F476385

General Info

Members Datasets Scaffolds Average Seq Length
704 258 704 243

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0523958|Ga0530510_0523958_62_853
Length 263
Sequence MTPPGRRRVDGKVALISGGARGQGASHGRLLAEHGARVVLGDILDGPGADTAGWLRQEGLEVRYVHLDVTRPEDWDAAVAVAEQSYGKLDVLVNNAGITGSASIVDCPLEEWQSVVAVNQTGVFLGIQRAVPALRRAGGGSIINVASVVATLGTESMIAYQASKAAVHQLTRAAAVTLAPDIRVNTVTPGIVTGTAMAAGLDPAWLEARLAVYPMGRGARVEEVSHAVLFLASDESSFTTGADLRVDGGALAGVKRRRFRADP

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.41
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10012005 3300002067 Bacteria 2741
2 JGI26129J50193_1003564 3300003349 Bacteria 1094
3 JGI25407J50210_10033392 3300003373 Bacteria 1328
4 JGI26141J51220_1001422 3300003503 Bacteria 1447
5 Ga0065704_10314564 3300005289 Bacteria 863
6 Ga0065715_10369058 3300005293 Bacteria 924
7 Ga0070676_10001508 3300005328 Bacteria 11783
8 Ga0070683_100040464 3300005329 Bacteria 4286
9 Ga0070690_100118531 3300005330 Bacteria 1774
10 Ga0070690_100227937 3300005330 Bacteria 1309
11 Ga0070690_100516391 3300005330 Bacteria 896
12 Ga0070670_100005711 3300005331 Bacteria 10515
13 Ga0068869_100001826 3300005334 Bacteria 12787
14 Ga0068869_100002053 3300005334 Bacteria 12100
15 Ga0070680_100011525 3300005336 Bacteria 6841
16 Ga0070680_100029669 3300005336 Bacteria 4392
17 Ga0070680_100034957 3300005336 Bacteria 4055
18 Ga0070680_100346515 3300005336 Bacteria 1263
19 Ga0070682_100010168 3300005337 Bacteria 5335
20 Ga0068868_100186906 3300005338 Bacteria 1722
21 Ga0070660_100006407 3300005339 Bacteria 8158
22 Ga0070689_100086275 3300005340 Bacteria 2469
23 Ga0070691_10001908 3300005341 Bacteria 9140
24 Ga0070691_10004132 3300005341 Bacteria 6593
25 Ga0070691_10023591 3300005341 Bacteria 2857
26 Ga0070661_100004542 3300005344 Bacteria 9551
27 Ga0070692_10096760 3300005345 Bacteria 1613
28 Ga0070668_100158679 3300005347 Bacteria 1834
29 Ga0070669_100009553 3300005353 Bacteria 6906
30 Ga0070669_100383192 3300005353 Bacteria 1147
31 Ga0070675_100096848 3300005354 Bacteria 2479
32 Ga0070659_100000322 3300005366 Bacteria 36690
33 Ga0070703_10000793 3300005406 Bacteria 10349
34 Ga0070703_10005280 3300005406 Bacteria 3610
35 Ga0070709_10045578 3300005434 Bacteria 2722
36 Ga0070701_10055062 3300005438 Bacteria 2076
37 Ga0070711_100462505 3300005439 Bacteria 1040
38 Ga0070705_100002220 3300005440 Bacteria 9870
39 Ga0070705_100019189 3300005440 Bacteria 3596
40 Ga0070705_100048811 3300005440 Bacteria 2454
41 Ga0070705_100068779 3300005440 Bacteria 2133
42 Ga0070700_100019386 3300005441 Bacteria 3925
43 Ga0070700_100054686 3300005441 Bacteria 2495
44 Ga0070694_100000296 3300005444 Bacteria 26721
45 Ga0070694_100000326 3300005444 Bacteria 25614
46 Ga0070694_100020927 3300005444 Bacteria 4175
47 Ga0070694_100054799 3300005444 Bacteria 2702
48 Ga0070694_100145888 3300005444 Bacteria 1723
49 Ga0070694_100468245 3300005444 Bacteria 998
50 Ga0070708_100011197 3300005445 Bacteria 7295
51 Ga0070708_100015611 3300005445 Bacteria 6276
52 Ga0070708_100028675 3300005445 Bacteria 4793
53 Ga0070708_100032014 3300005445 Bacteria 4557
54 Ga0070708_100069682 3300005445 Bacteria 3163
55 Ga0070708_100129176 3300005445 Bacteria 2338
56 Ga0070708_100132915 3300005445 Bacteria 2304
57 Ga0070708_100385405 3300005445 Bacteria 1322
58 Ga0070663_100011713 3300005455 Bacteria 5518
59 Ga0070662_100002852 3300005457 Bacteria 10713
60 Ga0070662_100125151 3300005457 Bacteria 1975
61 Ga0070662_100411032 3300005457 Bacteria 1118
62 Ga0070662_100510981 3300005457 Bacteria 1003
63 Ga0070681_10003875 3300005458 Bacteria 14078
64 Ga0068867_100028261 3300005459 Bacteria 4037
65 Ga0070706_100023384 3300005467 Bacteria 5691
66 Ga0070706_100037683 3300005467 Bacteria 4464
67 Ga0070706_100048189 3300005467 Bacteria 3933
68 Ga0070706_100389021 3300005467 Bacteria 1298
69 Ga0070706_100574269 3300005467 Bacteria 1048
70 Ga0070707_100001990 3300005468 Bacteria 19558
71 Ga0070707_100015361 3300005468 Bacteria 7184
72 Ga0070707_100061601 3300005468 Bacteria 3599
73 Ga0070707_100114959 3300005468 Bacteria 2611
74 Ga0070707_100141390 3300005468 Bacteria 2342
75 Ga0070707_100264879 3300005468 Bacteria 1672
76 Ga0070707_100302553 3300005468 Bacteria 1554
77 Ga0070707_100401665 3300005468 Bacteria 1330
78 Ga0070707_100519354 3300005468 Bacteria 1153
79 Ga0070698_100011688 3300005471 Bacteria 9312
80 Ga0070698_100039746 3300005471 Bacteria 4839
81 Ga0070698_100060267 3300005471 Bacteria 3829
82 Ga0070698_100158187 3300005471 Bacteria 2211
83 Ga0070698_100322269 3300005471 Bacteria 1476
84 Ga0070698_100335321 3300005471 Bacteria 1444
85 Ga0070699_100003494 3300005518 Bacteria 13891
86 Ga0070699_100007127 3300005518 Bacteria 9714
87 Ga0070699_100150214 3300005518 Bacteria 2060
88 Ga0070699_100191765 3300005518 Bacteria 1816
89 Ga0070699_100248325 3300005518 Bacteria 1589
90 Ga0070699_100285229 3300005518 Bacteria 1479
91 Ga0070679_100011577 3300005530 Bacteria 8405
92 Ga0070684_100033110 3300005535 Bacteria 4410
93 Ga0070697_100006412 3300005536 Bacteria 9108
94 Ga0070697_100027540 3300005536 Bacteria 4548
95 Ga0070697_100044734 3300005536 Bacteria 3586
96 Ga0070697_100048855 3300005536 Bacteria 3431
97 Ga0070697_100050530 3300005536 Bacteria 3375
98 Ga0070697_100056999 3300005536 Bacteria 3179
99 Ga0070697_100276740 3300005536 Bacteria 1439
100 Ga0070697_100351576 3300005536 Bacteria 1273
101 Ga0068853_100000518 3300005539 Bacteria 26167
102 Ga0070672_100014519 3300005543 Bacteria 5585
103 Ga0070672_100027044 3300005543 Bacteria 4276
104 Ga0070695_100002363 3300005545 Bacteria 10833
105 Ga0070695_100005039 3300005545 Bacteria 7784
106 Ga0070695_100010470 3300005545 Bacteria 5537
107 Ga0070695_100017187 3300005545 Bacteria 4386
108 Ga0070696_100023696 3300005546 Bacteria 4173
109 Ga0070696_100081933 3300005546 Bacteria 2287
110 Ga0070696_100083494 3300005546 Bacteria 2266
111 Ga0070696_100108877 3300005546 Bacteria 1993
112 Ga0070696_100109916 3300005546 Bacteria 1984
113 Ga0070696_100284506 3300005546 Bacteria 1262
114 Ga0070693_100001092 3300005547 Bacteria 12169
115 Ga0070693_100053471 3300005547 Bacteria 2319
116 Ga0070704_100013935 3300005549 Bacteria 5008
117 Ga0070704_100035814 3300005549 Bacteria 3377
118 Ga0070704_100047033 3300005549 Bacteria 3013
119 Ga0070704_100117534 3300005549 Bacteria 2035
120 Ga0070704_100169678 3300005549 Bacteria 1734
121 Ga0068855_100008473 3300005563 Bacteria 12431
122 Ga0068855_100262322 3300005563 Bacteria 1924
123 Ga0070664_100023335 3300005564 Bacteria 5109
124 Ga0068857_100005198 3300005577 Bacteria 11076
125 Ga0068857_100094490 3300005577 Bacteria 2678
126 Ga0068857_100307625 3300005577 Bacteria 1462
127 Ga0068854_100002526 3300005578 Bacteria 11320
128 Ga0068856_100019528 3300005614 Bacteria 6578
129 Ga0070702_100065431 3300005615 Bacteria 2129
130 Ga0068852_100024867 3300005616 Bacteria 4845
131 Ga0068859_100000976 3300005617 Bacteria 29307
132 Ga0068859_100211864 3300005617 Bacteria 2024
133 Ga0068864_100001266 3300005618 Bacteria 20986
134 Ga0068870_10000987 3300005840 Bacteria 11236
135 Ga0068863_100056203 3300005841 Bacteria 3727
136 Ga0068858_100036781 3300005842 Bacteria 4540
137 Ga0068860_100016087 3300005843 Bacteria 7298
138 Ga0068860_100052318 3300005843 Bacteria 3885
139 Ga0068860_100144646 3300005843 Bacteria 2287
140 Ga0068860_100499276 3300005843 Bacteria 1214
141 Ga0068862_100001929 3300005844 Bacteria 18827
142 Ga0068862_100092664 3300005844 Bacteria 2634
143 Ga0068862_100532795 3300005844 Bacteria 1119
144 Ga0081455_10015861 3300005937 Bacteria 7295
145 Ga0081538_10028407 3300005981 Bacteria 3847
146 Ga0081540_1017503 3300005983 Bacteria 4434
147 Ga0081540_1103207 3300005983 Bacteria 1223
148 Ga0081539_10000044 3300005985 Bacteria 284021
149 Ga0070712_100003253 3300006175 Bacteria 10001
150 Ga0075428_100000409 3300006844 Bacteria 42695
151 Ga0075428_100004007 3300006844 Bacteria 16168
152 Ga0075428_100010083 3300006844 Bacteria 10496
153 Ga0075428_100012600 3300006844 Bacteria 9401
154 Ga0075428_100071289 3300006844 Bacteria 3798
155 Ga0075428_100093499 3300006844 Bacteria 3278
156 Ga0075428_100148280 3300006844 Bacteria 2549
157 Ga0075428_100721192 3300006844 Bacteria 1062
158 Ga0075428_100843780 3300006844 Bacteria 973
159 Ga0075430_100000648 3300006846 Bacteria 26549
160 Ga0075430_100002276 3300006846 Bacteria 15900
161 Ga0075430_100006658 3300006846 Bacteria 9745
162 Ga0075430_100041160 3300006846 Bacteria 3909
163 Ga0075430_100059632 3300006846 Bacteria 3208
164 Ga0075430_100420480 3300006846 Bacteria 1103
165 Ga0075431_100000181 3300006847 Bacteria 45325
166 Ga0075431_100001052 3300006847 Bacteria 24662
167 Ga0075431_100003068 3300006847 Bacteria 16176
168 Ga0075431_100003078 3300006847 Bacteria 16159
169 Ga0075431_100009651 3300006847 Bacteria 9695
170 Ga0075431_100080627 3300006847 Bacteria 3360
171 Ga0075431_100093628 3300006847 Bacteria 3101
172 Ga0075431_100203116 3300006847 Bacteria 2027
173 Ga0075431_100311893 3300006847 Bacteria 1588
174 Ga0075431_100473263 3300006847 Bacteria 1246
175 Ga0075433_10001470 3300006852 Bacteria 17385
176 Ga0075433_10002688 3300006852 Bacteria 13580
177 Ga0075433_10017885 3300006852 Bacteria 5880
178 Ga0075433_10025926 3300006852 Bacteria 4958
179 Ga0075433_10067634 3300006852 Bacteria 3136
180 Ga0075433_10073771 3300006852 Bacteria 3002
181 Ga0075433_10100906 3300006852 Bacteria 2555
182 Ga0075433_10221264 3300006852 Bacteria 1681
183 Ga0075433_10229189 3300006852 Bacteria 1650
184 Ga0075434_100006184 3300006871 Bacteria 10962
185 Ga0075434_100010856 3300006871 Bacteria 8561
186 Ga0075434_100037121 3300006871 Bacteria 4823
187 Ga0075434_100045687 3300006871 Bacteria 4345
188 Ga0075434_100078686 3300006871 Bacteria 3293
189 Ga0075434_100122319 3300006871 Bacteria 2618
190 Ga0075434_100125335 3300006871 Bacteria 2586
191 Ga0075434_100134302 3300006871 Bacteria 2494
192 Ga0075434_100213306 3300006871 Bacteria 1951
193 Ga0075434_100640345 3300006871 Bacteria 1081
194 Ga0075429_100000116 3300006880 Bacteria 45959
195 Ga0075429_100006906 3300006880 Bacteria 9860
