 245 | 3300005457 | Ga0070662_100125151 | Ga0070662_1001251511 | 234 |
| 246 | 3300005457 | Ga0070662_100411032 | Ga0070662_1004110322 | 234 |
| 247 | 3300005457 | Ga0070662_100510981 | Ga0070662_1005109811 | 234 |
| 248 | 3300005467 | Ga0070706_100023384 | Ga0070706_1000233843 | 234 |
| 249 | 3300005467 | Ga0070706_100037683 | Ga0070706_1000376832 | 234 |
| 250 | 3300005467 | Ga0070706_100048189 | Ga0070706_1000481895 | 234 |
| 251 | 3300005467 | Ga0070706_100574269 | Ga0070706_1005742691 | 234 |
| 252 | 3300005468 | Ga0070707_100001990 | Ga0070707_1000019909 | 234 |
| 253 | 3300005468 | Ga0070707_100015361 | Ga0070707_1000153615 | 234 |
| 254 | 3300005468 | Ga0070707_100061601 | Ga0070707_1000616014 | 234 |
| 255 | 3300005468 | Ga0070707_100114959 | Ga0070707_1001149591 | 234 |
| 256 | 3300005468 | Ga0070707_100141390 | Ga0070707_1001413902 | 234 |
| 257 | 3300005468 | Ga0070707_100264879 | Ga0070707_1002648793 | 234 |
| 258 | 3300005468 | Ga0070707_100302553 | Ga0070707_1003025531 | 234 |
| 259 | 3300005468 | Ga0070707_100401665 | Ga0070707_1004016652 | 234 |
| 260 | 3300005468 | Ga0070707_100519354 | Ga0070707_1005193542 | 234 |
| 261 | 3300005471 | Ga0070698_100011688 | Ga0070698_1000116888 | 234 |
| 262 | 3300005471 | Ga0070698_100039746 | Ga0070698_1000397462 | 234 |
| 263 | 3300005471 | Ga0070698_100060267 | Ga0070698_1000602671 | 234 |
| 264 | 3300005471 | Ga0070698_100158187 | Ga0070698_1001581872 | 234 |
| 265 | 3300005471 | Ga0070698_100335321 | Ga0070698_1003353212 | 234 |
| 266 | 3300005518 | Ga0070699_100003494 | Ga0070699_1000034948 | 234 |
| 267 | 3300005518 | Ga0070699_100007127 | Ga0070699_1000071274 | 234 |
| 268 | 3300005518 | Ga0070699_100191765 | Ga0070699_1001917652 | 234 |
| 269 | 3300005518 | Ga0070699_100248325 | Ga0070699_1002483252 | 234 |
| 270 | 3300005518 | Ga0070699_100285229 | Ga0070699_1002852292 | 234 |
| 271 | 3300005536 | Ga0070697_100006412 | Ga0070697_1000064123 | 234 |
| 272 | 3300005536 | Ga0070697_100027540 | Ga0070697_1000275403 | 234 |
| 273 | 3300005536 | Ga0070697_100044734 | Ga0070697_1000447342 | 234 |
| 274 | 3300005536 | Ga0070697_100048855 | Ga0070697_1000488552 | 234 |
| 275 | 3300005536 | Ga0070697_100050530 | Ga0070697_1000505304 | 234 |
| 276 | 3300005536 | Ga0070697_100056999 | Ga0070697_1000569994 | 234 |
| 277 | 3300005536 | Ga0070697_100276740 | Ga0070697_1002767402 | 234 |
| 278 | 3300005536 | Ga0070697_100351576 | Ga0070697_1003515762 | 234 |
| 279 | 3300005543 | Ga0070672_100027044 | Ga0070672_1000270444 | 234 |
| 280 | 3300005545 | Ga0070695_100002363 | Ga0070695_1000023633 | 234 |
| 281 | 3300005545 | Ga0070695_100005039 | Ga0070695_1000050395 | 234 |
| 282 | 3300005546 | Ga0070696_100023696 | Ga0070696_1000236964 | 234 |
| 283 | 3300005546 | Ga0070696_100081933 | Ga0070696_1000819333 | 234 |
| 284 | 3300005546 | Ga0070696_100083494 | Ga0070696_1000834943 | 234 |
| 285 | 3300005546 | Ga0070696_100109916 | Ga0070696_1001099162 | 234 |
| 286 | 3300005546 | Ga0070696_100284506 | Ga0070696_1002845062 | 234 |
| 287 | 3300005549 | Ga0070704_100035814 | Ga0070704_1000358142 | 234 |
| 288 | 3300005549 | Ga0070704_100117534 | Ga0070704_1001175344 | 234 |
| 289 | 3300005549 | Ga0070704_100169678 | Ga0070704_1001696781 | 234 |
| 290 | 3300005577 | Ga0068857_100094490 | Ga0068857_1000944901 | 234 |
| 291 | 3300005577 | Ga0068857_100307625 | Ga0068857_1003076252 | 234 |
| 292 | 3300005615 | Ga0070702_100065431 | Ga0070702_1000654312 | 234 |
| 293 | 3300005617 | Ga0068859_100211864 | Ga0068859_1002118642 | 234 |
| 294 | 3300005841 | Ga0068863_100056203 | Ga0068863_1000562033 | 234 |
| 295 | 3300005843 | Ga0068860_100052318 | Ga0068860_1000523182 | 234 |
| 296 | 3300005843 | Ga0068860_100144646 | Ga0068860_1001446464 | 234 |
| 297 | 3300005844 | Ga0068862_100532795 | Ga0068862_1005327952 | 234 |
| 298 | 3300005937 | Ga0081455_10015861 | Ga0081455_100158614 | 234 |
| 299 | 3300005981 | Ga0081538_10028407 | Ga0081538_100284072 | 234 |
| 300 | 3300005983 | Ga0081540_1017503 | Ga0081540_10175034 | 234 |
| 301 | 3300005983 | Ga0081540_1103207 | Ga0081540_11032071 | 234 |
| 302 | 3300005985 | Ga0081539_10000044 | Ga0081539_1000004486 | 234 |
| 303 | 3300006175 | Ga0070712_100003253 | Ga0070712_1000032539 | 234 |
| 304 | 3300006844 | Ga0075428_100000409 | Ga0075428_10000040930 | 234 |
| 305 | 3300006844 | Ga0075428_100004007 | Ga0075428_1000040075 | 234 |
| 306 | 3300006844 | Ga0075428_100010083 | Ga0075428_1000100834 | 234 |
| 307 | 3300006844 | Ga0075428_100012600 | Ga0075428_1000126008 | 234 |