196 Ga0075429_100009267 3300006880 Bacteria 8546
197 Ga0075429_100010439 3300006880 Bacteria 8035
198 Ga0075429_100010600 3300006880 Bacteria 7975
199 Ga0075429_100011279 3300006880 Bacteria 7736
200 Ga0075429_100042925 3300006880 Bacteria 3934
201 Ga0075429_100100746 3300006880 Bacteria 2522
202 Ga0075429_100141934 3300006880 Bacteria 2103
203 Ga0075429_100430711 3300006880 Bacteria 1155
204 Ga0068865_100098520 3300006881 Bacteria 2136
205 Ga0068865_100100352 3300006881 Bacteria 2118
206 Ga0075436_100027597 3300006914 Bacteria 3907
207 Ga0075436_100035510 3300006914 Bacteria 3438
208 Ga0075436_100179959 3300006914 Bacteria 1494
209 Ga0097620_100000976 3300006931 Bacteria 29307
210 Ga0097620_100211860 3300006931 Bacteria 2024
211 Ga0075435_100005723 3300007076 Bacteria 8716
212 Ga0075435_100006422 3300007076 Bacteria 8311
213 Ga0075435_100010888 3300007076 Bacteria 6663
214 Ga0075435_100042844 3300007076 Bacteria 3622
215 Ga0075435_100160144 3300007076 Bacteria 1895
216 Ga0075435_100400418 3300007076 Bacteria 1180
217 Ga0099794_10045714 3300007265 Bacteria 2095
218 Ga0111539_10001546 3300009094 Bacteria 30637
219 Ga0111539_10016844 3300009094 Bacteria 9052
220 Ga0111539_10029142 3300009094 Bacteria 6729
221 Ga0111539_10059927 3300009094 Bacteria 4512
222 Ga0111539_10086840 3300009094 Bacteria 3675
223 Ga0105245_10061624 3300009098 Bacteria 3382
224 Ga0114129_10001191 3300009147 Bacteria 34529
225 Ga0114129_10012024 3300009147 Bacteria 12313
226 Ga0114129_10012777 3300009147 Bacteria 11952
227 Ga0114129_10016389 3300009147 Bacteria 10548
228 Ga0114129_10017340 3300009147 Bacteria 10251
229 Ga0114129_10022174 3300009147 Bacteria 9015
230 Ga0114129_10036794 3300009147 Bacteria 6911
231 Ga0114129_10073027 3300009147 Bacteria 4780
232 Ga0114129_10082640 3300009147 Bacteria 4463
233 Ga0114129_10127166 3300009147 Bacteria 3503
234 Ga0114129_10152998 3300009147 Bacteria 3156
235 Ga0114129_10244822 3300009147 Bacteria 2409
236 Ga0114129_10285463 3300009147 Bacteria 2204
237 Ga0114129_10294037 3300009147 Bacteria 2167
238 Ga0114129_10321737 3300009147 Bacteria 2056
239 Ga0114129_10363333 3300009147 Bacteria 1915
240 Ga0114129_10831422 3300009147 Bacteria 1176
241 Ga0114129_11337027 3300009147 Bacteria 887
242 Ga0105243_10036440 3300009148 Bacteria 3819
243 Ga0105243_10153032 3300009148 Bacteria 1981
244 Ga0105243_10155987 3300009148 Bacteria 1963
245 Ga0105243_10301713 3300009148 Bacteria 1452
246 Ga0105241_10000602 3300009174 Bacteria 27099
247 Ga0105241_10081082 3300009174 Bacteria 2541
248 Ga0105241_10351278 3300009174 Bacteria 1280
249 Ga0105242_10002560 3300009176 Bacteria 14248
250 Ga0105242_10312952 3300009176 Bacteria 1437
251 Ga0105237_10004996 3300009545 Bacteria 15108
252 Ga0105238_10981169 3300009551 Bacteria 865
253 Ga0105249_10022216 3300009553 Bacteria 5682
254 Ga0105249_10101361 3300009553 Bacteria 2708
255 Ga0105239_10002552 3300010375 Bacteria 23093
256 Ga0105239_10255784 3300010375 Bacteria 1967
257 Ga0105246_10031031 3300011119 Bacteria 3534
258 Ga0157373_10001523 3300013100 Bacteria 17668
259 Ga0157373_10280657 3300013100 Bacteria 1180
260 Ga0157369_10003919 3300013105 Bacteria 17649
261 Ga0157378_10103497 3300013297 Bacteria 2601
262 Ga0157378_10260932 3300013297 Bacteria 1662
263 Ga0157378_10438618 3300013297 Bacteria 1294
264 Ga0163162_10628566 3300013306 Bacteria 1198
265 Ga0163162_10669834 3300013306 Bacteria 1161
266 Ga0157372_10000415 3300013307 Bacteria 46758
267 Ga0157375_10024425 3300013308 Bacteria 5594
268 Ga0157375_10715082 3300013308 Bacteria 1155
269 Ga0157375_10982318 3300013308 Bacteria 985
270 Ga0157375_11082745 3300013308 Bacteria 938
271 Ga0163163_10075053 3300014325 Bacteria 3374
272 Ga0157380_10175728 3300014326 Bacteria 1876
273 Ga0157380_10680290 3300014326 Bacteria 1031
274 Ga0182008_10038272 3300014497 Bacteria 2398
275 Ga0207653_10001986 3300025885 Bacteria 6535
276 Ga0207653_10004275 3300025885 Bacteria 4487
277 Ga0207653_10017569 3300025885 Bacteria 2252
278 Ga0207688_10022050 3300025901 Bacteria 3484
279 Ga0207645_10000389 3300025907 Bacteria 36227
280 Ga0207643_10000290 3300025908 Bacteria 35007
281 Ga0207684_10000673 3300025910 Bacteria 40594
282 Ga0207684_10004725 3300025910 Bacteria 12775
283 Ga0207684_10007696 3300025910 Bacteria 9658
284 Ga0207684_10013914 3300025910 Bacteria 6950
285 Ga0207684_10019842 3300025910 Bacteria 5747
286 Ga0207684_10024244 3300025910 Bacteria 5174
287 Ga0207684_10049409 3300025910 Bacteria 3568
288 Ga0207654_10005545 3300025911 Bacteria 6384
289 Ga0207654_10018200 3300025911 Bacteria 3683
290 Ga0207707_10000158 3300025912 Bacteria 71112
291 Ga0207671_10002849 3300025914 Bacteria 17948
292 Ga0207693_10004038 3300025915 Bacteria 12474
293 Ga0207693_10164148 3300025915 Bacteria 1748
294 Ga0207663_10563445 3300025916 Bacteria 892
295 Ga0207660_10000987 3300025917 Bacteria 18878
296 Ga0207660_10063986 3300025917 Bacteria 2654
297 Ga0207660_10170079 3300025917 Bacteria 1686
298 Ga0207660_10668382 3300025917 Bacteria 847
299 Ga0207657_10000426 3300025919 Bacteria 44789
300 Ga0207649_10002448 3300025920 Bacteria 10393
301 Ga0207652_10000290 3300025921 Bacteria 52056
302 Ga0207646_10003019 3300025922 Bacteria 19387
303 Ga0207646_10004413 3300025922 Bacteria 15300
304 Ga0207646_10094726 3300025922 Bacteria 2674
305 Ga0207646_10116178 3300025922 Bacteria 2403
306 Ga0207646_10194980 3300025922 Bacteria 1829
307 Ga0207646_10202571 3300025922 Bacteria 1793
308 Ga0207646_10422670 3300025922 Bacteria 1203
309 Ga0207646_10476044 3300025922 Bacteria 1126
310 Ga0207646_10484674 3300025922 Bacteria 1115
311 Ga0207681_10016844 3300025923 Bacteria 4582
312 Ga0207681_10351511 3300025923 Bacteria 1180
313 Ga0207650_10256121 3300025925 Bacteria 1418
314 Ga0207659_10025333 3300025926 Bacteria 3985
315 Ga0207687_10035250 3300025927 Bacteria 3402
316 Ga0207690_10002346 3300025932 Bacteria 11492
317 Ga0207706_10003426 3300025933 Bacteria 15142
318 Ga0207686_10015702 3300025934 Bacteria 4239
319 Ga0207709_10014362 3300025935 Bacteria 4372
320 Ga0207709_10032319 3300025935 Bacteria 3063
321 Ga0207709_10059847 3300025935 Bacteria 2372
322 Ga0207709_10072769 3300025935 Bacteria 2187
323 Ga0207709_10184559 3300025935 Bacteria 1476
324 Ga0207670_10111422 3300025936 Bacteria 1973
325 Ga0207670_10118886 3300025936 Bacteria 1917
326 Ga0207704_10106592 3300025938 Bacteria 1883
327 Ga0207704_10178895 3300025938 Bacteria 1531
328 Ga0207665_10003465 3300025939 Bacteria 10536
329 Ga0207691_10076908 3300025940 Bacteria 3008
330 Ga0207691_10086362 3300025940 Bacteria 2815
331 Ga0207691_10356739 3300025940 Bacteria 1250
332 Ga0207689_10000277 3300025942 Bacteria 46512
333 Ga0207689_10002344 3300025942 Bacteria 17708
334 Ga0207689_10052447 3300025942 Bacteria 3361
335 Ga0207679_10000773 3300025945 Bacteria 20945
336 Ga0207667_10003179 3300025949 Bacteria 20318
337 Ga0207667_10724203 3300025949 Bacteria 996
338 Ga0207712_10077000 3300025961 Bacteria 2416
339 Ga0207668_10102555 3300025972 Bacteria 2129
340 Ga0207668_10632273 3300025972 Bacteria 935
341 Ga0207640_10001020 3300025981 Bacteria 15483
342 Ga0207677_10082810 3300026023 Bacteria 2307
343 Ga0207703_10041954 3300026035 Bacteria 3668
344 Ga0207703_10449022 3300026035 Bacteria 1204
345 Ga0207639_10001029 3300026041 Bacteria 18951
346 Ga0207678_10022159 3300026067 Bacteria 5567
347 Ga0207708_10004830 3300026075 Bacteria 9930
348 Ga0207708_10061128 3300026075 Bacteria 2876
349 Ga0207702_10003932 3300026078 Bacteria 13357
350 Ga0207648_10042884 3300026089 Bacteria 3973
351 Ga0207648_10046041 3300026089 Bacteria 3825
352 Ga0207648_10123281 3300026089 Bacteria 2279
353 Ga0207676_10033858 3300026095 Bacteria 3864
354 Ga0207674_10001112 3300026116 Bacteria 34904
355 Ga0207674_10324804 3300026116 Bacteria 1488
356 Ga0207675_100003707 3300026118 Bacteria 14882
357 Ga0207683_10382711 3300026121 Bacteria 1293
358 Ga0207698_10409182 3300026142 Bacteria 1299
359 Ga0209969_1005511 3300027360 Bacteria 1777
360 Ga0209967_1013273 3300027364 Bacteria 1168
361 Ga0209981_1003723 3300027378 Bacteria 1984
362 Ga0209996_1000276 3300027395 Bacteria 6449
363 Ga0210000_1005391 3300027462 Bacteria 1854
364 Ga0209995_1000753 3300027471 Bacteria 4972
365 Ga0209968_1002525 3300027526 Bacteria 2761
366 Ga0209999_1001317 3300027543 Bacteria 4256
367 Ga0209982_1002708 3300027552 Bacteria 2493
368 Ga0209983_1000304 3300027665 Bacteria 10254
369 Ga0209983_1019974 3300027665 Bacteria 1395
370 Ga0209588_1021324 3300027671 Bacteria 2034
371 Ga0209588_1029903 3300027671 Bacteria 1739
372 Ga0209588_1036640 3300027671 Bacteria 1579
373 Ga0209971_1000036 3300027682 Bacteria 46401
374 Ga0209966_1000228 3300027695 Bacteria 21579
375 Ga0209998_10000002 3300027717 Bacteria 126355
376 Ga0209974_10012526 3300027876 Bacteria 2835
377 Ga0207428_10000398 3300027907 Bacteria 54142
378 Ga0207428_10000526 3300027907 Bacteria 45700
379 Ga0207428_10069725 3300027907 Bacteria 2764
380 Ga0268266_10502658 3300028379 Bacteria 1158
381 Ga0268265_10011589 3300028380 Bacteria 5962
382 Ga0268265_10024881 3300028380 Bacteria 4242
383 Ga0268264_10032016 3300028381 Bacteria 4314
384 Ga0268264_10045134 3300028381 Bacteria 3659
385 Ga0268264_10086095 3300028381 Bacteria 2699
386 Ga0268264_10210804 3300028381 Bacteria 1783
387 Ga0307408_100003915 3300031548 Bacteria 10148
388 Ga0307408_100101902 3300031548 Bacteria 2189
389 Ga0307408_100246087 3300031548 Bacteria 1472
390 Ga0307405_10031571 3300031731 Bacteria 3120
391 Ga0307413_10002384 3300031824 Bacteria 7629
392 Ga0307410_10215824 3300031852 Bacteria 1473
393 Ga0307407_10370626 3300031903 Bacteria 1019
394 Ga0307412_10013219 3300031911 Bacteria 4832
395 Ga0307412_10074286 3300031911 Bacteria 2329
396 Ga0307412_10404405 3300031911 Bacteria 1112
397 Ga0307409_100271350 3300031995 Bacteria 1562
398 Ga0307409_100361726 3300031995 Bacteria 1373
399 Ga0307409_100556605 3300031995 Bacteria 1127
400 Ga0307409_101296598 3300031995 Bacteria 753
401 Ga0307416_100014018 3300032002 Bacteria 5471
402 Ga0307411_10120923 3300032005 Bacteria 1894