| 308 | 3300006844 | Ga0075428_100071289 | Ga0075428_1000712892 | 234 |
| 309 | 3300006844 | Ga0075428_100093499 | Ga0075428_1000934992 | 234 |
| 310 | 3300006844 | Ga0075428_100148280 | Ga0075428_1001482803 | 234 |
| 311 | 3300006844 | Ga0075428_100721192 | Ga0075428_1007211921 | 234 |
| 312 | 3300006844 | Ga0075428_100843780 | Ga0075428_1008437802 | 234 |
| 313 | 3300006846 | Ga0075430_100000648 | Ga0075430_10000064815 | 234 |
| 314 | 3300006846 | Ga0075430_100002276 | Ga0075430_10000227618 | 234 |
| 315 | 3300006846 | Ga0075430_100006658 | Ga0075430_1000066585 | 234 |
| 316 | 3300006846 | Ga0075430_100041160 | Ga0075430_1000411603 | 234 |
| 317 | 3300006846 | Ga0075430_100059632 | Ga0075430_1000596322 | 234 |
| 318 | 3300006846 | Ga0075430_100420480 | Ga0075430_1004204801 | 234 |
| 319 | 3300006847 | Ga0075431_100000181 | Ga0075431_10000018144 | 234 |
| 320 | 3300006847 | Ga0075431_100001052 | Ga0075431_10000105222 | 234 |
| 321 | 3300006847 | Ga0075431_100003068 | Ga0075431_10000306815 | 234 |
| 322 | 3300006847 | Ga0075431_100003078 | Ga0075431_10000307816 | 234 |
| 323 | 3300006847 | Ga0075431_100009651 | Ga0075431_1000096515 | 234 |
| 324 | 3300006847 | Ga0075431_100080627 | Ga0075431_1000806273 | 234 |
| 325 | 3300006847 | Ga0075431_100093628 | Ga0075431_1000936282 | 234 |
| 326 | 3300006847 | Ga0075431_100203116 | Ga0075431_1002031161 | 234 |
| 327 | 3300006847 | Ga0075431_100473263 | Ga0075431_1004732632 | 234 |
| 328 | 3300006852 | Ga0075433_10001470 | Ga0075433_1000147011 | 234 |
| 329 | 3300006852 | Ga0075433_10002688 | Ga0075433_100026887 | 234 |
| 330 | 3300006852 | Ga0075433_10017885 | Ga0075433_100178853 | 234 |
| 331 | 3300006852 | Ga0075433_10025926 | Ga0075433_100259264 | 234 |
| 332 | 3300006852 | Ga0075433_10067634 | Ga0075433_100676342 | 234 |
| 333 | 3300006852 | Ga0075433_10073771 | Ga0075433_100737711 | 234 |
| 334 | 3300006852 | Ga0075433_10221264 | Ga0075433_102212642 | 234 |
| 335 | 3300006852 | Ga0075433_10229189 | Ga0075433_102291892 | 234 |
| 336 | 3300006871 | Ga0075434_100006184 | Ga0075434_1000061842 | 234 |
| 337 | 3300006871 | Ga0075434_100010856 | Ga0075434_1000108566 | 234 |
| 338 | 3300006871 | Ga0075434_100037121 | Ga0075434_1000371213 | 234 |
| 339 | 3300006871 | Ga0075434_100078686 | Ga0075434_1000786863 | 234 |
| 340 | 3300006871 | Ga0075434_100122319 | Ga0075434_1001223192 | 234 |
| 341 | 3300006871 | Ga0075434_100125335 | Ga0075434_1001253352 | 234 |
| 342 | 3300006871 | Ga0075434_100134302 | Ga0075434_1001343024 | 234 |
| 343 | 3300006871 | Ga0075434_100213306 | Ga0075434_1002133062 | 234 |
| 344 | 3300006871 | Ga0075434_100640345 | Ga0075434_1006403452 | 234 |
| 345 | 3300006880 | Ga0075429_100000116 | Ga0075429_10000011629 | 234 |
| 346 | 3300006880 | Ga0075429_100006906 | Ga0075429_1000069063 | 234 |
| 347 | 3300006880 | Ga0075429_100009267 | Ga0075429_10000926711 | 234 |
| 348 | 3300006880 | Ga0075429_100010439 | Ga0075429_1000104394 | 234 |
| 349 | 3300006880 | Ga0075429_100010600 | Ga0075429_1000106002 | 234 |
| 350 | 3300006880 | Ga0075429_100011279 | Ga0075429_1000112794 | 234 |
| 351 | 3300006880 | Ga0075429_100042925 | Ga0075429_1000429252 | 234 |
| 352 | 3300006880 | Ga0075429_100100746 | Ga0075429_1001007462 | 234 |
| 353 | 3300006880 | Ga0075429_100141934 | Ga0075429_1001419342 | 234 |
| 354 | 3300006880 | Ga0075429_100430711 | Ga0075429_1004307111 | 234 |
| 355 | 3300006881 | Ga0068865_100098520 | Ga0068865_1000985202 | 234 |
| 356 | 3300006881 | Ga0068865_100100352 | Ga0068865_1001003523 | 234 |
| 357 | 3300006914 | Ga0075436_100027597 | Ga0075436_1000275976 | 234 |
| 358 | 3300006914 | Ga0075436_100035510 | Ga0075436_1000355102 | 234 |
| 359 | 3300006914 | Ga0075436_100179959 | Ga0075436_1001799592 | 234 |
| 360 | 3300006931 | Ga0097620_100211860 | Ga0097620_1002118602 | 234 |
| 361 | 3300007076 | Ga0075435_100005723 | Ga0075435_10000572311 | 234 |
| 362 | 3300007076 | Ga0075435_100006422 | Ga0075435_1000064228 | 234 |
| 363 | 3300007076 | Ga0075435_100010888 | Ga0075435_1000108884 | 234 |
| 364 | 3300007076 | Ga0075435_100160144 | Ga0075435_1001601443 | 234 |
| 365 | 3300007076 | Ga0075435_100400418 | Ga0075435_1004004182 | 234 |
| 366 | 3300007265 | Ga0099794_10045714 | Ga0099794_100457142 | 234 |
| 367 | 3300009094 | Ga0111539_10001546 | Ga0111539_100015467 | 234 |
| 368 | 3300009094 | Ga0111539_10016844 | Ga0111539_100168442 | 234 |
| 369 | 3300009094 | Ga0111539_10029142 | Ga0111539_100291428 | 234 |
| 370 | 3300009094 | Ga0111539_10086840 | Ga0111539_100868402 | 234 |