403 Ga0307415_100239906 3300032126 Bacteria 1466
404 Ga0373950_0009574 3300034818 Bacteria 1550
405 Ga0373928_0017528 3300035084 Bacteria 1475
406 Ga0373940_0003877 3300035088 Bacteria 3106
407 Ga0373949_0012139 3300035090 Bacteria 1902
408 Ga0373949_0020438 3300035090 Bacteria 1515
409 Ga0373949_0044645 3300035090 Bacteria 1100
410 Ga0373951_0009267 3300035091 Bacteria 2218
411 Ga0373952_0002583 3300035092 Bacteria 3261
412 Ga0373932_0032119 3300035112 Bacteria 1467
413 Ga0373939_0011216 3300035114 Bacteria 2257
414 Ga0373939_0022929 3300035114 Bacteria 1725
415 Ga0373931_0017773 3300035691 Bacteria 3523
416 Ga0373931_0028538 3300035691 Bacteria 2858
417 Ga0373931_0044914 3300035691 Bacteria 2331
418 Ga0373931_0130007 3300035691 Bacteria 1448
419 Ga0373931_0505477 3300035691 Bacteria 780
420 Ga0395899_0228129 3300037312 Bacteria 1287
421 Ga0395898_0110168 3300037466 Bacteria 2639
422 Ga0395898_0758660 3300037466 Bacteria 911
423 Ga0395901_0085204 3300038443 Bacteria 3303
424 Ga0395901_0695613 3300038443 Bacteria 1015
425 Ga0439443_021858 3300042003 Bacteria 1013
426 Ga0439448_0007726 3300042005 Bacteria 3123
427 Ga0439448_0034698 3300042005 Bacteria 1613
428 Ga0439450_059040 3300042008 Bacteria 924
429 Ga0439455_0036068 3300042012 Bacteria 1250
430 Ga0439458_0031856 3300042157 Bacteria 1258
431 Ga0439435_0074447 3300042436 Bacteria 1010
432 Ga0439435_0096276 3300042436 Bacteria 905
433 Ga0439464_0003187 3300042439 Bacteria 4116
434 Ga0439460_0002670 3300042461 Bacteria 4304
435 Ga0439460_0088913 3300042461 Bacteria 979
436 Ga0451577_0000793 3300042876 Bacteria 47582
437 Ga0451577_0007730 3300042876 Bacteria 10539
438 Ga0451577_0014349 3300042876 Bacteria 7387
439 Ga0451577_0968603 3300042876 Bacteria 765
440 Ga0453683_0005071 3300044673 Bacteria 9240
441 Ga0453683_0009470 3300044673 Bacteria 6500
442 Ga0453683_0039670 3300044673 Bacteria 2959
443 Ga0453683_0278141 3300044673 Bacteria 1069
444 Ga0453684_0031081 3300044712 Bacteria 7519
445 Ga0453684_0130819 3300044712 Bacteria 3011
446 Ga0453684_0530748 3300044712 Bacteria 1299
447 Ga0453684_0694702 3300044712 Bacteria 1106
448 Ga0451576_0005173 3300045051 Bacteria 16502
449 Ga0451576_0032025 3300045051 Bacteria 5603
450 Ga0451576_0033529 3300045051 Bacteria 5458
451 Ga0451576_0049699 3300045051 Bacteria 4401
452 Ga0451576_0053559 3300045051 Bacteria 4226
453 Ga0451576_0114215 3300045051 Bacteria 2811
454 Ga0451576_0264864 3300045051 Bacteria 1796
455 Ga0495603_0084563 3300046455 Bacteria 1858
456 Ga0495580_0016661 3300046472 Bacteria 5514
457 Ga0495580_0193068 3300046472 Bacteria 1404
458 Ga0495584_0071647 3300046491 Bacteria 1742
459 Ga0495584_0072783 3300046491 Bacteria 1727
460 Ga0495642_0011189 3300046528 Bacteria 3442
461 Ga0495633_0181734 3300046558 Bacteria 968
462 Ga0495656_0053380 3300046615 Bacteria 1736
463 Ga0495659_0037935 3300046664 Bacteria 1709
464 Ga0495669_0027414 3300046684 Bacteria 2492
465 Ga0495669_0038401 3300046684 Bacteria 2120
466 Ga0495636_0058445 3300047318 Bacteria 1626
467 Ga0495636_0098583 3300047318 Bacteria 1276
468 Ga0495636_0188675 3300047318 Bacteria 938
469 Ga0496102_0051899 3300048905 Bacteria 3736
470 Ga0496103_0375382 3300048906 Bacteria 914
471 Ga0496104_0253378 3300048907 Bacteria 1673
472 Ga0496105_0061652 3300048908 Bacteria 3095
473 Ga0496106_0037094 3300048909 Bacteria 3646
474 Ga0496106_0287039 3300048909 Bacteria 1319
475 Ga0496106_0394127 3300048909 Bacteria 1113
476 Ga0496106_0514185 3300048909 Bacteria 962
477 Ga0496108_0022804 3300048911 Bacteria 5150
478 Ga0496108_0649067 3300048911 Bacteria 917
479 Ga0496109_0442920 3300048912 Bacteria 1227
480 Ga0496110_0018494 3300048913 Bacteria 5843
481 Ga0496110_0806316 3300048913 Bacteria 843
482 Ga0496111_0262286 3300048914 Bacteria 1282
483 Ga0496112_0064810 3300048915 Bacteria 3606
484 Ga0496113_0295158 3300048916 Bacteria 1297
485 Ga0496114_0012272 3300048917 Bacteria 6857
486 Ga0501031_0116012 3300049568 Bacteria 1749
487 Ga0501031_0243676 3300049568 Bacteria 1168
488 Ga0501032_0127389 3300049569 Bacteria 1681
489 Ga0501033_0020667 3300049570 Bacteria 4974
490 Ga0501033_0057423 3300049570 Bacteria 2877
491 Ga0501033_0252405 3300049570 Bacteria 1250
492 Ga0501036_0053635 3300049572 Bacteria 3414
493 Ga0501036_0344199 3300049572 Bacteria 1245
494 Ga0501038_0062853 3300049574 Bacteria 3171
495 Ga0501039_0005533 3300049575 Bacteria 9562
496 Ga0501039_0357622 3300049575 Bacteria 1147
497 Ga0501039_0466292 3300049575 Bacteria 992
498 Ga0501039_0636721 3300049575 Bacteria 835
499 Ga0501040_0002756 3300049576 Bacteria 11323
500 Ga0501040_0030056 3300049576 Bacteria 3668
501 Ga0501040_0087287 3300049576 Bacteria 2166
502 Ga0501040_0145261 3300049576 Bacteria 1672
503 Ga0501040_0252876 3300049576 Bacteria 1257
504 Ga0501041_0036477 3300049577 Bacteria 2978
505 Ga0501041_0052173 3300049577 Bacteria 2493
506 Ga0501041_0080929 3300049577 Bacteria 2000
507 Ga0501041_0111594 3300049577 Bacteria 1696
508 Ga0501041_0352247 3300049577 Bacteria 930
509 Ga0501042_0000598 3300049578 Bacteria 19220
510 Ga0501042_0065812 3300049578 Bacteria 2590
511 Ga0501042_0148671 3300049578 Bacteria 1689
512 Ga0501042_0279767 3300049578 Bacteria 1205
513 Ga0501042_0358319 3300049578 Bacteria 1055
514 Ga0501043_0033816 3300049579 Bacteria 4023
515 Ga0501043_0122969 3300049579 Bacteria 2035
516 Ga0501046_0000240 3300049580 Bacteria 56302
517 Ga0501046_0055306 3300049580 Bacteria 3120
518 Ga0501046_0055808 3300049580 Bacteria 3102
519 Ga0501046_0093811 3300049580 Bacteria 2307
520 Ga0501046_0142576 3300049580 Bacteria 1812
521 Ga0501046_0576693 3300049580 Bacteria 800
522 Ga0501047_0193410 3300049581 Bacteria 1897
523 Ga0501048_0014851 3300049582 Bacteria 5758
524 Ga0501048_0146719 3300049582 Bacteria 1668
525 Ga0501048_0215869 3300049582 Bacteria 1360
526 Ga0501067_0269534 3300049583 Bacteria 948
527 Ga0501068_0047077 3300049584 Bacteria 2601
528 Ga0501068_0307817 3300049584 Bacteria 1015
529 Ga0501071_0029734 3300049587 Bacteria 3858
530 Ga0501071_0062699 3300049587 Bacteria 2694
531 Ga0501071_0089391 3300049587 Bacteria 2260
532 Ga0501071_0282300 3300049587 Bacteria 1257
533 Ga0501072_0010731 3300049588 Bacteria 6980
534 Ga0501072_0011976 3300049588 Bacteria 6626
535 Ga0501072_0019392 3300049588 Bacteria 5256
536 Ga0501072_0024925 3300049588 Bacteria 4657
537 Ga0501072_0143087 3300049588 Bacteria 1907
538 Ga0501072_0213564 3300049588 Bacteria 1538
539 Ga0501072_0563245 3300049588 Bacteria 899
540 Ga0501073_0046661 3300049589 Bacteria 3046
541 Ga0501073_0113279 3300049589 Bacteria 1881
542 Ga0501073_0149774 3300049589 Bacteria 1617
543 Ga0501074_0048490 3300049590 Bacteria 3068
544 Ga0501074_0069840 3300049590 Bacteria 2526
545 Ga0501074_0119473 3300049590 Bacteria 1884
546 Ga0501075_0014499 3300049591 Bacteria 5649
547 Ga0501075_0024646 3300049591 Bacteria 4416
548 Ga0501075_0034507 3300049591 Bacteria 3767
549 Ga0501075_0045394 3300049591 Bacteria 3298
550 Ga0501075_0074095 3300049591 Bacteria 2575
551 Ga0501075_0109511 3300049591 Bacteria 2100
552 Ga0501075_0109520 3300049591 Bacteria 2100
553 Ga0501075_0115461 3300049591 Bacteria 2041
554 Ga0501075_0198999 3300049591 Bacteria 1528
555 Ga0501076_0018260 3300049592 Bacteria 5344
556 Ga0501076_0021228 3300049592 Bacteria 4980
557 Ga0501076_0051267 3300049592 Bacteria 3266
558 Ga0501076_0060391 3300049592 Bacteria 3016
559 Ga0501076_0079350 3300049592 Bacteria 2634
560 Ga0501076_0243552 3300049592 Bacteria 1471
561 Ga0501076_0296881 3300049592 Bacteria 1324
562 Ga0501076_0706975 3300049592 Bacteria 832
563 Ga0501076_0910073 3300049592 Bacteria 725
564 Ga0501077_0012026 3300049593 Bacteria 5418
565 Ga0501077_0046909 3300049593 Bacteria 2745
566 Ga0501077_0084986 3300049593 Bacteria 2006
567 Ga0501077_0104873 3300049593 Bacteria 1791
568 Ga0501077_0148829 3300049593 Bacteria 1485
569 Ga0501077_0356827 3300049593 Bacteria 933
570 Ga0501079_0000962 3300049741 Bacteria 19859
571 Ga0501079_0022830 3300049741 Bacteria 4802
572 Ga0501079_0028488 3300049741 Bacteria 4287
573 Ga0501079_0044843 3300049741 Bacteria 3412
574 Ga0501079_0110328 3300049741 Bacteria 2137
575 Ga0501079_0115159 3300049741 Bacteria 2090
576 Ga0501079_0186870 3300049741 Bacteria 1617
577 Ga0501080_0013705 3300049742 Bacteria 7466
578 Ga0501080_0061308 3300049742 Bacteria 3502
579 Ga0501080_0229708 3300049742 Bacteria 1696
580 Ga0501080_0239431 3300049742 Bacteria 1656
581 Ga0501080_0277362 3300049742 Bacteria 1525
582 Ga0501080_0565874 3300049742 Bacteria 1011
583 Ga0501080_0584024 3300049742 Bacteria 993
584 Ga0501081_0002065 3300049743 Bacteria 12525
585 Ga0501081_0003003 3300049743 Bacteria 10711
586 Ga0501081_0003043 3300049743 Bacteria 10641
587 Ga0501081_0006739 3300049743 Bacteria 7466
588 Ga0501081_0018202 3300049743 Bacteria 4663
589 Ga0501081_0064719 3300049743 Bacteria 2540
590 Ga0501083_0029430 3300049744 Bacteria 3777
591 Ga0501083_0173718 3300049744 Bacteria 1408
592 Ga0501035_0285826 3300049822 Bacteria 1393
593 Ga0501035_0288301 3300049822 Bacteria 1386
594 Ga0501035_0320692 3300049822 Bacteria 1302
595 Ga0501045_0000542 3300049824 Bacteria 23648
596 Ga0501045_0018403 3300049824 Bacteria 4970
597 Ga0501045_0018570 3300049824 Bacteria 4947
598 Ga0501045_0026245 3300049824 Bacteria 4189
599 Ga0501045_0144679 3300049824 Bacteria 1768
600 Ga0501045_0273232 3300049824 Bacteria 1258
601 Ga0501045_0489812 3300049824 Bacteria 913
602 nmdc:mga05p37_10296_c1 3300050507 Bacteria 11105
603 nmdc:mga05p37_10313_c1 3300050507 Bacteria 11096
604 nmdc:mga05p37_111793_c1 3300050507 Bacteria 3359
605 nmdc:mga05p37_11771_c1 3300050507 Bacteria 9366
606 nmdc:mga05p37_1188_c1 3300050507 Bacteria 30065
607 nmdc:mga05p37_132550_c1 3300050507 Bacteria 3057
608 nmdc:mga05p37_182465_c1 3300050507 Bacteria 2553
609 nmdc:mga05p37_212_c1 3300050507 Bacteria 58811
610 nmdc:mga05p37_270065_c1 3300050507 Bacteria 2033
611 nmdc:mga05p37_335410_c1 3300050507 Bacteria 1785
612 nmdc:mga05p37_403887_c1 3300050507 Bacteria 1594
613 nmdc:mga05p37_41471_c1 3300050507 Bacteria 5651