| 371 | 3300009147 | Ga0114129_10001191 | Ga0114129_100011916 | 234 |
| 372 | 3300009147 | Ga0114129_10012024 | Ga0114129_1001202411 | 234 |
| 373 | 3300009147 | Ga0114129_10012777 | Ga0114129_100127777 | 234 |
| 374 | 3300009147 | Ga0114129_10016389 | Ga0114129_1001638911 | 234 |
| 375 | 3300009147 | Ga0114129_10017340 | Ga0114129_1001734011 | 234 |
| 376 | 3300009147 | Ga0114129_10022174 | Ga0114129_100221742 | 234 |
| 377 | 3300009147 | Ga0114129_10036794 | Ga0114129_100367942 | 234 |
| 378 | 3300009147 | Ga0114129_10073027 | Ga0114129_100730274 | 234 |
| 379 | 3300009147 | Ga0114129_10082640 | Ga0114129_100826404 | 234 |
| 380 | 3300009147 | Ga0114129_10152998 | Ga0114129_101529983 | 234 |
| 381 | 3300009147 | Ga0114129_10244822 | Ga0114129_102448222 | 234 |
| 382 | 3300009147 | Ga0114129_10285463 | Ga0114129_102854633 | 234 |
| 383 | 3300009147 | Ga0114129_10294037 | Ga0114129_102940373 | 234 |
| 384 | 3300009147 | Ga0114129_10321737 | Ga0114129_103217372 | 234 |
| 385 | 3300009147 | Ga0114129_10831422 | Ga0114129_108314222 | 234 |
| 386 | 3300009148 | Ga0105243_10036440 | Ga0105243_100364404 | 234 |
| 387 | 3300009148 | Ga0105243_10153032 | Ga0105243_101530322 | 234 |
| 388 | 3300009148 | Ga0105243_10301713 | Ga0105243_103017132 | 234 |
| 389 | 3300009174 | Ga0105241_10081082 | Ga0105241_100810824 | 234 |
| 390 | 3300009176 | Ga0105242_10002560 | Ga0105242_1000256013 | 234 |
| 391 | 3300009553 | Ga0105249_10022216 | Ga0105249_100222165 | 234 |
| 392 | 3300009553 | Ga0105249_10101361 | Ga0105249_101013612 | 234 |
| 393 | 3300013100 | Ga0157373_10280657 | Ga0157373_102806571 | 234 |
| 394 | 3300013297 | Ga0157378_10103497 | Ga0157378_101034972 | 234 |
| 395 | 3300013297 | Ga0157378_10260932 | Ga0157378_102609322 | 234 |
| 396 | 3300013297 | Ga0157378_10438618 | Ga0157378_104386181 | 234 |
| 397 | 3300013308 | Ga0157375_10715082 | Ga0157375_107150821 | 234 |
| 398 | 3300013308 | Ga0157375_10982318 | Ga0157375_109823182 | 234 |
| 399 | 3300014326 | Ga0157380_10175728 | Ga0157380_101757281 | 234 |
| 400 | 3300014326 | Ga0157380_10680290 | Ga0157380_106802902 | 234 |
| 401 | 3300025885 | Ga0207653_10004275 | Ga0207653_100042753 | 234 |
| 402 | 3300025910 | Ga0207684_10000673 | Ga0207684_1000067330 | 234 |
| 403 | 3300025910 | Ga0207684_10004725 | Ga0207684_1000472513 | 234 |
| 404 | 3300025910 | Ga0207684_10007696 | Ga0207684_100076963 | 234 |
| 405 | 3300025910 | Ga0207684_10013914 | Ga0207684_100139145 | 234 |
| 406 | 3300025910 | Ga0207684_10019842 | Ga0207684_100198424 | 234 |
| 407 | 3300025910 | Ga0207684_10024244 | Ga0207684_100242447 | 234 |
| 408 | 3300025910 | Ga0207684_10049409 | Ga0207684_100494092 | 234 |
| 409 | 3300025911 | Ga0207654_10018200 | Ga0207654_100182003 | 234 |
| 410 | 3300025915 | Ga0207693_10004038 | Ga0207693_100040389 | 234 |
| 411 | 3300025915 | Ga0207693_10164148 | Ga0207693_101641482 | 234 |
| 412 | 3300025916 | Ga0207663_10563445 | Ga0207663_105634451 | 234 |
| 413 | 3300025917 | Ga0207660_10170079 | Ga0207660_101700792 | 234 |
| 414 | 3300025922 | Ga0207646_10003019 | Ga0207646_1000301918 | 234 |
| 415 | 3300025922 | Ga0207646_10004413 | Ga0207646_1000441313 | 234 |
| 416 | 3300025922 | Ga0207646_10094726 | Ga0207646_100947263 | 234 |
| 417 | 3300025922 | Ga0207646_10116178 | Ga0207646_101161782 | 234 |
| 418 | 3300025922 | Ga0207646_10194980 | Ga0207646_101949801 | 234 |
| 419 | 3300025922 | Ga0207646_10202571 | Ga0207646_102025713 | 234 |
| 420 | 3300025922 | Ga0207646_10422670 | Ga0207646_104226701 | 234 |
| 421 | 3300025922 | Ga0207646_10476044 | Ga0207646_104760441 | 234 |
| 422 | 3300025923 | Ga0207681_10351511 | Ga0207681_103515112 | 234 |
| 423 | 3300025934 | Ga0207686_10015702 | Ga0207686_100157022 | 234 |
| 424 | 3300025935 | Ga0207709_10014362 | Ga0207709_100143621 | 234 |
| 425 | 3300025935 | Ga0207709_10072769 | Ga0207709_100727692 | 234 |
| 426 | 3300025935 | Ga0207709_10184559 | Ga0207709_101845592 | 234 |
| 427 | 3300025936 | Ga0207670_10111422 | Ga0207670_101114222 | 234 |
| 428 | 3300025938 | Ga0207704_10106592 | Ga0207704_101065922 | 234 |
| 429 | 3300025939 | Ga0207665_10003465 | Ga0207665_1000346510 | 234 |
| 430 | 3300025940 | Ga0207691_10086362 | Ga0207691_100863623 | 234 |
| 431 | 3300025942 | Ga0207689_10052447 | Ga0207689_100524472 | 234 |
| 432 | 3300025961 | Ga0207712_10077000 | Ga0207712_100770003 | 234 |
| 433 | 3300025972 | Ga0207668_10102555 | Ga0207668_101025552 | 234 |
| 434 | 3300026075 | Ga0207708_10004830 | Ga0207708_100048301 | 234 |