614 nmdc:mga05p37_7876_c1 3300050507 Bacteria 12576
615 nmdc:mga09592_11174_c1 3300050508 Bacteria 7306
616 nmdc:mga09592_134764_c1 3300050508 Bacteria 2127
617 nmdc:mga09592_212597_c1 3300050508 Bacteria 1676
618 nmdc:mga09592_265_c1 3300050508 Bacteria 38165
619 nmdc:mga09592_32798_c1 3300050508 Bacteria 4330
620 nmdc:mga09592_38645_c1 3300050508 Bacteria 4007
621 nmdc:mga09592_3999_c1 3300050508 Bacteria 11886
622 nmdc:mga09592_413686_c1 3300050508 Bacteria 1165
623 nmdc:mga09592_7616_c1 3300050508 Bacteria 8809
624 nmdc:mga09592_92363_c1 3300050508 Bacteria 2587
625 nmdc:mga09592_992_c1 3300050508 Bacteria 22474
626 nmdc:mga0qj67_162838_c1 3300050509 Bacteria 1811
627 nmdc:mga0qj67_2490_c1 3300050509 Bacteria 13137
628 nmdc:mga0qj67_426286_c1 3300050509 Bacteria 1069
629 nmdc:mga0qj67_6600_c1 3300050509 Bacteria 8527
630 nmdc:mga0qj67_72017_c1 3300050509 Bacteria 2758
631 nmdc:mga06r32_100340_c1 3300050510 Bacteria 2840
632 nmdc:mga06r32_102516_c1 3300050510 Bacteria 2809
633 nmdc:mga06r32_179862_c1 3300050510 Bacteria 2100
634 nmdc:mga06r32_1850_c1 3300050510 Bacteria 18813
635 nmdc:mga06r32_2420_c1 3300050510 Bacteria 16703
636 nmdc:mga06r32_26143_c1 3300050510 Bacteria 5439
637 nmdc:mga06r32_30435_c1 3300050510 Bacteria 5064
638 nmdc:mga06r32_455607_c1 3300050510 Bacteria 1258
639 nmdc:mga06r32_52930_c1 3300050510 Bacteria 3889
640 nmdc:mga06r32_63311_c1 3300050510 Bacteria 3565
641 nmdc:mga06r32_749782_c1 3300050510 Bacteria 940
642 nmdc:mga06r32_886_c1 3300050510 Bacteria 26660
643 nmdc:mga08y16_1163552_c1 3300050511 Bacteria 744
644 nmdc:mga08y16_350387_c1 3300050511 Bacteria 1517
645 nmdc:mga08y16_5536_c1 3300050511 Bacteria 13220
646 nmdc:mga08y16_6014_c1 3300050511 Bacteria 12718
647 nmdc:mga0n895_10268_c1 3300050512 Bacteria 8255
648 nmdc:mga0n895_139945_c1 3300050512 Bacteria 2448
649 nmdc:mga0n895_24612_c1 3300050512 Bacteria 5676
650 nmdc:mga0n895_270470_c1 3300050512 Bacteria 1724
651 nmdc:mga0n895_286848_c1 3300050512 Bacteria 1669
652 nmdc:mga0n895_3081_c1 3300050512 Bacteria 13264
653 nmdc:mga0n895_33586_c1 3300050512 Bacteria 4932
654 nmdc:mga0n895_353404_c1 3300050512 Bacteria 1488
655 nmdc:mga0n895_35372_c1 3300050512 Bacteria 4816
656 nmdc:mga0n895_42945_c1 3300050512 Bacteria 4403
657 nmdc:mga0n895_459722_c1 3300050512 Bacteria 1285
658 nmdc:mga0rr50_1061_c1 3300050513 Bacteria 14938
659 nmdc:mga0rr50_147245_c1 3300050513 Bacteria 1900
660 nmdc:mga0rr50_153051_c1 3300050513 Bacteria 1866
661 nmdc:mga0rr50_168928_c1 3300050513 Bacteria 1781
662 nmdc:mga0rr50_2266_c1 3300050513 Bacteria 10791
663 nmdc:mga0rr50_401764_c1 3300050513 Bacteria 1157
664 nmdc:mga0rr50_65858_c1 3300050513 Bacteria 2746
665 nmdc:mga0rr50_7012_c1 3300050513 Bacteria 6914
666 nmdc:mga08x19_116540_c1 3300050514 Bacteria 1786
667 nmdc:mga08x19_23888_c1 3300050514 Bacteria 3795
668 nmdc:mga08x19_361440_c1 3300050514 Bacteria 1015
669 nmdc:mga08x19_546158_c1 3300050514 Bacteria 820
670 nmdc:mga0a205_1419_c1 3300050515 Bacteria 20361
671 nmdc:mga0a205_153847_c1 3300050515 Bacteria 2199
672 nmdc:mga0a205_15574_c1 3300050515 Bacteria 7107
673 nmdc:mga0a205_17378_c1 3300050515 Bacteria 6740
674 nmdc:mga0a205_173969_c1 3300050515 Bacteria 2049
675 nmdc:mga0a205_259714_c1 3300050515 Bacteria 1615
676 nmdc:mga0a205_3138_c2 3300050515 Bacteria 13217
677 nmdc:mga0a205_3294_c1 3300050515 Bacteria 14365
678 nmdc:mga0a205_353382_c1 3300050515 Bacteria 1337
679 nmdc:mga0a205_60234_c1 3300050515 Bacteria 3667
680 nmdc:mga0a205_669355_c1 3300050515 Bacteria 889
681 nmdc:mga0a205_69079_c1 3300050515 Bacteria 3412
682 nmdc:mga0a205_7770_c1 3300050515 Bacteria 9735
683 Ga0501084_0011863 3300054114 Bacteria 7214
684 Ga0501084_0043575 3300054114 Bacteria 3753
685 Ga0501084_0060512 3300054114 Bacteria 3170
686 Ga0501084_0064742 3300054114 Bacteria 3059
687 Ga0501084_0109738 3300054114 Bacteria 2318
688 Ga0501084_0113893 3300054114 Bacteria 2273
689 Ga0501084_0202675 3300054114 Bacteria 1674
690 Ga0590074_010689 3300059423 Bacteria 1535
691 Ga0501082_0000590 3300060353 Bacteria 32111
692 Ga0501082_0007107 3300060353 Bacteria 9659
693 Ga0501082_0010275 3300060353 Bacteria 8058
694 Ga0501082_0059775 3300060353 Bacteria 3284
695 Ga0501082_0105500 3300060353 Bacteria 2438
696 Ga0501082_0158908 3300060353 Bacteria 1964
697 Ga0501082_0167219 3300060353 Bacteria 1911
698 Ga0501082_0253139 3300060353 Bacteria 1532
699 Ga0501082_0508353 3300060353 Bacteria 1053
700 Ga0530510_0015192 3300061734 Bacteria 5437
701 Ga0530510_0032811 3300061734 Bacteria 3737
702 Ga0530510_0231024 3300061734 Bacteria 1376
703 Ga0530510_0232407 3300061734 Bacteria 1372
704 Ga0530510_0523958 3300061734 Bacteria 899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0968603 Ga0451577_0968603_15_635 196
2 3300013306 Ga0163162_10669834 Ga0163162_106698341 206
3 3300005293 Ga0065715_10369058 Ga0065715_103690581 208
4 3300005328 Ga0070676_10001508 Ga0070676_100015085 208
5 3300005329 Ga0070683_100040464 Ga0070683_1000404643 208
6 3300005330 Ga0070690_100227937 Ga0070690_1002279371 208
7 3300005331 Ga0070670_100005711 Ga0070670_1000057112 208
8 3300005334 Ga0068869_100001826 Ga0068869_1000018269 208
9 3300005336 Ga0070680_100011525 Ga0070680_1000115254 208
10 3300005337 Ga0070682_100010168 Ga0070682_1000101683 208
11 3300005338 Ga0068868_100186906 Ga0068868_1001869062 208
12 3300005339 Ga0070660_100006407 Ga0070660_1000064074 208
13 3300005340 Ga0070689_100086275 Ga0070689_1000862752 208
14 3300005341 Ga0070691_10004132 Ga0070691_100041323 208
15 3300005344 Ga0070661_100004542 Ga0070661_1000045426 208
16 3300005345 Ga0070692_10096760 Ga0070692_100967602 208
17 3300005354 Ga0070675_100096848 Ga0070675_1000968482 208
18 3300005366 Ga0070659_100000322 Ga0070659_10000032218 208
19 3300005406 Ga0070703_10000793 Ga0070703_100007937 208
20 3300005438 Ga0070701_10055062 Ga0070701_100550622 208
21 3300005440 Ga0070705_100002220 Ga0070705_1000022206 208
22 3300005441 Ga0070700_100054686 Ga0070700_1000546862 208
23 3300005444 Ga0070694_100000296 Ga0070694_1000002961 208
24 3300005445 Ga0070708_100385405 Ga0070708_1003854052 208
25 3300005455 Ga0070663_100011713 Ga0070663_1000117132 208
26 3300005457 Ga0070662_100002852 Ga0070662_1000028526 208
27 3300005458 Ga0070681_10003875 Ga0070681_100038756 208
28 3300005459 Ga0068867_100028261 Ga0068867_1000282612 208
29 3300005530 Ga0070679_100011577 Ga0070679_1000115776 208
30 3300005535 Ga0070684_100033110 Ga0070684_1000331104 208
31 3300005539 Ga0068853_100000518 Ga0068853_1000005186 208
32 3300005543 Ga0070672_100014519 Ga0070672_1000145194 208
33 3300005545 Ga0070695_100017187 Ga0070695_1000171875 208
34 3300005547 Ga0070693_100001092 Ga0070693_1000010924 208
35 3300005549 Ga0070704_100013935 Ga0070704_1000139354 208
36 3300005563 Ga0068855_100008473 Ga0068855_10000847310 208
37 3300005564 Ga0070664_100023335 Ga0070664_1000233351 208
38 3300005577 Ga0068857_100005198 Ga0068857_1000051983 208
39 3300005578 Ga0068854_100002526 Ga0068854_10000252610 208
40 3300005614 Ga0068856_100019528 Ga0068856_1000195286 208
41 3300005616 Ga0068852_100024867 Ga0068852_1000248672 208
42 3300005617 Ga0068859_100000976 Ga0068859_10000097617 208
43 3300005618 Ga0068864_100001266 Ga0068864_10000126617 208
44 3300005840 Ga0068870_10000987 Ga0068870_100009874 208
45 3300005842 Ga0068858_100036781 Ga0068858_1000367814 208
46 3300005843 Ga0068860_100016087 Ga0068860_1000160876 208
47 3300005844 Ga0068862_100001929 Ga0068862_1000019295 208
48 3300006852 Ga0075433_10100906 Ga0075433_101009062 208
49 3300006871 Ga0075434_100045687 Ga0075434_1000456872 208
50 3300006931 Ga0097620_100000976 Ga0097620_10000097613 208
51 3300007076 Ga0075435_100042844 Ga0075435_1000428445 208
52 3300009147 Ga0114129_10127166 Ga0114129_101271662 208
53 3300009148 Ga0105243_10155987 Ga0105243_101559871 208
54 3300009174 Ga0105241_10000602 Ga0105241_1000060210 208
55 3300009551 Ga0105238_10981169 Ga0105238_109811691 208
56 3300010375 Ga0105239_10255784 Ga0105239_102557842 208
57 3300011119 Ga0105246_10031031 Ga0105246_100310313 208
58 3300013100 Ga0157373_10001523 Ga0157373_1000152313 208
59 3300013105 Ga0157369_10003919 Ga0157369_1000391916 208
60 3300013307 Ga0157372_10000415 Ga0157372_1000041520 208
61 3300013308 Ga0157375_10024425 Ga0157375_100244256 208
62 3300014325 Ga0163163_10075053 Ga0163163_100750533 208
63 3300014497 Ga0182008_10038272 Ga0182008_100382722 208
64 3300025885 Ga0207653_10001986 Ga0207653_100019862 208
65 3300025901 Ga0207688_10022050 Ga0207688_100220501 208
66 3300025907 Ga0207645_10000389 Ga0207645_1000038913 208
67 3300025908 Ga0207643_10000290 Ga0207643_1000029017 208
68 3300025911 Ga0207654_10005545 Ga0207654_100055454 208
69 3300025912 Ga0207707_10000158 Ga0207707_1000015848 208
70 3300025917 Ga0207660_10000987 Ga0207660_1000098710 208
71 3300025919 Ga0207657_10000426 Ga0207657_1000042621 208
72 3300025920 Ga0207649_10002448 Ga0207649_100024487 208
73 3300025921 Ga0207652_10000290 Ga0207652_100002904 208
74 3300025923 Ga0207681_10016844 Ga0207681_100168445 208
75 3300025925 Ga0207650_10256121 Ga0207650_102561212 208
76 3300025926 Ga0207659_10025333 Ga0207659_100253335 208
77 3300025932 Ga0207690_10002346 Ga0207690_1000234610 208
78 3300025933 Ga0207706_10003426 Ga0207706_100034266 208
79 3300025935 Ga0207709_10032319 Ga0207709_100323192 208
80 3300025936 Ga0207670_10118886 Ga0207670_101188863 208
81 3300025940 Ga0207691_10076908 Ga0207691_100769081 208
82 3300025942 Ga0207689_10000277 Ga0207689_1000027713 208
83 3300025945 Ga0207679_10000773 Ga0207679_1000077317 208
84 3300025949 Ga0207667_10003179 Ga0207667_1000317916 208
85 3300025981 Ga0207640_10001020 Ga0207640_100010206 208
86 3300026023 Ga0207677_10082810 Ga0207677_100828103 208
87 3300026035 Ga0207703_10041954 Ga0207703_100419543 208
88 3300026041 Ga0207639_10001029 Ga0207639_1000102916 208
89 3300026067 Ga0207678_10022159 Ga0207678_100221592 208
90 3300026075 Ga0207708_10061128 Ga0207708_100611282 208
91 3300026078 Ga0207702_10003932 Ga0207702_100039326 208
92 3300026089 Ga0207648_10046041 Ga0207648_100460414 208