| 435 | 3300026089 | Ga0207648_10042884 | Ga0207648_100428844 | 234 |
| 436 | 3300026116 | Ga0207674_10324804 | Ga0207674_103248042 | 234 |
| 437 | 3300027360 | Ga0209969_1005511 | Ga0209969_10055112 | 234 |
| 438 | 3300027364 | Ga0209967_1013273 | Ga0209967_10132732 | 234 |
| 439 | 3300027378 | Ga0209981_1003723 | Ga0209981_10037232 | 234 |
| 440 | 3300027395 | Ga0209996_1000276 | Ga0209996_10002768 | 234 |
| 441 | 3300027462 | Ga0210000_1005391 | Ga0210000_10053912 | 234 |
| 442 | 3300027471 | Ga0209995_1000753 | Ga0209995_10007531 | 234 |
| 443 | 3300027526 | Ga0209968_1002525 | Ga0209968_10025253 | 234 |
| 444 | 3300027543 | Ga0209999_1001317 | Ga0209999_10013173 | 234 |
| 445 | 3300027665 | Ga0209983_1000304 | Ga0209983_10003046 | 234 |
| 446 | 3300027665 | Ga0209983_1019974 | Ga0209983_10199742 | 234 |
| 447 | 3300027671 | Ga0209588_1021324 | Ga0209588_10213242 | 234 |
| 448 | 3300027671 | Ga0209588_1029903 | Ga0209588_10299032 | 234 |
| 449 | 3300027671 | Ga0209588_1036640 | Ga0209588_10366402 | 234 |
| 450 | 3300027682 | Ga0209971_1000036 | Ga0209971_100003614 | 234 |
| 451 | 3300027695 | Ga0209966_1000228 | Ga0209966_100022815 | 234 |
| 452 | 3300027717 | Ga0209998_10000002 | Ga0209998_1000000245 | 234 |
| 453 | 3300027876 | Ga0209974_10012526 | Ga0209974_100125264 | 234 |
| 454 | 3300027907 | Ga0207428_10000398 | Ga0207428_1000039828 | 234 |
| 455 | 3300027907 | Ga0207428_10000526 | Ga0207428_1000052633 | 234 |
| 456 | 3300027907 | Ga0207428_10069725 | Ga0207428_100697252 | 234 |
| 457 | 3300028381 | Ga0268264_10045134 | Ga0268264_100451344 | 234 |
| 458 | 3300028381 | Ga0268264_10086095 | Ga0268264_100860952 | 234 |
| 459 | 3300028381 | Ga0268264_10210804 | Ga0268264_102108042 | 234 |
| 460 | 3300031548 | Ga0307408_100101902 | Ga0307408_1001019022 | 234 |
| 461 | 3300031911 | Ga0307412_10074286 | Ga0307412_100742863 | 234 |
| 462 | 3300031995 | Ga0307409_100361726 | Ga0307409_1003617262 | 234 |
| 463 | 3300031995 | Ga0307409_100556605 | Ga0307409_1005566051 | 234 |
| 464 | 3300032126 | Ga0307415_100239906 | Ga0307415_1002399062 | 234 |
| 465 | 3300035084 | Ga0373928_0017528 | Ga0373928_0017528_484_1236 | 234 |
| 466 | 3300035088 | Ga0373940_0003877 | Ga0373940_0003877_1139_1891 | 234 |
| 467 | 3300035090 | Ga0373949_0020438 | Ga0373949_0020438_62_814 | 234 |
| 468 | 3300035090 | Ga0373949_0044645 | Ga0373949_0044645_27_779 | 234 |
| 469 | 3300035114 | Ga0373939_0011216 | Ga0373939_0011216_320_1072 | 234 |
| 470 | 3300035114 | Ga0373939_0022929 | Ga0373939_0022929_374_1126 | 234 |
| 471 | 3300035691 | Ga0373931_0017773 | Ga0373931_0017773_311_1063 | 234 |
| 472 | 3300035691 | Ga0373931_0028538 | Ga0373931_0028538_1719_2471 | 234 |
| 473 | 3300035691 | Ga0373931_0130007 | Ga0373931_0130007_39_791 | 234 |
| 474 | 3300035691 | Ga0373931_0505477 | Ga0373931_0505477_18_770 | 234 |
| 475 | 3300037312 | Ga0395899_0228129 | Ga0395899_0228129_64_816 | 234 |
| 476 | 3300037466 | Ga0395898_0110168 | Ga0395898_0110168_59_811 | 234 |
| 477 | 3300037466 | Ga0395898_0758660 | Ga0395898_0758660_106_858 | 234 |
| 478 | 3300038443 | Ga0395901_0085204 | Ga0395901_0085204_789_1541 | 234 |
| 479 | 3300038443 | Ga0395901_0695613 | Ga0395901_0695613_76_828 | 234 |
| 480 | 3300042003 | Ga0439443_021858 | Ga0439443_021858_97_849 | 234 |
| 481 | 3300042005 | Ga0439448_0034698 | Ga0439448_0034698_639_1391 | 234 |
| 482 | 3300042436 | Ga0439435_0074447 | Ga0439435_0074447_241_993 | 234 |
| 483 | 3300042436 | Ga0439435_0096276 | Ga0439435_0096276_98_850 | 234 |
| 484 | 3300042439 | Ga0439464_0003187 | Ga0439464_0003187_587_1339 | 234 |
| 485 | 3300042461 | Ga0439460_0002670 | Ga0439460_0002670_2680_3432 | 234 |
| 486 | 3300042461 | Ga0439460_0088913 | Ga0439460_0088913_207_959 | 234 |
| 487 | 3300042876 | Ga0451577_0000793 | Ga0451577_0000793_30188_30931 | 234 |
| 488 | 3300044673 | Ga0453683_0009470 | Ga0453683_0009470_1685_2428 | 234 |
| 489 | 3300044673 | Ga0453683_0278141 | Ga0453683_0278141_41_793 | 234 |
| 490 | 3300044712 | Ga0453684_0031081 | Ga0453684_0031081_1081_1824 | 234 |
| 491 | 3300044712 | Ga0453684_0530748 | Ga0453684_0530748_532_1284 | 234 |
| 492 | 3300044712 | Ga0453684_0694702 | Ga0453684_0694702_104_856 | 234 |
| 493 | 3300045051 | Ga0451576_0005173 | Ga0451576_0005173_3485_4228 | 234 |
| 494 | 3300045051 | Ga0451576_0032025 | Ga0451576_0032025_1622_2374 | 234 |
| 495 | 3300045051 | Ga0451576_0033529 | Ga0451576_0033529_1581_2324 | 234 |
| 496 | 3300045051 | Ga0451576_0049699 | Ga0451576_0049699_2969_3721 | 234 |
| 497 | 3300045051 | Ga0451576_0053559 | Ga0451576_0053559_263_1015 | 234 |
| 498 | 3300045051 | Ga0451576_0264864 | Ga0451576_0264864_915_1667 | 234 |
| 499 | 3300046455 | Ga0495603_0084563 | Ga0495603_0084563_365_1117 | 234 |
| 500 | 3300046472 | Ga0495580_0016661 | Ga0495580_0016661_1400_2152 | 234 |
| 501 | 3300046491 | Ga0495584_0071647 | Ga0495584_0071647_826_1578 | 234 |
| 502 | 3300046528 | Ga0495642_0011189 | Ga0495642_0011189_2483_3235 | 234 |
| 503 | 3300046558 | Ga0495633_0181734 | Ga0495633_0181734_190_942 | 234 |
| 504 | 3300046615 | Ga0495656_0053380 | Ga0495656_0053380_145_897 | 234 |
| 505 | 3300046664 | Ga0495659_0037935 | Ga0495659_0037935_786_1538 | 234 |
| 506 | 3300046684 | Ga0495669_0027414 | Ga0495669_0027414_1014_1766 | 234 |
| 507 | 3300046684 | Ga0495669_0038401 | Ga0495669_0038401_252_1004 | 234 |
| 508 | 3300047318 | Ga0495636_0058445 | Ga0495636_0058445_69_821 | 234 |
| 509 | 3300047318 | Ga0495636_0098583 | Ga0495636_0098583_362_1105 | 234 |
| 510 | 3300047318 | Ga0495636_0188675 | Ga0495636_0188675_144_896 | 234 |
| 511 | 3300048906 | Ga0496103_0375382 | Ga0496103_0375382_29_772 | 234 |
| 512 | 3300048909 | Ga0496106_0037094 | Ga0496106_0037094_2641_3393 | 234 |
| 513 | 3300048909 | Ga0496106_0287039 | Ga0496106_0287039_391_1143 | 234 |
| 514 | 3300048909 | Ga0496106_0394127 | Ga0496106_0394127_185_937 | 234 |
| 515 | 3300048913 | Ga0496110_0806316 | Ga0496110_0806316_16_768 | 234 |
| 516 | 3300049568 | Ga0501031_0116012 | Ga0501031_0116012_641_1393 | 234 |
| 517 | 3300049569 | Ga0501032_0127389 | Ga0501032_0127389_900_1652 | 234 |
| 518 | 3300049570 | Ga0501033_0020667 | Ga0501033_0020667_2065_2817 | 234 |
| 519 | 3300049570 | Ga0501033_0057423 | Ga0501033_0057423_503_1255 | 234 |
| 520 | 3300049570 | Ga0501033_0252405 | Ga0501033_0252405_132_884 | 234 |
| 521 | 3300049572 | Ga0501036_0053635 | Ga0501036_0053635_2022_2774 | 234 |
| 522 | 3300049574 | Ga0501038_0062853 | Ga0501038_0062853_2329_3081 | 234 |
| 523 | 3300049576 | Ga0501040_0002756 | Ga0501040_0002756_8223_8975 | 234 |
| 524 | 3300049576 | Ga0501040_0030056 | Ga0501040_0030056_1735_2487 | 234 |
| 525 | 3300049576 | Ga0501040_0145261 | Ga0501040_0145261_335_1087 | 234 |
| 526 | 3300049576 | Ga0501040_0252876 | Ga0501040_0252876_381_1124 | 234 |
| 527 | 3300049577 | Ga0501041_0036477 | Ga0501041_0036477_2152_2904 | 234 |
| 528 | 3300049577 | Ga0501041_0052173 | Ga0501041_0052173_1010_1756 | 234 |
| 529 | 3300049577 | Ga0501041_0352247 | Ga0501041_0352247_107_859 | 234 |
| 530 | 3300049578 | Ga0501042_0000598 | Ga0501042_0000598_14071_14823 | 234 |
| 531 | 3300049578 | Ga0501042_0148671 | Ga0501042_0148671_629_1375 | 234 |
| 532 | 3300049579 | Ga0501043_0033816 | Ga0501043_0033816_441_1193 | 234 |
| 533 | 3300049579 | Ga0501043_0122969 | Ga0501043_0122969_636_1388 | 234 |
| 534 | 3300049580 | Ga0501046_0000240 | Ga0501046_0000240_47630_48382 | 234 |
| 535 | 3300049580 | Ga0501046_0055306 | Ga0501046_0055306_1743_2489 | 234 |
| 536 | 3300049580 | Ga0501046_0055808 | Ga0501046_0055808_1550_2302 | 234 |
| 537 | 3300049581 | Ga0501047_0193410 | Ga0501047_0193410_598_1350 | 234 |
| 538 | 3300049582 | Ga0501048_0014851 | Ga0501048_0014851_553_1305 | 234 |
| 539 | 3300049582 | Ga0501048_0146719 | Ga0501048_0146719_97_849 | 234 |
| 540 | 3300049582 | Ga0501048_0215869 | Ga0501048_0215869_212_964 | 234 |
| 541 | 3300049583 | Ga0501067_0269534 | Ga0501067_0269534_18_770 | 234 |
| 542 | 3300049584 | Ga0501068_0307817 | Ga0501068_0307817_78_821 | 234 |
| 543 | 3300049587 | Ga0501071_0029734 | Ga0501071_0029734_1768_2520 | 234 |
| 544 | 3300049587 | Ga0501071_0062699 | Ga0501071_0062699_768_1514 | 234 |
| 545 | 3300049587 | Ga0501071_0282300 | Ga0501071_0282300_308_1060 | 234 |
| 546 | 3300049588 | Ga0501072_0010731 | Ga0501072_0010731_1060_1812 | 234 |
| 547 | 3300049588 | Ga0501072_0011976 | Ga0501072_0011976_3628_4380 | 234 |
| 548 | 3300049588 | Ga0501072_0024925 | Ga0501072_0024925_2139_2882 | 234 |
| 549 | 3300049588 | Ga0501072_0213564 | Ga0501072_0213564_387_1139 | 234 |
| 550 | 3300049589 | Ga0501073_0046661 | Ga0501073_0046661_161_913 | 234 |
| 551 | 3300049589 | Ga0501073_0149774 | Ga0501073_0149774_97_849 | 234 |
| 552 | 3300049590 | Ga0501074_0048490 | Ga0501074_0048490_1884_2636 | 234 |
| 553 | 3300049590 | Ga0501074_0069840 | Ga0501074_0069840_647_1399 | 234 |
| 554 | 3300049591 | Ga0501075_0014499 | Ga0501075_0014499_1581_2327 | 234 |
| 555 | 3300049591 | Ga0501075_0034507 | Ga0501075_0034507_1075_1827 | 234 |