93 3300026095 Ga0207676_10033858 Ga0207676_100338584 208
94 3300026116 Ga0207674_10001112 Ga0207674_1000111220 208
95 3300026118 Ga0207675_100003707 Ga0207675_10000370715 208
96 3300026142 Ga0207698_10409182 Ga0207698_104091821 208
97 3300028380 Ga0268265_10024881 Ga0268265_100248811 208
98 3300028381 Ga0268264_10032016 Ga0268264_100320165 208
99 3300034818 Ga0373950_0009574 Ga0373950_0009574_239_991 208
100 3300035090 Ga0373949_0012139 Ga0373949_0012139_267_1019 208
101 3300035091 Ga0373951_0009267 Ga0373951_0009267_1249_2001 208
102 3300035092 Ga0373952_0002583 Ga0373952_0002583_2470_3222 208
103 3300035112 Ga0373932_0032119 Ga0373932_0032119_476_1228 208
104 3300035691 Ga0373931_0044914 Ga0373931_0044914_191_943 208
105 3300042005 Ga0439448_0007726 Ga0439448_0007726_74_826 208
106 3300042012 Ga0439455_0036068 Ga0439455_0036068_272_1024 208
107 3300042157 Ga0439458_0031856 Ga0439458_0031856_480_1232 208
108 3300042876 Ga0451577_0007730 Ga0451577_0007730_6345_7097 208
109 3300048905 Ga0496102_0051899 Ga0496102_0051899_367_1119 208
110 3300048907 Ga0496104_0253378 Ga0496104_0253378_835_1587 208
111 3300048911 Ga0496108_0649067 Ga0496108_0649067_62_814 208
112 3300048912 Ga0496109_0442920 Ga0496109_0442920_253_1005 208
113 3300048915 Ga0496112_0064810 Ga0496112_0064810_2695_3447 208
114 3300048916 Ga0496113_0295158 Ga0496113_0295158_355_1107 208
115 3300049572 Ga0501036_0344199 Ga0501036_0344199_17_673 208
116 3300049591 Ga0501075_0198999 Ga0501075_0198999_808_1464 208
117 3300049592 Ga0501076_0910073 Ga0501076_0910073_52_708 208
118 3300049742 Ga0501080_0229708 Ga0501080_0229708_510_1166 208
119 3300050513 nmdc:mga0rr50_147245_c1 nmdc:mga0rr50_147245_c1_260_1012 208
120 3300050515 nmdc:mga0a205_173969_c1 nmdc:mga0a205_173969_c1_426_1178 208
121 3300025940 Ga0207691_10356739 Ga0207691_103567392 209
122 3300049568 Ga0501031_0243676 Ga0501031_0243676_498_1157 209
123 3300050507 nmdc:mga05p37_132550_c1 nmdc:mga05p37_132550_c1_1308_2060 210
124 3300025917 Ga0207660_10668382 Ga0207660_106683821 216
125 3300049742 Ga0501080_0565874 Ga0501080_0565874_11_697 218
126 3300049576 Ga0501040_0087287 Ga0501040_0087287_305_1057 219
127 3300049578 Ga0501042_0279767 Ga0501042_0279767_280_1032 219
128 3300049588 Ga0501072_0019392 Ga0501072_0019392_925_1677 219
129 3300049592 Ga0501076_0060391 Ga0501076_0060391_1221_1973 219
130 3300049742 Ga0501080_0239431 Ga0501080_0239431_661_1413 219
131 3300049824 Ga0501045_0018570 Ga0501045_0018570_3880_4632 219
132 3300054114 Ga0501084_0064742 Ga0501084_0064742_599_1351 219
133 3300061734 Ga0530510_0032811 Ga0530510_0032811_592_1344 219
134 3300049580 Ga0501046_0093811 Ga0501046_0093811_1088_1840 220
135 3300049575 Ga0501039_0466292 Ga0501039_0466292_187_939 221
136 3300049588 Ga0501072_0143087 Ga0501072_0143087_209_961 221
137 3300049588 Ga0501072_0563245 Ga0501072_0563245_56_808 221
138 3300049592 Ga0501076_0079350 Ga0501076_0079350_185_937 221
139 3300049743 Ga0501081_0064719 Ga0501081_0064719_261_1013 221
140 3300061734 Ga0530510_0015192 Ga0530510_0015192_1559_2311 221
141 3300061734 Ga0530510_0231024 Ga0530510_0231024_108_860 221
142 3300050509 nmdc:mga0qj67_72017_c1 nmdc:mga0qj67_72017_c1_59_826 222
143 3300031995 Ga0307409_101296598 Ga0307409_1012965981 223
144 3300049575 Ga0501039_0636721 Ga0501039_0636721_117_818 223
145 3300049580 Ga0501046_0576693 Ga0501046_0576693_15_716 223
146 3300042876 Ga0451577_0014349 Ga0451577_0014349_2530_3234 224
147 3300044673 Ga0453683_0005071 Ga0453683_0005071_3386_4090 224
148 3300044712 Ga0453684_0130819 Ga0453684_0130819_2112_2816 224
149 3300045051 Ga0451576_0114215 Ga0451576_0114215_856_1560 224
150 3300046472 Ga0495580_0193068 Ga0495580_0193068_681_1385 224
151 3300049575 Ga0501039_0005533 Ga0501039_0005533_8845_9549 224
152 3300049578 Ga0501042_0358319 Ga0501042_0358319_29_733 224
153 3300049822 Ga0501035_0285826 Ga0501035_0285826_301_1005 224
154 3300050511 nmdc:mga08y16_1163552_c1 nmdc:mga08y16_1163552_c1_26_730 224
155 3300050512 nmdc:mga0n895_270470_c1 nmdc:mga0n895_270470_c1_1016_1711 224
156 3300050514 nmdc:mga08x19_546158_c1 nmdc:mga08x19_546158_c1_34_738 224
157 3300009147 Ga0114129_10363333 Ga0114129_103633333 228
158 3300027552 Ga0209982_1002708 Ga0209982_10027081 229
159 3300049592 Ga0501076_0706975 Ga0501076_0706975_20_739 232
160 3300005289 Ga0065704_10314564 Ga0065704_103145641 233
161 3300005334 Ga0068869_100002053 Ga0068869_1000020538 233
162 3300005347 Ga0070668_100158679 Ga0070668_1001586792 233
163 3300005406 Ga0070703_10005280 Ga0070703_100052802 233
164 3300005444 Ga0070694_100145888 Ga0070694_1001458882 233
165 3300005471 Ga0070698_100322269 Ga0070698_1003222691 233
166 3300005545 Ga0070695_100010470 Ga0070695_1000104705 233
167 3300005546 Ga0070696_100108877 Ga0070696_1001088771 233
168 3300005547 Ga0070693_100053471 Ga0070693_1000534711 233
169 3300005549 Ga0070704_100047033 Ga0070704_1000470332 233
170 3300005843 Ga0068860_100499276 Ga0068860_1004992761 233
171 3300005844 Ga0068862_100092664 Ga0068862_1000926642 233
172 3300006847 Ga0075431_100311893 Ga0075431_1003118932 233
173 3300009098 Ga0105245_10061624 Ga0105245_100616244 233
174 3300009147 Ga0114129_11337027 Ga0114129_113370271 233
175 3300009174 Ga0105241_10351278 Ga0105241_103512781 233
176 3300009176 Ga0105242_10312952 Ga0105242_103129522 233
177 3300013306 Ga0163162_10628566 Ga0163162_106285662 233
178 3300025885 Ga0207653_10017569 Ga0207653_100175693 233
179 3300025917 Ga0207660_10063986 Ga0207660_100639862 233
180 3300025922 Ga0207646_10484674 Ga0207646_104846741 233
181 3300025927 Ga0207687_10035250 Ga0207687_100352504 233
182 3300025935 Ga0207709_10059847 Ga0207709_100598473 233
183 3300025942 Ga0207689_10002344 Ga0207689_100023442 233
184 3300025972 Ga0207668_10632273 Ga0207668_106322732 233
185 3300026035 Ga0207703_10449022 Ga0207703_104490222 233
186 3300026089 Ga0207648_10123281 Ga0207648_101232813 233
187 3300028380 Ga0268265_10011589 Ga0268265_100115893 233
188 3300042008 Ga0439450_059040 Ga0439450_059040_83_832 233
189 3300044673 Ga0453683_0039670 Ga0453683_0039670_1487_2236 233
190 3300046491 Ga0495584_0072783 Ga0495584_0072783_607_1356 233
191 3300048909 Ga0496106_0514185 Ga0496106_0514185_95_844 233
192 3300049575 Ga0501039_0357622 Ga0501039_0357622_230_979 233
193 3300049577 Ga0501041_0080929 Ga0501041_0080929_936_1685 233
194 3300049578 Ga0501042_0065812 Ga0501042_0065812_1767_2516 233
195 3300049580 Ga0501046_0142576 Ga0501046_0142576_157_906 233
196 3300049584 Ga0501068_0047077 Ga0501068_0047077_1483_2232 233
197 3300049587 Ga0501071_0089391 Ga0501071_0089391_470_1219 233
198 3300049589 Ga0501073_0113279 Ga0501073_0113279_232_981 233
199 3300049590 Ga0501074_0119473 Ga0501074_0119473_292_1041 233
200 3300049591 Ga0501075_0024646 Ga0501075_0024646_3529_4278 233
201 3300049591 Ga0501075_0109520 Ga0501075_0109520_1101_1850 233
202 3300049591 Ga0501075_0115461 Ga0501075_0115461_998_1747 233
203 3300049592 Ga0501076_0243552 Ga0501076_0243552_135_884 233
204 3300049593 Ga0501077_0104873 Ga0501077_0104873_149_898 233
205 3300049741 Ga0501079_0110328 Ga0501079_0110328_432_1181 233
206 3300049742 Ga0501080_0013705 Ga0501080_0013705_5990_6739 233
207 3300049743 Ga0501081_0002065 Ga0501081_0002065_9586_10335 233
208 3300049744 Ga0501083_0173718 Ga0501083_0173718_462_1211 233
209 3300049822 Ga0501035_0320692 Ga0501035_0320692_121_870 233
210 3300049824 Ga0501045_0144679 Ga0501045_0144679_307_1056 233
211 3300050507 nmdc:mga05p37_403887_c1 nmdc:mga05p37_403887_c1_192_932 233
212 3300054114 Ga0501084_0011863 Ga0501084_0011863_3144_3893 233
213 3300060353 Ga0501082_0059775 Ga0501082_0059775_847_1596 233
214 3300060353 Ga0501082_0105500 Ga0501082_0105500_1138_1887 233
215 3300060353 Ga0501082_0158908 Ga0501082_0158908_1098_1847 233
216 3300003349 JGI26129J50193_1003564 JGI26129J50193_10035642 234
217 3300003373 JGI25407J50210_10033392 JGI25407J50210_100333922 234
218 3300003503 JGI26141J51220_1001422 JGI26141J51220_10014222 234
219 3300005330 Ga0070690_100118531 Ga0070690_1001185313 234
220 3300005330 Ga0070690_100516391 Ga0070690_1005163911 234
221 3300005336 Ga0070680_100029669 Ga0070680_1000296695 234
222 3300005336 Ga0070680_100034957 Ga0070680_1000349572 234
223 3300005336 Ga0070680_100346515 Ga0070680_1003465152 234
224 3300005341 Ga0070691_10001908 Ga0070691_100019087 234
225 3300005341 Ga0070691_10023591 Ga0070691_100235912 234
226 3300005353 Ga0070669_100009553 Ga0070669_1000095535 234
227 3300005353 Ga0070669_100383192 Ga0070669_1003831922 234
228 3300005434 Ga0070709_10045578 Ga0070709_100455784 234
229 3300005439 Ga0070711_100462505 Ga0070711_1004625051 234
230 3300005440 Ga0070705_100019189 Ga0070705_1000191892 234
231 3300005440 Ga0070705_100048811 Ga0070705_1000488112 234
232 3300005440 Ga0070705_100068779 Ga0070705_1000687792 234
233 3300005441 Ga0070700_100019386 Ga0070700_1000193862 234
234 3300005444 Ga0070694_100000326 Ga0070694_10000032616 234
235 3300005444 Ga0070694_100020927 Ga0070694_1000209274 234
236 3300005444 Ga0070694_100054799 Ga0070694_1000547994 234
237 3300005444 Ga0070694_100468245 Ga0070694_1004682451 234
238 3300005445 Ga0070708_100011197 Ga0070708_1000111978 234
239 3300005445 Ga0070708_100015611 Ga0070708_1000156114 234
240 3300005445 Ga0070708_100028675 Ga0070708_1000286752 234
241 3300005445 Ga0070708_100032014 Ga0070708_1000320144 234
242 3300005445 Ga0070708_100069682 Ga0070708_1000696824 234
243 3300005445 Ga0070708_100129176 Ga0070708_1001291762 234
244 3300005445 Ga0070708_100132915 Ga0070708_1001329152 234
245 3300005457 Ga0070662_100125151 Ga0070662_1001251511 234
246 3300005457 Ga0070662_100411032 Ga0070662_1004110322 234
247 3300005457 Ga0070662_100510981 Ga0070662_1005109811 234
248 3300005467 Ga0070706_100023384 Ga0070706_1000233843 234
249 3300005467 Ga0070706_100037683 Ga0070706_1000376832 234
250 3300005467 Ga0070706_100048189 Ga0070706_1000481895 234
251 3300005467 Ga0070706_100574269 Ga0070706_1005742691 234
252 3300005468 Ga0070707_100001990 Ga0070707_1000019909 234
253 3300005468 Ga0070707_100015361 Ga0070707_1000153615 234
254 3300005468 Ga0070707_100061601 Ga0070707_1000616014 234
255 3300005468 Ga0070707_100114959 Ga0070707_1001149591 234
256 3300005468 Ga0070707_100141390 Ga0070707_1001413902 234
257 3300005468 Ga0070707_100264879 Ga0070707_1002648793 234
258 3300005468 Ga0070707_100302553 Ga0070707_1003025531 234
259 3300005468 Ga0070707_100401665 Ga0070707_1004016652 234
260 3300005468 Ga0070707_100519354 Ga0070707_1005193542 234
261 3300005471 Ga0070698_100011688 Ga0070698_1000116888 234
262 3300005471 Ga0070698_100039746 Ga0070698_1000397462 234
263 3300005471 Ga0070698_100060267 Ga0070698_1000602671 234
264 3300005471 Ga0070698_100158187 Ga0070698_1001581872 234
265 3300005471 Ga0070698_100335321 Ga0070698_1003353212 234
266 3300005518 Ga0070699_100003494 Ga0070699_1000034948 234
267 3300005518 Ga0070699_100007127 Ga0070699_1000071274 234
268 3300005518 Ga0070699_100191765 Ga0070699_1001917652 234
269 3300005518 Ga0070699_100248325 Ga0070699_1002483252 234
270 3300005518 Ga0070699_100285229 Ga0070699_1002852292 234
271 3300005536 Ga0070697_100006412 Ga0070697_1000064123 234
272 3300005536 Ga0070697_100027540 Ga0070697_1000275403 234
273 3300005536 Ga0070697_100044734 Ga0070697_1000447342 234
274 3300005536 Ga0070697_100048855 Ga0070697_1000488552 234
275 3300005536 Ga0070697_100050530 Ga0070697_1000505304 234
276 3300005536 Ga0070697_100056999 Ga0070697_1000569994 234
277 3300005536 Ga0070697_100276740 Ga0070697_1002767402 234
278 3300005536 Ga0070697_100351576 Ga0070697_1003515762 234
279 3300005543 Ga0070672_100027044 Ga0070672_1000270444 234
280 3300005545 Ga0070695_100002363 Ga0070695_1000023633 234
281 3300005545 Ga0070695_100005039 Ga0070695_1000050395 234
282 3300005546 Ga0070696_100023696 Ga0070696_1000236964 234
283 3300005546 Ga0070696_100081933 Ga0070696_1000819333 234
284 3300005546 Ga0070696_100083494 Ga0070696_1000834943 234
285 3300005546 Ga0070696_100109916 Ga0070696_1001099162 234
286 3300005546 Ga0070696_100284506 Ga0070696_1002845062 234
287 3300005549 Ga0070704_100035814 Ga0070704_1000358142 234
288 3300005549 Ga0070704_100117534 Ga0070704_1001175344 234
289 3300005549 Ga0070704_100169678 Ga0070704_1001696781 234
290 3300005577 Ga0068857_100094490 Ga0068857_1000944901 234
291 3300005577 Ga0068857_100307625 Ga0068857_1003076252 234
292 3300005615 Ga0070702_100065431 Ga0070702_1000654312 234
293 3300005617 Ga0068859_100211864 Ga0068859_1002118642 234
294 3300005841 Ga0068863_100056203 Ga0068863_1000562033 234
295 3300005843 Ga0068860_100052318 Ga0068860_1000523182 234
296 3300005843 Ga0068860_100144646 Ga0068860_1001446464 234
297 3300005844 Ga0068862_100532795 Ga0068862_1005327952 234
298 3300005937 Ga0081455_10015861 Ga0081455_100158614 234
299 3300005981 Ga0081538_10028407 Ga0081538_100284072 234
300 3300005983 Ga0081540_1017503 Ga0081540_10175034 234
301 3300005983 Ga0081540_1103207 Ga0081540_11032071 234
302 3300005985 Ga0081539_10000044 Ga0081539_1000004486 234
303 3300006175 Ga0070712_100003253 Ga0070712_1000032539 234
304 3300006844 Ga0075428_100000409 Ga0075428_10000040930 234
305 3300006844 Ga0075428_100004007 Ga0075428_1000040075 234
306 3300006844 Ga0075428_100010083 Ga0075428_1000100834 234
307 3300006844 Ga0075428_100012600 Ga0075428_1000126008 234
308 3300006844 Ga0075428_100071289 Ga0075428_1000712892 234
309 3300006844 Ga0075428_100093499 Ga0075428_1000934992 234
310 3300006844 Ga0075428_100148280 Ga0075428_1001482803 234
311 3300006844 Ga0075428_100721192 Ga0075428_1007211921 234
312 3300006844 Ga0075428_100843780 Ga0075428_1008437802 234
313 3300006846 Ga0075430_100000648 Ga0075430_10000064815 234
314 3300006846 Ga0075430_100002276 Ga0075430_10000227618 234
315 3300006846 Ga0075430_100006658 Ga0075430_1000066585 234
316 3300006846 Ga0075430_100041160 Ga0075430_1000411603 234
317 3300006846 Ga0075430_100059632 Ga0075430_1000596322 234
318 3300006846 Ga0075430_100420480 Ga0075430_1004204801 234
319 3300006847 Ga0075431_100000181 Ga0075431_10000018144 234
320 3300006847 Ga0075431_100001052 Ga0075431_10000105222 234
321 3300006847 Ga0075431_100003068 Ga0075431_10000306815 234
322 3300006847 Ga0075431_100003078 Ga0075431_10000307816 234
323 3300006847 Ga0075431_100009651 Ga0075431_1000096515 234
324 3300006847 Ga0075431_100080627 Ga0075431_1000806273 234
325 3300006847 Ga0075431_100093628 Ga0075431_1000936282 234
326 3300006847 Ga0075431_100203116 Ga0075431_1002031161 234
327 3300006847 Ga0075431_100473263 Ga0075431_1004732632 234
328 3300006852 Ga0075433_10001470 Ga0075433_1000147011 234
329 3300006852 Ga0075433_10002688 Ga0075433_100026887 234
330 3300006852 Ga0075433_10017885 Ga0075433_100178853 234
331 3300006852 Ga0075433_10025926 Ga0075433_100259264 234
332 3300006852 Ga0075433_10067634 Ga0075433_100676342 234
333 3300006852 Ga0075433_10073771 Ga0075433_100737711 234
334 3300006852 Ga0075433_10221264 Ga0075433_102212642 234
335 3300006852 Ga0075433_10229189 Ga0075433_102291892 234
336 3300006871 Ga0075434_100006184 Ga0075434_1000061842 234
337 3300006871 Ga0075434_100010856 Ga0075434_1000108566 234
338 3300006871 Ga0075434_100037121 Ga0075434_1000371213 234
339 3300006871 Ga0075434_100078686 Ga0075434_1000786863 234
340 3300006871 Ga0075434_100122319 Ga0075434_1001223192 234
341 3300006871 Ga0075434_100125335 Ga0075434_1001253352 234
342 3300006871 Ga0075434_100134302 Ga0075434_1001343024 234
343 3300006871 Ga0075434_100213306 Ga0075434_1002133062 234
344 3300006871 Ga0075434_100640345 Ga0075434_1006403452 234
345 3300006880 Ga0075429_100000116 Ga0075429_10000011629 234
346 3300006880 Ga0075429_100006906 Ga0075429_1000069063 234
347 3300006880 Ga0075429_100009267 Ga0075429_10000926711 234
348 3300006880 Ga0075429_100010439 Ga0075429_1000104394 234
349 3300006880 Ga0075429_100010600 Ga0075429_1000106002 234
350 3300006880 Ga0075429_100011279 Ga0075429_1000112794 234
351 3300006880 Ga0075429_100042925 Ga0075429_1000429252 234
352 3300006880 Ga0075429_100100746 Ga0075429_1001007462 234
353 3300006880 Ga0075429_100141934 Ga0075429_1001419342 234
354 3300006880 Ga0075429_100430711 Ga0075429_1004307111 234
355 3300006881 Ga0068865_100098520 Ga0068865_1000985202 234
356 3300006881 Ga0068865_100100352 Ga0068865_1001003523 234
357 3300006914 Ga0075436_100027597 Ga0075436_1000275976 234
358 3300006914 Ga0075436_100035510 Ga0075436_1000355102 234
359 3300006914 Ga0075436_100179959 Ga0075436_1001799592 234
360 3300006931 Ga0097620_100211860 Ga0097620_1002118602 234
361 3300007076 Ga0075435_100005723 Ga0075435_10000572311 234
362 3300007076 Ga0075435_100006422 Ga0075435_1000064228 234
363 3300007076 Ga0075435_100010888 Ga0075435_1000108884 234
364 3300007076 Ga0075435_100160144 Ga0075435_1001601443 234
365 3300007076 Ga0075435_100400418 Ga0075435_1004004182 234
366 3300007265 Ga0099794_10045714 Ga0099794_100457142 234
367 3300009094 Ga0111539_10001546 Ga0111539_100015467 234
368 3300009094 Ga0111539_10016844 Ga0111539_100168442 234
369 3300009094 Ga0111539_10029142 Ga0111539_100291428 234
370 3300009094 Ga0111539_10086840 Ga0111539_100868402 234
371 3300009147 Ga0114129_10001191 Ga0114129_100011916 234
372 3300009147 Ga0114129_10012024 Ga0114129_1001202411 234
373 3300009147 Ga0114129_10012777 Ga0114129_100127777 234
374 3300009147 Ga0114129_10016389 Ga0114129_1001638911 234
375 3300009147 Ga0114129_10017340 Ga0114129_1001734011 234
376 3300009147 Ga0114129_10022174 Ga0114129_100221742 234
377 3300009147 Ga0114129_10036794 Ga0114129_100367942 234
378 3300009147 Ga0114129_10073027 Ga0114129_100730274 234
379 3300009147 Ga0114129_10082640 Ga0114129_100826404 234
380 3300009147 Ga0114129_10152998 Ga0114129_101529983 234
381 3300009147 Ga0114129_10244822 Ga0114129_102448222 234
382 3300009147 Ga0114129_10285463 Ga0114129_102854633 234
383 3300009147 Ga0114129_10294037 Ga0114129_102940373 234
384 3300009147 Ga0114129_10321737 Ga0114129_103217372 234
385 3300009147 Ga0114129_10831422 Ga0114129_108314222 234
386 3300009148 Ga0105243_10036440 Ga0105243_100364404 234
387 3300009148 Ga0105243_10153032 Ga0105243_101530322 234
388 3300009148 Ga0105243_10301713 Ga0105243_103017132 234
389 3300009174 Ga0105241_10081082 Ga0105241_100810824 234
390 3300009176 Ga0105242_10002560 Ga0105242_1000256013 234
391 3300009553 Ga0105249_10022216 Ga0105249_100222165 234
392 3300009553 Ga0105249_10101361 Ga0105249_101013612 234
393 3300013100 Ga0157373_10280657 Ga0157373_102806571 234
394 3300013297 Ga0157378_10103497 Ga0157378_101034972 234
395 3300013297 Ga0157378_10260932 Ga0157378_102609322 234
396 3300013297 Ga0157378_10438618 Ga0157378_104386181 234
397 3300013308 Ga0157375_10715082 Ga0157375_107150821 234
398 3300013308 Ga0157375_10982318 Ga0157375_109823182 234
399 3300014326 Ga0157380_10175728 Ga0157380_101757281 234
400 3300014326 Ga0157380_10680290 Ga0157380_106802902 234
401 3300025885 Ga0207653_10004275 Ga0207653_100042753 234
402 3300025910 Ga0207684_10000673 Ga0207684_1000067330 234
403 3300025910 Ga0207684_10004725 Ga0207684_1000472513 234
404 3300025910 Ga0207684_10007696 Ga0207684_100076963 234
405 3300025910 Ga0207684_10013914 Ga0207684_100139145 234
406 3300025910 Ga0207684_10019842 Ga0207684_100198424 234
407 3300025910 Ga0207684_10024244 Ga0207684_100242447 234
408 3300025910 Ga0207684_10049409 Ga0207684_100494092 234
409 3300025911 Ga0207654_10018200 Ga0207654_100182003 234
410 3300025915 Ga0207693_10004038 Ga0207693_100040389 234
411 3300025915 Ga0207693_10164148 Ga0207693_101641482 234
412 3300025916 Ga0207663_10563445 Ga0207663_105634451 234
413 3300025917 Ga0207660_10170079 Ga0207660_101700792 234
414 3300025922 Ga0207646_10003019 Ga0207646_1000301918 234
415 3300025922 Ga0207646_10004413 Ga0207646_1000441313 234
416 3300025922 Ga0207646_10094726 Ga0207646_100947263 234
417 3300025922 Ga0207646_10116178 Ga0207646_101161782 234
418 3300025922 Ga0207646_10194980 Ga0207646_101949801 234
419 3300025922 Ga0207646_10202571 Ga0207646_102025713 234
420 3300025922 Ga0207646_10422670 Ga0207646_104226701 234
421 3300025922 Ga0207646_10476044 Ga0207646_104760441 234