| 556 | 3300049591 | Ga0501075_0074095 | Ga0501075_0074095_1399_2151 | 234 |
| 557 | 3300049591 | Ga0501075_0109511 | Ga0501075_0109511_1049_1792 | 234 |
| 558 | 3300049592 | Ga0501076_0018260 | Ga0501076_0018260_4180_4932 | 234 |
| 559 | 3300049592 | Ga0501076_0021228 | Ga0501076_0021228_1577_2329 | 234 |
| 560 | 3300049592 | Ga0501076_0051267 | Ga0501076_0051267_361_1113 | 234 |
| 561 | 3300049593 | Ga0501077_0012026 | Ga0501077_0012026_3997_4749 | 234 |
| 562 | 3300049593 | Ga0501077_0046909 | Ga0501077_0046909_1074_1826 | 234 |
| 563 | 3300049593 | Ga0501077_0084986 | Ga0501077_0084986_720_1472 | 234 |
| 564 | 3300049593 | Ga0501077_0148829 | Ga0501077_0148829_222_968 | 234 |
| 565 | 3300049593 | Ga0501077_0356827 | Ga0501077_0356827_77_829 | 234 |
| 566 | 3300049741 | Ga0501079_0000962 | Ga0501079_0000962_15118_15870 | 234 |
| 567 | 3300049741 | Ga0501079_0022830 | Ga0501079_0022830_2698_3450 | 234 |
| 568 | 3300049741 | Ga0501079_0028488 | Ga0501079_0028488_2979_3722 | 234 |
| 569 | 3300049741 | Ga0501079_0044843 | Ga0501079_0044843_746_1498 | 234 |
| 570 | 3300049741 | Ga0501079_0115159 | Ga0501079_0115159_446_1198 | 234 |
| 571 | 3300049741 | Ga0501079_0186870 | Ga0501079_0186870_320_1066 | 234 |
| 572 | 3300049742 | Ga0501080_0061308 | Ga0501080_0061308_1384_2136 | 234 |
| 573 | 3300049742 | Ga0501080_0277362 | Ga0501080_0277362_168_914 | 234 |
| 574 | 3300049742 | Ga0501080_0584024 | Ga0501080_0584024_130_882 | 234 |
| 575 | 3300049743 | Ga0501081_0003003 | Ga0501081_0003003_1603_2355 | 234 |
| 576 | 3300049743 | Ga0501081_0003043 | Ga0501081_0003043_1076_1828 | 234 |
| 577 | 3300049743 | Ga0501081_0006739 | Ga0501081_0006739_3311_4057 | 234 |
| 578 | 3300049743 | Ga0501081_0018202 | Ga0501081_0018202_3162_3914 | 234 |
| 579 | 3300049744 | Ga0501083_0029430 | Ga0501083_0029430_1892_2644 | 234 |
| 580 | 3300049822 | Ga0501035_0288301 | Ga0501035_0288301_457_1209 | 234 |
| 581 | 3300049824 | Ga0501045_0000542 | Ga0501045_0000542_11812_12564 | 234 |
| 582 | 3300049824 | Ga0501045_0018403 | Ga0501045_0018403_3314_4060 | 234 |
| 583 | 3300049824 | Ga0501045_0026245 | Ga0501045_0026245_1854_2606 | 234 |
| 584 | 3300049824 | Ga0501045_0489812 | Ga0501045_0489812_20_772 | 234 |
| 585 | 3300050507 | nmdc:mga05p37_10296_c1 | nmdc:mga05p37_10296_c1_2886_3638 | 234 |
| 586 | 3300050507 | nmdc:mga05p37_10313_c1 | nmdc:mga05p37_10313_c1_5686_6438 | 234 |
| 587 | 3300050507 | nmdc:mga05p37_111793_c1 | nmdc:mga05p37_111793_c1_1047_1799 | 234 |
| 588 | 3300050507 | nmdc:mga05p37_11771_c1 | nmdc:mga05p37_11771_c1_8576_9328 | 234 |
| 589 | 3300050507 | nmdc:mga05p37_1188_c1 | nmdc:mga05p37_1188_c1_23152_23904 | 234 |
| 590 | 3300050507 | nmdc:mga05p37_212_c1 | nmdc:mga05p37_212_c1_53688_54440 | 234 |
| 591 | 3300050507 | nmdc:mga05p37_270065_c1 | nmdc:mga05p37_270065_c1_1248_2000 | 234 |
| 592 | 3300050507 | nmdc:mga05p37_335410_c1 | nmdc:mga05p37_335410_c1_243_995 | 234 |
| 593 | 3300050507 | nmdc:mga05p37_41471_c1 | nmdc:mga05p37_41471_c1_1371_2123 | 234 |
| 594 | 3300050507 | nmdc:mga05p37_7876_c1 | nmdc:mga05p37_7876_c1_6975_7718 | 234 |
| 595 | 3300050508 | nmdc:mga09592_11174_c1 | nmdc:mga09592_11174_c1_3774_4526 | 234 |
| 596 | 3300050508 | nmdc:mga09592_134764_c1 | nmdc:mga09592_134764_c1_1292_2044 | 234 |
| 597 | 3300050508 | nmdc:mga09592_265_c1 | nmdc:mga09592_265_c1_26866_27618 | 234 |
| 598 | 3300050508 | nmdc:mga09592_32798_c1 | nmdc:mga09592_32798_c1_3010_3762 | 234 |
| 599 | 3300050508 | nmdc:mga09592_38645_c1 | nmdc:mga09592_38645_c1_751_1503 | 234 |
| 600 | 3300050508 | nmdc:mga09592_3999_c1 | nmdc:mga09592_3999_c1_8055_8807 | 234 |
| 601 | 3300050508 | nmdc:mga09592_413686_c1 | nmdc:mga09592_413686_c1_298_1050 | 234 |
| 602 | 3300050508 | nmdc:mga09592_7616_c1 | nmdc:mga09592_7616_c1_1783_2535 | 234 |
| 603 | 3300050508 | nmdc:mga09592_92363_c1 | nmdc:mga09592_92363_c1_494_1246 | 234 |
| 604 | 3300050508 | nmdc:mga09592_992_c1 | nmdc:mga09592_992_c1_8647_9399 | 234 |
| 605 | 3300050509 | nmdc:mga0qj67_162838_c1 | nmdc:mga0qj67_162838_c1_445_1197 | 234 |
| 606 | 3300050509 | nmdc:mga0qj67_2490_c1 | nmdc:mga0qj67_2490_c1_1144_1896 | 234 |
| 607 | 3300050509 | nmdc:mga0qj67_6600_c1 | nmdc:mga0qj67_6600_c1_5741_6493 | 234 |
| 608 | 3300050510 | nmdc:mga06r32_100340_c1 | nmdc:mga06r32_100340_c1_1432_2184 | 234 |
| 609 | 3300050510 | nmdc:mga06r32_102516_c1 | nmdc:mga06r32_102516_c1_1442_2194 | 234 |
| 610 | 3300050510 | nmdc:mga06r32_179862_c1 | nmdc:mga06r32_179862_c1_1094_1846 | 234 |
| 611 | 3300050510 | nmdc:mga06r32_1850_c1 | nmdc:mga06r32_1850_c1_1654_2397 | 234 |