422 3300025923 Ga0207681_10351511 Ga0207681_103515112 234
423 3300025934 Ga0207686_10015702 Ga0207686_100157022 234
424 3300025935 Ga0207709_10014362 Ga0207709_100143621 234
425 3300025935 Ga0207709_10072769 Ga0207709_100727692 234
426 3300025935 Ga0207709_10184559 Ga0207709_101845592 234
427 3300025936 Ga0207670_10111422 Ga0207670_101114222 234
428 3300025938 Ga0207704_10106592 Ga0207704_101065922 234
429 3300025939 Ga0207665_10003465 Ga0207665_1000346510 234
430 3300025940 Ga0207691_10086362 Ga0207691_100863623 234
431 3300025942 Ga0207689_10052447 Ga0207689_100524472 234
432 3300025961 Ga0207712_10077000 Ga0207712_100770003 234
433 3300025972 Ga0207668_10102555 Ga0207668_101025552 234
434 3300026075 Ga0207708_10004830 Ga0207708_100048301 234
435 3300026089 Ga0207648_10042884 Ga0207648_100428844 234
436 3300026116 Ga0207674_10324804 Ga0207674_103248042 234
437 3300027360 Ga0209969_1005511 Ga0209969_10055112 234
438 3300027364 Ga0209967_1013273 Ga0209967_10132732 234
439 3300027378 Ga0209981_1003723 Ga0209981_10037232 234
440 3300027395 Ga0209996_1000276 Ga0209996_10002768 234
441 3300027462 Ga0210000_1005391 Ga0210000_10053912 234
442 3300027471 Ga0209995_1000753 Ga0209995_10007531 234
443 3300027526 Ga0209968_1002525 Ga0209968_10025253 234
444 3300027543 Ga0209999_1001317 Ga0209999_10013173 234
445 3300027665 Ga0209983_1000304 Ga0209983_10003046 234
446 3300027665 Ga0209983_1019974 Ga0209983_10199742 234
447 3300027671 Ga0209588_1021324 Ga0209588_10213242 234
448 3300027671 Ga0209588_1029903 Ga0209588_10299032 234
449 3300027671 Ga0209588_1036640 Ga0209588_10366402 234
450 3300027682 Ga0209971_1000036 Ga0209971_100003614 234
451 3300027695 Ga0209966_1000228 Ga0209966_100022815 234
452 3300027717 Ga0209998_10000002 Ga0209998_1000000245 234
453 3300027876 Ga0209974_10012526 Ga0209974_100125264 234
454 3300027907 Ga0207428_10000398 Ga0207428_1000039828 234
455 3300027907 Ga0207428_10000526 Ga0207428_1000052633 234
456 3300027907 Ga0207428_10069725 Ga0207428_100697252 234
457 3300028381 Ga0268264_10045134 Ga0268264_100451344 234
458 3300028381 Ga0268264_10086095 Ga0268264_100860952 234
459 3300028381 Ga0268264_10210804 Ga0268264_102108042 234
460 3300031548 Ga0307408_100101902 Ga0307408_1001019022 234
461 3300031911 Ga0307412_10074286 Ga0307412_100742863 234
462 3300031995 Ga0307409_100361726 Ga0307409_1003617262 234
463 3300031995 Ga0307409_100556605 Ga0307409_1005566051 234
464 3300032126 Ga0307415_100239906 Ga0307415_1002399062 234
465 3300035084 Ga0373928_0017528 Ga0373928_0017528_484_1236 234
466 3300035088 Ga0373940_0003877 Ga0373940_0003877_1139_1891 234
467 3300035090 Ga0373949_0020438 Ga0373949_0020438_62_814 234
468 3300035090 Ga0373949_0044645 Ga0373949_0044645_27_779 234
469 3300035114 Ga0373939_0011216 Ga0373939_0011216_320_1072 234
470 3300035114 Ga0373939_0022929 Ga0373939_0022929_374_1126 234
471 3300035691 Ga0373931_0017773 Ga0373931_0017773_311_1063 234
472 3300035691 Ga0373931_0028538 Ga0373931_0028538_1719_2471 234
473 3300035691 Ga0373931_0130007 Ga0373931_0130007_39_791 234
474 3300035691 Ga0373931_0505477 Ga0373931_0505477_18_770 234
475 3300037312 Ga0395899_0228129 Ga0395899_0228129_64_816 234
476 3300037466 Ga0395898_0110168 Ga0395898_0110168_59_811 234
477 3300037466 Ga0395898_0758660 Ga0395898_0758660_106_858 234
478 3300038443 Ga0395901_0085204 Ga0395901_0085204_789_1541 234
479 3300038443 Ga0395901_0695613 Ga0395901_0695613_76_828 234
480 3300042003 Ga0439443_021858 Ga0439443_021858_97_849 234
481 3300042005 Ga0439448_0034698 Ga0439448_0034698_639_1391 234
482 3300042436 Ga0439435_0074447 Ga0439435_0074447_241_993 234
483 3300042436 Ga0439435_0096276 Ga0439435_0096276_98_850 234
484 3300042439 Ga0439464_0003187 Ga0439464_0003187_587_1339 234
485 3300042461 Ga0439460_0002670 Ga0439460_0002670_2680_3432 234
486 3300042461 Ga0439460_0088913 Ga0439460_0088913_207_959 234
487 3300042876 Ga0451577_0000793 Ga0451577_0000793_30188_30931 234
488 3300044673 Ga0453683_0009470 Ga0453683_0009470_1685_2428 234
489 3300044673 Ga0453683_0278141 Ga0453683_0278141_41_793 234
490 3300044712 Ga0453684_0031081 Ga0453684_0031081_1081_1824 234
491 3300044712 Ga0453684_0530748 Ga0453684_0530748_532_1284 234
492 3300044712 Ga0453684_0694702 Ga0453684_0694702_104_856 234
493 3300045051 Ga0451576_0005173 Ga0451576_0005173_3485_4228 234
494 3300045051 Ga0451576_0032025 Ga0451576_0032025_1622_2374 234
495 3300045051 Ga0451576_0033529 Ga0451576_0033529_1581_2324 234
496 3300045051 Ga0451576_0049699 Ga0451576_0049699_2969_3721 234
497 3300045051 Ga0451576_0053559 Ga0451576_0053559_263_1015 234
498 3300045051 Ga0451576_0264864 Ga0451576_0264864_915_1667 234
499 3300046455 Ga0495603_0084563 Ga0495603_0084563_365_1117 234
500 3300046472 Ga0495580_0016661 Ga0495580_0016661_1400_2152 234
501 3300046491 Ga0495584_0071647 Ga0495584_0071647_826_1578 234
502 3300046528 Ga0495642_0011189 Ga0495642_0011189_2483_3235 234
503 3300046558 Ga0495633_0181734 Ga0495633_0181734_190_942 234
504 3300046615 Ga0495656_0053380 Ga0495656_0053380_145_897 234
505 3300046664 Ga0495659_0037935 Ga0495659_0037935_786_1538 234
506 3300046684 Ga0495669_0027414 Ga0495669_0027414_1014_1766 234
507 3300046684 Ga0495669_0038401 Ga0495669_0038401_252_1004 234
508 3300047318 Ga0495636_0058445 Ga0495636_0058445_69_821 234
509 3300047318 Ga0495636_0098583 Ga0495636_0098583_362_1105 234
510 3300047318 Ga0495636_0188675 Ga0495636_0188675_144_896 234
511 3300048906 Ga0496103_0375382 Ga0496103_0375382_29_772 234
512 3300048909 Ga0496106_0037094 Ga0496106_0037094_2641_3393 234
513 3300048909 Ga0496106_0287039 Ga0496106_0287039_391_1143 234
514 3300048909 Ga0496106_0394127 Ga0496106_0394127_185_937 234
515 3300048913 Ga0496110_0806316 Ga0496110_0806316_16_768 234
516 3300049568 Ga0501031_0116012 Ga0501031_0116012_641_1393 234
517 3300049569 Ga0501032_0127389 Ga0501032_0127389_900_1652 234
518 3300049570 Ga0501033_0020667 Ga0501033_0020667_2065_2817 234
519 3300049570 Ga0501033_0057423 Ga0501033_0057423_503_1255 234
520 3300049570 Ga0501033_0252405 Ga0501033_0252405_132_884 234
521 3300049572 Ga0501036_0053635 Ga0501036_0053635_2022_2774 234
522 3300049574 Ga0501038_0062853 Ga0501038_0062853_2329_3081 234
523 3300049576 Ga0501040_0002756 Ga0501040_0002756_8223_8975 234
524 3300049576 Ga0501040_0030056 Ga0501040_0030056_1735_2487 234
525 3300049576 Ga0501040_0145261 Ga0501040_0145261_335_1087 234
526 3300049576 Ga0501040_0252876 Ga0501040_0252876_381_1124 234
527 3300049577 Ga0501041_0036477 Ga0501041_0036477_2152_2904 234
528 3300049577 Ga0501041_0052173 Ga0501041_0052173_1010_1756 234
529 3300049577 Ga0501041_0352247 Ga0501041_0352247_107_859 234
530 3300049578 Ga0501042_0000598 Ga0501042_0000598_14071_14823 234
531 3300049578 Ga0501042_0148671 Ga0501042_0148671_629_1375 234
532 3300049579 Ga0501043_0033816 Ga0501043_0033816_441_1193 234
533 3300049579 Ga0501043_0122969 Ga0501043_0122969_636_1388 234
534 3300049580 Ga0501046_0000240 Ga0501046_0000240_47630_48382 234
535 3300049580 Ga0501046_0055306 Ga0501046_0055306_1743_2489 234
536 3300049580 Ga0501046_0055808 Ga0501046_0055808_1550_2302 234
537 3300049581 Ga0501047_0193410 Ga0501047_0193410_598_1350 234
538 3300049582 Ga0501048_0014851 Ga0501048_0014851_553_1305 234
539 3300049582 Ga0501048_0146719 Ga0501048_0146719_97_849 234
540 3300049582 Ga0501048_0215869 Ga0501048_0215869_212_964 234
541 3300049583 Ga0501067_0269534 Ga0501067_0269534_18_770 234
542 3300049584 Ga0501068_0307817 Ga0501068_0307817_78_821 234
543 3300049587 Ga0501071_0029734 Ga0501071_0029734_1768_2520 234
544 3300049587 Ga0501071_0062699 Ga0501071_0062699_768_1514 234
545 3300049587 Ga0501071_0282300 Ga0501071_0282300_308_1060 234
546 3300049588 Ga0501072_0010731 Ga0501072_0010731_1060_1812 234
547 3300049588 Ga0501072_0011976 Ga0501072_0011976_3628_4380 234
548 3300049588 Ga0501072_0024925 Ga0501072_0024925_2139_2882 234
549 3300049588 Ga0501072_0213564 Ga0501072_0213564_387_1139 234
550 3300049589 Ga0501073_0046661 Ga0501073_0046661_161_913 234
551 3300049589 Ga0501073_0149774 Ga0501073_0149774_97_849 234
552 3300049590 Ga0501074_0048490 Ga0501074_0048490_1884_2636 234
553 3300049590 Ga0501074_0069840 Ga0501074_0069840_647_1399 234
554 3300049591 Ga0501075_0014499 Ga0501075_0014499_1581_2327 234
555 3300049591 Ga0501075_0034507 Ga0501075_0034507_1075_1827 234
556 3300049591 Ga0501075_0074095 Ga0501075_0074095_1399_2151 234
557 3300049591 Ga0501075_0109511 Ga0501075_0109511_1049_1792 234
558 3300049592 Ga0501076_0018260 Ga0501076_0018260_4180_4932 234
559 3300049592 Ga0501076_0021228 Ga0501076_0021228_1577_2329 234
560 3300049592 Ga0501076_0051267 Ga0501076_0051267_361_1113 234
561 3300049593 Ga0501077_0012026 Ga0501077_0012026_3997_4749 234
562 3300049593 Ga0501077_0046909 Ga0501077_0046909_1074_1826 234
563 3300049593 Ga0501077_0084986 Ga0501077_0084986_720_1472 234
564 3300049593 Ga0501077_0148829 Ga0501077_0148829_222_968 234
565 3300049593 Ga0501077_0356827 Ga0501077_0356827_77_829 234
566 3300049741 Ga0501079_0000962 Ga0501079_0000962_15118_15870 234
567 3300049741 Ga0501079_0022830 Ga0501079_0022830_2698_3450 234
568 3300049741 Ga0501079_0028488 Ga0501079_0028488_2979_3722 234
569 3300049741 Ga0501079_0044843 Ga0501079_0044843_746_1498 234
570 3300049741 Ga0501079_0115159 Ga0501079_0115159_446_1198 234
571 3300049741 Ga0501079_0186870 Ga0501079_0186870_320_1066 234
572 3300049742 Ga0501080_0061308 Ga0501080_0061308_1384_2136 234
573 3300049742 Ga0501080_0277362 Ga0501080_0277362_168_914 234
574 3300049742 Ga0501080_0584024 Ga0501080_0584024_130_882 234
575 3300049743 Ga0501081_0003003 Ga0501081_0003003_1603_2355 234
576 3300049743 Ga0501081_0003043 Ga0501081_0003043_1076_1828 234
577 3300049743 Ga0501081_0006739 Ga0501081_0006739_3311_4057 234
578 3300049743 Ga0501081_0018202 Ga0501081_0018202_3162_3914 234
579 3300049744 Ga0501083_0029430 Ga0501083_0029430_1892_2644 234
580 3300049822 Ga0501035_0288301 Ga0501035_0288301_457_1209 234
581 3300049824 Ga0501045_0000542 Ga0501045_0000542_11812_12564 234