| 612 | 3300050510 | nmdc:mga06r32_2420_c1 | nmdc:mga06r32_2420_c1_433_1185 | 234 |
| 613 | 3300050510 | nmdc:mga06r32_26143_c1 | nmdc:mga06r32_26143_c1_2961_3713 | 234 |
| 614 | 3300050510 | nmdc:mga06r32_30435_c1 | nmdc:mga06r32_30435_c1_1154_1906 | 234 |
| 615 | 3300050510 | nmdc:mga06r32_455607_c1 | nmdc:mga06r32_455607_c1_396_1139 | 234 |
| 616 | 3300050510 | nmdc:mga06r32_52930_c1 | nmdc:mga06r32_52930_c1_414_1166 | 234 |
| 617 | 3300050510 | nmdc:mga06r32_63311_c1 | nmdc:mga06r32_63311_c1_355_1107 | 234 |
| 618 | 3300050510 | nmdc:mga06r32_749782_c1 | nmdc:mga06r32_749782_c1_32_784 | 234 |
| 619 | 3300050510 | nmdc:mga06r32_886_c1 | nmdc:mga06r32_886_c1_14200_14952 | 234 |
| 620 | 3300050511 | nmdc:mga08y16_350387_c1 | nmdc:mga08y16_350387_c1_274_1017 | 234 |
| 621 | 3300050511 | nmdc:mga08y16_5536_c1 | nmdc:mga08y16_5536_c1_8791_9543 | 234 |
| 622 | 3300050511 | nmdc:mga08y16_6014_c1 | nmdc:mga08y16_6014_c1_3643_4386 | 234 |
| 623 | 3300050512 | nmdc:mga0n895_10268_c1 | nmdc:mga0n895_10268_c1_6775_7527 | 234 |
| 624 | 3300050512 | nmdc:mga0n895_139945_c1 | nmdc:mga0n895_139945_c1_165_908 | 234 |
| 625 | 3300050512 | nmdc:mga0n895_24612_c1 | nmdc:mga0n895_24612_c1_1686_2438 | 234 |
| 626 | 3300050512 | nmdc:mga0n895_286848_c1 | nmdc:mga0n895_286848_c1_549_1292 | 234 |
| 627 | 3300050512 | nmdc:mga0n895_3081_c1 | nmdc:mga0n895_3081_c1_5546_6289 | 234 |
| 628 | 3300050512 | nmdc:mga0n895_33586_c1 | nmdc:mga0n895_33586_c1_1065_1817 | 234 |
| 629 | 3300050512 | nmdc:mga0n895_353404_c1 | nmdc:mga0n895_353404_c1_439_1191 | 234 |
| 630 | 3300050512 | nmdc:mga0n895_35372_c1 | nmdc:mga0n895_35372_c1_1037_1789 | 234 |
| 631 | 3300050512 | nmdc:mga0n895_42945_c1 | nmdc:mga0n895_42945_c1_2561_3313 | 234 |
| 632 | 3300050512 | nmdc:mga0n895_459722_c1 | nmdc:mga0n895_459722_c1_454_1206 | 234 |
| 633 | 3300050513 | nmdc:mga0rr50_1061_c1 | nmdc:mga0rr50_1061_c1_12307_13059 | 234 |
| 634 | 3300050513 | nmdc:mga0rr50_153051_c1 | nmdc:mga0rr50_153051_c1_237_989 | 234 |
| 635 | 3300050513 | nmdc:mga0rr50_168928_c1 | nmdc:mga0rr50_168928_c1_31_783 | 234 |
| 636 | 3300050513 | nmdc:mga0rr50_2266_c1 | nmdc:mga0rr50_2266_c1_5106_5849 | 234 |
| 637 | 3300050513 | nmdc:mga0rr50_401764_c1 | nmdc:mga0rr50_401764_c1_212_964 | 234 |
| 638 | 3300050513 | nmdc:mga0rr50_65858_c1 | nmdc:mga0rr50_65858_c1_1065_1817 | 234 |
| 639 | 3300050513 | nmdc:mga0rr50_7012_c1 | nmdc:mga0rr50_7012_c1_552_1304 | 234 |
| 640 | 3300050514 | nmdc:mga08x19_116540_c1 | nmdc:mga08x19_116540_c1_404_1156 | 234 |
| 641 | 3300050514 | nmdc:mga08x19_23888_c1 | nmdc:mga08x19_23888_c1_2864_3607 | 234 |
| 642 | 3300050514 | nmdc:mga08x19_361440_c1 | nmdc:mga08x19_361440_c1_18_770 | 234 |
| 643 | 3300050515 | nmdc:mga0a205_1419_c1 | nmdc:mga0a205_1419_c1_2036_2779 | 234 |
| 644 | 3300050515 | nmdc:mga0a205_153847_c1 | nmdc:mga0a205_153847_c1_459_1211 | 234 |
| 645 | 3300050515 | nmdc:mga0a205_15574_c1 | nmdc:mga0a205_15574_c1_3667_4419 | 234 |
| 646 | 3300050515 | nmdc:mga0a205_17378_c1 | nmdc:mga0a205_17378_c1_4028_4780 | 234 |
| 647 | 3300050515 | nmdc:mga0a205_259714_c1 | nmdc:mga0a205_259714_c1_452_1204 | 234 |
| 648 | 3300050515 | nmdc:mga0a205_3138_c2 | nmdc:mga0a205_3138_c2_8330_9082 | 234 |
| 649 | 3300050515 | nmdc:mga0a205_3294_c1 | nmdc:mga0a205_3294_c1_3603_4346 | 234 |
| 650 | 3300050515 | nmdc:mga0a205_353382_c1 | nmdc:mga0a205_353382_c1_483_1235 | 234 |
| 651 | 3300050515 | nmdc:mga0a205_60234_c1 | nmdc:mga0a205_60234_c1_2736_3479 | 234 |
| 652 | 3300050515 | nmdc:mga0a205_669355_c1 | nmdc:mga0a205_669355_c1_95_847 | 234 |
| 653 | 3300050515 | nmdc:mga0a205_69079_c1 | nmdc:mga0a205_69079_c1_33_785 | 234 |
| 654 | 3300050515 | nmdc:mga0a205_7770_c1 | nmdc:mga0a205_7770_c1_8231_8974 | 234 |
| 655 | 3300054114 | Ga0501084_0043575 | Ga0501084_0043575_1820_2572 | 234 |
| 656 | 3300054114 | Ga0501084_0060512 | Ga0501084_0060512_2079_2831 | 234 |
| 657 | 3300054114 | Ga0501084_0109738 | Ga0501084_0109738_980_1726 | 234 |
| 658 | 3300054114 | Ga0501084_0113893 | Ga0501084_0113893_1407_2159 | 234 |
| 659 | 3300059423 | Ga0590074_010689 | Ga0590074_010689_400_1152 | 234 |
| 660 | 3300060353 | Ga0501082_0000590 | Ga0501082_0000590_30934_31686 | 234 |
| 661 | 3300060353 | Ga0501082_0007107 | Ga0501082_0007107_5886_6638 | 234 |
| 662 | 3300060353 | Ga0501082_0010275 | Ga0501082_0010275_5430_6182 | 234 |
| 663 | 3300060353 | Ga0501082_0167219 | Ga0501082_0167219_315_1061 | 234 |
| 664 | 3300060353 | Ga0501082_0253139 | Ga0501082_0253139_16_768 | 234 |