582 3300049824 Ga0501045_0018403 Ga0501045_0018403_3314_4060 234
583 3300049824 Ga0501045_0026245 Ga0501045_0026245_1854_2606 234
584 3300049824 Ga0501045_0489812 Ga0501045_0489812_20_772 234
585 3300050507 nmdc:mga05p37_10296_c1 nmdc:mga05p37_10296_c1_2886_3638 234
586 3300050507 nmdc:mga05p37_10313_c1 nmdc:mga05p37_10313_c1_5686_6438 234
587 3300050507 nmdc:mga05p37_111793_c1 nmdc:mga05p37_111793_c1_1047_1799 234
588 3300050507 nmdc:mga05p37_11771_c1 nmdc:mga05p37_11771_c1_8576_9328 234
589 3300050507 nmdc:mga05p37_1188_c1 nmdc:mga05p37_1188_c1_23152_23904 234
590 3300050507 nmdc:mga05p37_212_c1 nmdc:mga05p37_212_c1_53688_54440 234
591 3300050507 nmdc:mga05p37_270065_c1 nmdc:mga05p37_270065_c1_1248_2000 234
592 3300050507 nmdc:mga05p37_335410_c1 nmdc:mga05p37_335410_c1_243_995 234
593 3300050507 nmdc:mga05p37_41471_c1 nmdc:mga05p37_41471_c1_1371_2123 234
594 3300050507 nmdc:mga05p37_7876_c1 nmdc:mga05p37_7876_c1_6975_7718 234
595 3300050508 nmdc:mga09592_11174_c1 nmdc:mga09592_11174_c1_3774_4526 234
596 3300050508 nmdc:mga09592_134764_c1 nmdc:mga09592_134764_c1_1292_2044 234
597 3300050508 nmdc:mga09592_265_c1 nmdc:mga09592_265_c1_26866_27618 234
598 3300050508 nmdc:mga09592_32798_c1 nmdc:mga09592_32798_c1_3010_3762 234
599 3300050508 nmdc:mga09592_38645_c1 nmdc:mga09592_38645_c1_751_1503 234
600 3300050508 nmdc:mga09592_3999_c1 nmdc:mga09592_3999_c1_8055_8807 234
601 3300050508 nmdc:mga09592_413686_c1 nmdc:mga09592_413686_c1_298_1050 234
602 3300050508 nmdc:mga09592_7616_c1 nmdc:mga09592_7616_c1_1783_2535 234
603 3300050508 nmdc:mga09592_92363_c1 nmdc:mga09592_92363_c1_494_1246 234
604 3300050508 nmdc:mga09592_992_c1 nmdc:mga09592_992_c1_8647_9399 234
605 3300050509 nmdc:mga0qj67_162838_c1 nmdc:mga0qj67_162838_c1_445_1197 234
606 3300050509 nmdc:mga0qj67_2490_c1 nmdc:mga0qj67_2490_c1_1144_1896 234
607 3300050509 nmdc:mga0qj67_6600_c1 nmdc:mga0qj67_6600_c1_5741_6493 234
608 3300050510 nmdc:mga06r32_100340_c1 nmdc:mga06r32_100340_c1_1432_2184 234
609 3300050510 nmdc:mga06r32_102516_c1 nmdc:mga06r32_102516_c1_1442_2194 234
610 3300050510 nmdc:mga06r32_179862_c1 nmdc:mga06r32_179862_c1_1094_1846 234
611 3300050510 nmdc:mga06r32_1850_c1 nmdc:mga06r32_1850_c1_1654_2397 234
612 3300050510 nmdc:mga06r32_2420_c1 nmdc:mga06r32_2420_c1_433_1185 234
613 3300050510 nmdc:mga06r32_26143_c1 nmdc:mga06r32_26143_c1_2961_3713 234
614 3300050510 nmdc:mga06r32_30435_c1 nmdc:mga06r32_30435_c1_1154_1906 234
615 3300050510 nmdc:mga06r32_455607_c1 nmdc:mga06r32_455607_c1_396_1139 234
616 3300050510 nmdc:mga06r32_52930_c1 nmdc:mga06r32_52930_c1_414_1166 234
617 3300050510 nmdc:mga06r32_63311_c1 nmdc:mga06r32_63311_c1_355_1107 234
618 3300050510 nmdc:mga06r32_749782_c1 nmdc:mga06r32_749782_c1_32_784 234
619 3300050510 nmdc:mga06r32_886_c1 nmdc:mga06r32_886_c1_14200_14952 234
620 3300050511 nmdc:mga08y16_350387_c1 nmdc:mga08y16_350387_c1_274_1017 234
621 3300050511 nmdc:mga08y16_5536_c1 nmdc:mga08y16_5536_c1_8791_9543 234
622 3300050511 nmdc:mga08y16_6014_c1 nmdc:mga08y16_6014_c1_3643_4386 234
623 3300050512 nmdc:mga0n895_10268_c1 nmdc:mga0n895_10268_c1_6775_7527 234
624 3300050512 nmdc:mga0n895_139945_c1 nmdc:mga0n895_139945_c1_165_908 234
625 3300050512 nmdc:mga0n895_24612_c1 nmdc:mga0n895_24612_c1_1686_2438 234
626 3300050512 nmdc:mga0n895_286848_c1 nmdc:mga0n895_286848_c1_549_1292 234
627 3300050512 nmdc:mga0n895_3081_c1 nmdc:mga0n895_3081_c1_5546_6289 234
628 3300050512 nmdc:mga0n895_33586_c1 nmdc:mga0n895_33586_c1_1065_1817 234
629 3300050512 nmdc:mga0n895_353404_c1 nmdc:mga0n895_353404_c1_439_1191 234
630 3300050512 nmdc:mga0n895_35372_c1 nmdc:mga0n895_35372_c1_1037_1789 234
631 3300050512 nmdc:mga0n895_42945_c1 nmdc:mga0n895_42945_c1_2561_3313 234
632 3300050512 nmdc:mga0n895_459722_c1 nmdc:mga0n895_459722_c1_454_1206 234
633 3300050513 nmdc:mga0rr50_1061_c1 nmdc:mga0rr50_1061_c1_12307_13059 234
634 3300050513 nmdc:mga0rr50_153051_c1 nmdc:mga0rr50_153051_c1_237_989 234
635 3300050513 nmdc:mga0rr50_168928_c1 nmdc:mga0rr50_168928_c1_31_783 234
636 3300050513 nmdc:mga0rr50_2266_c1 nmdc:mga0rr50_2266_c1_5106_5849 234
637 3300050513 nmdc:mga0rr50_401764_c1 nmdc:mga0rr50_401764_c1_212_964 234
638 3300050513 nmdc:mga0rr50_65858_c1 nmdc:mga0rr50_65858_c1_1065_1817 234
639 3300050513 nmdc:mga0rr50_7012_c1 nmdc:mga0rr50_7012_c1_552_1304 234
640 3300050514 nmdc:mga08x19_116540_c1 nmdc:mga08x19_116540_c1_404_1156 234
641 3300050514 nmdc:mga08x19_23888_c1 nmdc:mga08x19_23888_c1_2864_3607 234
642 3300050514 nmdc:mga08x19_361440_c1 nmdc:mga08x19_361440_c1_18_770 234
643 3300050515 nmdc:mga0a205_1419_c1 nmdc:mga0a205_1419_c1_2036_2779 234
644 3300050515 nmdc:mga0a205_153847_c1 nmdc:mga0a205_153847_c1_459_1211 234
645 3300050515 nmdc:mga0a205_15574_c1 nmdc:mga0a205_15574_c1_3667_4419 234
646 3300050515 nmdc:mga0a205_17378_c1 nmdc:mga0a205_17378_c1_4028_4780 234
647 3300050515 nmdc:mga0a205_259714_c1 nmdc:mga0a205_259714_c1_452_1204 234
648 3300050515 nmdc:mga0a205_3138_c2 nmdc:mga0a205_3138_c2_8330_9082 234
649 3300050515 nmdc:mga0a205_3294_c1 nmdc:mga0a205_3294_c1_3603_4346 234
650 3300050515 nmdc:mga0a205_353382_c1 nmdc:mga0a205_353382_c1_483_1235 234
651 3300050515 nmdc:mga0a205_60234_c1 nmdc:mga0a205_60234_c1_2736_3479 234
652 3300050515 nmdc:mga0a205_669355_c1 nmdc:mga0a205_669355_c1_95_847 234
653 3300050515 nmdc:mga0a205_69079_c1 nmdc:mga0a205_69079_c1_33_785 234
654 3300050515 nmdc:mga0a205_7770_c1 nmdc:mga0a205_7770_c1_8231_8974 234
655 3300054114 Ga0501084_0043575 Ga0501084_0043575_1820_2572 234
656 3300054114 Ga0501084_0060512 Ga0501084_0060512_2079_2831 234
657 3300054114 Ga0501084_0109738 Ga0501084_0109738_980_1726 234
658 3300054114 Ga0501084_0113893 Ga0501084_0113893_1407_2159 234
659 3300059423 Ga0590074_010689 Ga0590074_010689_400_1152 234
660 3300060353 Ga0501082_0000590 Ga0501082_0000590_30934_31686 234
661 3300060353 Ga0501082_0007107 Ga0501082_0007107_5886_6638 234
662 3300060353 Ga0501082_0010275 Ga0501082_0010275_5430_6182 234
663 3300060353 Ga0501082_0167219 Ga0501082_0167219_315_1061 234
664 3300060353 Ga0501082_0253139 Ga0501082_0253139_16_768 234
665 3300061734 Ga0530510_0232407 Ga0530510_0232407_293_1045 234
666 3300028379 Ga0268266_10502658 Ga0268266_105026582 235
667 3300049577 Ga0501041_0111594 Ga0501041_0111594_58_837 235
668 3300049591 Ga0501075_0045394 Ga0501075_0045394_193_963 235
669 3300049592 Ga0501076_0296881 Ga0501076_0296881_505_1275 235
670 3300049824 Ga0501045_0273232 Ga0501045_0273232_454_1233 235
671 3300054114 Ga0501084_0202675 Ga0501084_0202675_24_803 235
672 3300060353 Ga0501082_0508353 Ga0501082_0508353_231_1010 235
673 3300005518 Ga0070699_100150214 Ga0070699_1001502142 236
674 3300009094 Ga0111539_10059927 Ga0111539_100599273 236
675 3300050507 nmdc:mga05p37_182465_c1 nmdc:mga05p37_182465_c1_206_970 236
676 3300050508 nmdc:mga09592_212597_c1 nmdc:mga09592_212597_c1_725_1489 236
677 3300050509 nmdc:mga0qj67_426286_c1 nmdc:mga0qj67_426286_c1_169_933 236
678 3300061734 Ga0530510_0523958 Ga0530510_0523958_62_853 236
679 3300031824 Ga0307413_10002384 Ga0307413_100023847 237
680 3300031852 Ga0307410_10215824 Ga0307410_102158241 237
681 3300005467 Ga0070706_100389021 Ga0070706_1003890212 238
682 3300013308 Ga0157375_11082745 Ga0157375_110827452 239
683 3300025938 Ga0207704_10178895 Ga0207704_101788952 239
684 3300026121 Ga0207683_10382711 Ga0207683_103827112 239
685 3300031548 Ga0307408_100003915 Ga0307408_1000039155 239
686 3300031548 Ga0307408_100246087 Ga0307408_1002460872 239
687 3300031731 Ga0307405_10031571 Ga0307405_100315712 239
688 3300031903 Ga0307407_10370626 Ga0307407_103706261 239
689 3300031911 Ga0307412_10013219 Ga0307412_100132192 239
690 3300031911 Ga0307412_10404405 Ga0307412_104044051 239
691 3300031995 Ga0307409_100271350 Ga0307409_1002713502 239
692 3300032002 Ga0307416_100014018 Ga0307416_1000140185 239
693 3300032005 Ga0307411_10120923 Ga0307411_101209231 239
694 3300048908 Ga0496105_0061652 Ga0496105_0061652_432_1181 239
695 3300048911 Ga0496108_0022804 Ga0496108_0022804_4161_4910 239
696 3300048913 Ga0496110_0018494 Ga0496110_0018494_4976_5725 239
697 3300048914 Ga0496111_0262286 Ga0496111_0262286_361_1110 239
698 3300048917 Ga0496114_0012272 Ga0496114_0012272_1356_2105 239
699 3300002067 JGI24735J21928_10012005 JGI24735J21928_100120052 241
700 3300005563 Ga0068855_100262322 Ga0068855_1002623222 241
701 3300009545 Ga0105237_10004996 Ga0105237_100049963 241
702 3300010375 Ga0105239_10002552 Ga0105239_1000255214 241
703 3300025914 Ga0207671_10002849 Ga0207671_1000284910 241
704 3300025949 Ga0207667_10724203 Ga0207667_107242031 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

204

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

250

0.91

PF08659

KR

KR domain

12

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uzm-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9425 8 238
3u09-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae 0.9397 6 238
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9364 5 241
4nbw-assembly1.cif.gz_D crystal structure of fabg from plesiocystis pacifica 0.9362 6 237
4rzi-assembly1.cif.gz_B crystal structure of phab from synechocystis sp. pcc 6803 0.9335 6 238
ID Description Score Start End Superfamily
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 6 241 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9364 5 237 3.40.50.720
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 6 237 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9338 8 238 3.40.50.720
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 6 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G3V2G6-F1-model_v4 deleted 0.9633 147 241
AF-X1F0L5-F1-model_v4 SDR family oxidoreductase 0.9594 156 241 GO:0016616
AF-R7HG36-F1-model_v4 Short-chain dehydrogenase/reductase family protein 0.9471 6 241 GO:0016491
AF-C7Q7G2-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9454 6 241 GO:0016491
AF-S9SQ61-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.944 92 238

Feature Viewer

pLDDT pTM Quality
87.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map