| 665 | 3300061734 | Ga0530510_0232407 | Ga0530510_0232407_293_1045 | 234 |
| 666 | 3300028379 | Ga0268266_10502658 | Ga0268266_105026582 | 235 |
| 667 | 3300049577 | Ga0501041_0111594 | Ga0501041_0111594_58_837 | 235 |
| 668 | 3300049591 | Ga0501075_0045394 | Ga0501075_0045394_193_963 | 235 |
| 669 | 3300049592 | Ga0501076_0296881 | Ga0501076_0296881_505_1275 | 235 |
| 670 | 3300049824 | Ga0501045_0273232 | Ga0501045_0273232_454_1233 | 235 |
| 671 | 3300054114 | Ga0501084_0202675 | Ga0501084_0202675_24_803 | 235 |
| 672 | 3300060353 | Ga0501082_0508353 | Ga0501082_0508353_231_1010 | 235 |
| 673 | 3300005518 | Ga0070699_100150214 | Ga0070699_1001502142 | 236 |
| 674 | 3300009094 | Ga0111539_10059927 | Ga0111539_100599273 | 236 |
| 675 | 3300050507 | nmdc:mga05p37_182465_c1 | nmdc:mga05p37_182465_c1_206_970 | 236 |
| 676 | 3300050508 | nmdc:mga09592_212597_c1 | nmdc:mga09592_212597_c1_725_1489 | 236 |
| 677 | 3300050509 | nmdc:mga0qj67_426286_c1 | nmdc:mga0qj67_426286_c1_169_933 | 236 |
| 678 | 3300061734 | Ga0530510_0523958 | Ga0530510_0523958_62_853 | 236 |
| 679 | 3300031824 | Ga0307413_10002384 | Ga0307413_100023847 | 237 |
| 680 | 3300031852 | Ga0307410_10215824 | Ga0307410_102158241 | 237 |
| 681 | 3300005467 | Ga0070706_100389021 | Ga0070706_1003890212 | 238 |
| 682 | 3300013308 | Ga0157375_11082745 | Ga0157375_110827452 | 239 |
| 683 | 3300025938 | Ga0207704_10178895 | Ga0207704_101788952 | 239 |
| 684 | 3300026121 | Ga0207683_10382711 | Ga0207683_103827112 | 239 |
| 685 | 3300031548 | Ga0307408_100003915 | Ga0307408_1000039155 | 239 |
| 686 | 3300031548 | Ga0307408_100246087 | Ga0307408_1002460872 | 239 |
| 687 | 3300031731 | Ga0307405_10031571 | Ga0307405_100315712 | 239 |
| 688 | 3300031903 | Ga0307407_10370626 | Ga0307407_103706261 | 239 |
| 689 | 3300031911 | Ga0307412_10013219 | Ga0307412_100132192 | 239 |
| 690 | 3300031911 | Ga0307412_10404405 | Ga0307412_104044051 | 239 |
| 691 | 3300031995 | Ga0307409_100271350 | Ga0307409_1002713502 | 239 |
| 692 | 3300032002 | Ga0307416_100014018 | Ga0307416_1000140185 | 239 |
| 693 | 3300032005 | Ga0307411_10120923 | Ga0307411_101209231 | 239 |
| 694 | 3300048908 | Ga0496105_0061652 | Ga0496105_0061652_432_1181 | 239 |
| 695 | 3300048911 | Ga0496108_0022804 | Ga0496108_0022804_4161_4910 | 239 |
| 696 | 3300048913 | Ga0496110_0018494 | Ga0496110_0018494_4976_5725 | 239 |
| 697 | 3300048914 | Ga0496111_0262286 | Ga0496111_0262286_361_1110 | 239 |
| 698 | 3300048917 | Ga0496114_0012272 | Ga0496114_0012272_1356_2105 | 239 |
| 699 | 3300002067 | JGI24735J21928_10012005 | JGI24735J21928_100120052 | 241 |
| 700 | 3300005563 | Ga0068855_100262322 | Ga0068855_1002623222 | 241 |
| 701 | 3300009545 | Ga0105237_10004996 | Ga0105237_100049963 | 241 |
| 702 | 3300010375 | Ga0105239_10002552 | Ga0105239_1000255214 | 241 |
| 703 | 3300025914 | Ga0207671_10002849 | Ga0207671_1000284910 | 241 |
| 704 | 3300025949 | Ga0207667_10724203 | Ga0207667_107242031 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uzm-assembly1.cif.gz_A-2 | maba from mycobacterium tuberculosis | 0.9425 | 8 | 238 |
| 3u09-assembly1.cif.gz_A | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae | 0.9397 | 6 | 238 |
| 3tzq-assembly1.cif.gz_C | crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum | 0.9364 | 5 | 241 |
| 4nbw-assembly1.cif.gz_D | crystal structure of fabg from plesiocystis pacifica | 0.9362 | 6 | 237 |
| 4rzi-assembly1.cif.gz_B | crystal structure of phab from synechocystis sp. pcc 6803 | 0.9335 | 6 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h5xG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9423 | 6 | 241 | 3.40.50.720 |
| 3tzqC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9364 | 5 | 237 | 3.40.50.720 |
| 4nbwD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9362 | 6 | 237 | 3.40.50.720 |
| 2ntnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9338 | 8 | 238 | 3.40.50.720 |
| 4rziB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9335 | 6 | 238 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3V2G6-F1-model_v4 | deleted | 0.9633 | 147 | 241 |
|
| AF-X1F0L5-F1-model_v4 | SDR family oxidoreductase | 0.9594 | 156 | 241 |
GO:0016616
|
| AF-R7HG36-F1-model_v4 | Short-chain dehydrogenase/reductase family protein | 0.9471 | 6 | 241 |
GO:0016491
|
| AF-C7Q7G2-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9454 | 6 | 241 |
GO:0016491
|
| AF-S9SQ61-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.944 | 92 | 238 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar