F476397

General Info

Members Datasets Scaffolds Average Seq Length
705 288 1410 140

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1051082|Ga0079104_10510821
Length 143
Sequence VSSPSNTFECRWHASRQLLAAYLLAQAFALGALFLLSIPVWASLLAACACLLHGVWLLPRQILLTHPKAFCGLRRDADGWQVWNAQLCRDSLALPLLVVLRFRLRGEWRVRSICVPRDALATDVHRRLRVRLKFTRRRWAAPE

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
30 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
84 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
85 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
86 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
87 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
88 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
89 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
90 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
91 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
92 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
93 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
94 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
95 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
96 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
97 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
98 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
99 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
100 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
101 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
108 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
109 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 2511231006 Pseudomonas sp. GM17 Isolate Nodule
201 2511231010 Pseudomonas sp. GM25 Isolate Nodule
202 2511231011 Pseudomonas sp. GM30 Isolate Nodule
203 2511231012 Pseudomonas sp. GM33 Isolate Nodule
204 2511231017 Pseudomonas sp. GM55 Isolate Nodule
205 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
206 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
207 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
208 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
209 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
210 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
211 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
212 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
213 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
214 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
215 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
216 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
217 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
218 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
219 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
220 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
221 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
222 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
223 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
224 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
225 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
226 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
227 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
228 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
229 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
230 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
231 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
232 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
233 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
234 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
235 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
236 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
237 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
238 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
239 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
240 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
241 2773857673 Pseudomonas sp. 443 Isolate Unclassified
242 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
243 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
244 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
245 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
246 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
247 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
248 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
249 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
250 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
251 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
252 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
253 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
254 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
255 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
256 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
257 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
258 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
259 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
260 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
261 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
262 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
263 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
264 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
265 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
266 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
267 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
268 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
269 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
270 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
271 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
272 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
273 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
274 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
275 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
276 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
277 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
278 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
279 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
280 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
281 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
282 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
283 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
284 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
285 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
286 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
287 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
288 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.38
Metatranscriptomes 0
Isolates 12.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 2.13
Rhizoplane 4.4
Rhizosphere 78.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1051082 3300006946 Bacteria 921
2 JGI25162J39368_1000054 3300002737 Bacteria 147779
3 JGI25162J39368_1000132 3300002737 Bacteria 80803
4 JGI25163J39215_1000844 3300002771 Bacteria 7315
5 JGI25163J39215_1000977 3300002771 Bacteria 6347
6 JGI25164J39214_1000029 3300002772 Bacteria 147779
7 JGI25164J39214_1000106 3300002772 Bacteria 80803
8 JGI25165J46597_1000111 3300003214 Bacteria 147779
9 JGI25165J46597_1000217 3300003214 Bacteria 80803
10 Ga0055538_1000099 3300003751 Bacteria 70627
11 Ga0055539_1000147 3300003752 Bacteria 70627
12 Ga0055533_1000151 3300003756 Bacteria 70627
13 Ga0055532_1000108 3300003758 Bacteria 88720
14 Ga0055525_1000199 3300003759 Bacteria 70627
15 Ga0055536_1000583 3300003781 Bacteria 24873
16 Ga0055541_1000099 3300003841 Bacteria 70627
17 Ga0065714_10136744 3300005288 Bacteria 1203
18 Ga0065714_10180514 3300005288 Bacteria 965
19 Ga0065712_10325967 3300005290 Bacteria 807
20 Ga0070670_100000267 3300005331 Bacteria 46521
21 Ga0070662_100205696 3300005457 Bacteria 1564
22 Ga0070665_101468037 3300005548 Bacteria 691
23 Ga0075364_10083592 3300006051 Bacteria 2113
24 Ga0075364_10187274 3300006051 Bacteria 1401
25 Ga0075364_10266648 3300006051 Bacteria 1164
26 Ga0075432_10304610 3300006058 Bacteria 662
27 Ga0075362_10118532 3300006177 Bacteria 1251
28 Ga0075362_10129614 3300006177 Bacteria 1198
29 Ga0075362_10266671 3300006177 Bacteria 845
30 Ga0075436_100149165 3300006914 Bacteria 1645
31 Ga0075436_100881851 3300006914 Bacteria 668
32 Ga0079104_1000090 3300006946 Bacteria 132824
33 Ga0079104_1000134 3300006946 Bacteria 103774
34 Ga0079104_1041140 3300006946 Bacteria 1078
35 Ga0099826_10003760 3300006948 Bacteria 10433
36 Ga0105251_10020323 3300009011 Bacteria 3491
37 Ga0105251_10021638 3300009011 Bacteria 3353
38 Ga0105251_10041371 3300009011 Bacteria 2243
39 Ga0105251_10219512 3300009011 Bacteria 856
40 Ga0105244_10012584 3300009036 Bacteria 4991
41 Ga0105244_10128048 3300009036 Bacteria 1226
42 Ga0105244_10420730 3300009036 Bacteria 614
43 Ga0105250_10003140 3300009092 Bacteria 7936
44 Ga0105250_10412754 3300009092 Bacteria 600
45 Ga0105243_10000144 3300009148 Bacteria 81484
46 Ga0105242_12292032 3300009176 Bacteria 586
47 Ga0105249_10190333 3300009553 Bacteria 2002
48 Ga0157337_1011414 3300012483 Bacteria 702
49 Ga0157345_1000028 3300012498 Bacteria 37231
50 Ga0157373_10009220 3300013100 Bacteria 7297
51 Ga0157373_10021164 3300013100 Bacteria 4721
52 Ga0157373_10056917 3300013100 Bacteria 2774
53 Ga0157373_10200932 3300013100 Bacteria 1405
54 Ga0157373_10503145 3300013100 Bacteria 875
55 Ga0157373_11105576 3300013100 Bacteria 595
56 Ga0157371_10000230 3300013102 Bacteria 80303
57 Ga0157371_10013816 3300013102 Bacteria 6117
58 Ga0157371_10947773 3300013102 Bacteria 654
59 Ga0157370_10076758 3300013104 Bacteria 3147
60 Ga0157370_10263013 3300013104 Bacteria 1594
61 Ga0157370_10732404 3300013104 Bacteria 901
62 Ga0157369_10119570 3300013105 Bacteria 2796
63 Ga0157369_10119656 3300013105 Bacteria 2795
64 Ga0163162_10041183 3300013306 Bacteria 4621
65 Ga0157375_10393701 3300013308 Bacteria 1552
66 Ga0182008_10000783 3300014497 Bacteria 22244
67 Ga0182008_10017015 3300014497 Bacteria 3773
68 Ga0182008_10536524 3300014497 Bacteria 648
69 Ga0182006_1001311 3300015261 Bacteria 15281
70 Ga0182006_1001590 3300015261 Bacteria 13458
71 Ga0182006_1005933 3300015261 Bacteria 5742
72 Ga0182006_1105756 3300015261 Bacteria 993
73 Ga0182007_10051781 3300015262 Bacteria 1354
74 Ga0182005_1022958 3300015265 Bacteria 1707
75 Ga0182005_1050351 3300015265 Bacteria 1132
76 Ga0182005_1170483 3300015265 Bacteria 642
77 Ga0182005_1210933 3300015265 Bacteria 587
78 Ga0163161_10004555 3300017792 Bacteria 9651
79 Ga0163161_10015005 3300017792 Bacteria 5397
80 Ga0163161_10956007 3300017792 Bacteria 729
81 Ga0209760_100015 3300025207 Bacteria 176281
82 Ga0209760_100047 3300025207 Bacteria 107520
83 Ga0209784_100015 3300025224 Bacteria 482117
84 Ga0209566_100012 3300025225 Bacteria 482281
85 Ga0209674_100027 3300025226 Bacteria 482281
86 Ga0209147_100019 3300025229 Bacteria 482139
87 Ga0209563_100031 3300025230 Bacteria 482281
88 Ga0209563_100515 3300025230 Bacteria 13129
89 Ga0207427_100001 3300025231 Bacteria 1410763
90 Ga0207427_100029 3300025231 Bacteria 376678
91 Ga0209437_100003 3300025233 Bacteria 1517827
92 Ga0209437_100009 3300025233 Bacteria 915954
93 Ga0209258_100364 3300025242 Bacteria 60333
94 Ga0209646_1000199 3300025246 Bacteria 71982
95 Ga0209677_100016 3300025253 Bacteria 482117
96 Ga0209759_1006450 3300025256 Bacteria 3937
97 Ga0209233_1000007 3300025261 Bacteria 1411234
98 Ga0209233_1000032 3300025261 Bacteria 623596
99 Ga0209675_1011935 3300025291 Bacteria 2837
100 Ga0209676_1000080 3300025292 Bacteria 287400
101 Ga0209676_1003397 3300025292 Bacteria 9864
102 Ga0209050_1000117 3300025298 Bacteria 202979
103 Ga0209050_1001816 3300025298 Bacteria 20822
104 Ga0209051_1000077 3300025303 Bacteria 202959
105 Ga0209051_1028897 3300025303 Bacteria 2181
106 Ga0209257_1050473 3300025304 Bacteria 1178
107 Ga0209257_1056648 3300025304 Bacteria 1082
108 Ga0207696_1000083 3300025711 Bacteria 197352
109 Ga0207696_1012583 3300025711 Bacteria 2985
110 Ga0207696_1049592 3300025711 Bacteria 1204
111 Ga0207655_1004205 3300025728 Bacteria 10321
112 Ga0207655_1009831 3300025728 Bacteria 5891
113 Ga0207655_1010304 3300025728 Bacteria 5677
114 Ga0207655_1105394 3300025728 Bacteria 963
115 Ga0207713_1008305 3300025735 Bacteria 5996
116 Ga0207713_1016990 3300025735 Bacteria 3672
117 Ga0207713_1036422 3300025735 Bacteria 2110
118 Ga0207706_10087349 3300025933 Bacteria 2742
119 Ga0207709_10000250 3300025935 Bacteria 65488
120 Ga0207712_10091085 3300025961 Bacteria 2245
121 Ga0209281_1000013 3300027111 Bacteria 653449
122 Ga0209281_1000172 3300027111 Bacteria 151766
123 Ga0209281_1015713 3300027111 Bacteria 1571
124 Ga0209281_1037532 3300027111 Bacteria 832
125 Ga0209282_1050965 3300027666 Bacteria 2375
126 Ga0207428_10032474 3300027907 Bacteria 4294
127 Ga0207428_10112061 3300027907 Bacteria 2099
128 Ga0207428_10155769 3300027907 Bacteria 1738
129 Ga0207428_10410893 3300027907 Bacteria 990
130 Ga0207428_10481447 3300027907 Bacteria 903
131 Ga0207428_10805527 3300027907 Bacteria 667
132 Ga0207428_10884545 3300027907 Bacteria 632
133 Ga0307517_10538606 3300028786 Bacteria 586
134 Ga0316178_1048493 3300030735 Bacteria 14555
135 Ga0307408_100051624 3300031548 Bacteria 2962
136 Ga0307405_10067256 3300031731 Bacteria 2288
137 Ga0307413_10252956 3300031824 Bacteria 1308
138 Ga0307407_10056603 3300031903 Bacteria 2271
139 Ga0307407_10246726 3300031903 Bacteria 1221
140 Ga0307412_10070109 3300031911 Bacteria 2388
141 Ga0307416_100234366 3300032002 Bacteria 1772
142 Ga0307414_11427210 3300032004 Bacteria 643
143 Ga0307411_10103522 3300032005 Bacteria 2019
144 Ga0307411_10381395 3300032005 Bacteria 1159
145 Ga0307510_10054802 3300033180 Bacteria 4171
146 Ga0439438_001945 3300041405 Bacteria 9016
147 Ga0439438_002440 3300041405 Bacteria 7920
148 Ga0439438_003854 3300041405 Bacteria 5915
149 Ga0439438_009356 3300041405 Bacteria 3176
150 Ga0439438_014528 3300041405 Bacteria 2341
151 Ga0439438_015152 3300041405 Bacteria 2276
152 Ga0439438_053192 3300041405 Bacteria 1025
153 Ga0439438_059314 3300041405 Bacteria 960
154 Ga0439447_000502 3300041407 Bacteria 14543
155 Ga0439447_002323 3300041407 Bacteria 6951
156 Ga0439447_011139 3300041407 Bacteria 2637
157 Ga0439447_060517 3300041407 Bacteria 891
158 Ga0439447_088569 3300041407 Bacteria 712
159 Ga0439447_112879 3300041407 Bacteria 623
160 Ga0439466_0007459 3300041411 Bacteria 4142
161 Ga0439466_0008849 3300041411 Bacteria 3787
162 Ga0439466_0010442 3300041411 Bacteria 3451
163 Ga0439466_0027365 3300041411 Bacteria 1975
164 Ga0439466_0038434 3300041411 Bacteria 1607
165 Ga0439466_0168687 3300041411 Bacteria 668
166 Ga0451841_0539425 3300041498 Bacteria 632
167 Ga0439431_0004827 3300041997 Bacteria 2970
168 Ga0439445_0085012 3300042004 Bacteria 887
169 Ga0439445_0134961 3300042004 Bacteria 714
170 Ga0439432_006081 3300042006 Bacteria 4324
171 Ga0439432_019659 3300042006 Bacteria 2248
172 Ga0439432_032882 3300042006 Bacteria 1670
173 Ga0439432_067713 3300042006 Bacteria 1092
174 Ga0439432_137397 3300042006 Bacteria 719
175 Ga0439451_053027 3300042009 Bacteria 812
176 Ga0439452_000135 3300042010 Bacteria 55807
177 Ga0439452_000233 3300042010 Bacteria 38666
178 Ga0439452_000500 3300042010 Bacteria 21349
179 Ga0439452_008224 3300042010 Bacteria 3152
180 Ga0439452_042839 3300042010 Bacteria 1059
181 Ga0439452_051685 3300042010 Bacteria 939
182 Ga0439452_062889 3300042010 Bacteria 828
183 Ga0439456_005258 3300042013 Bacteria 2629
184 Ga0439456_006396 3300042013 Bacteria 2405
185 Ga0439456_109741 3300042013 Bacteria 628
186 Ga0439463_001060 3300042016 Bacteria 7426
187 Ga0439463_006107 3300042016 Bacteria 2989
188 Ga0450911_000292 3300042115 Bacteria 18338
189 Ga0450920_011174 3300042122 Bacteria 1671
190 Ga0450922_017496 3300042124 Bacteria 723
191 Ga0450891_014726 3300042129 Bacteria 738
192 Ga0450892_015510 3300042130 Bacteria 711
193 Ga0450900_001045 3300042136 Bacteria 2547
194 Ga0450902_002439 3300042137 Bacteria 2636
195 Ga0450902_028276 3300042137 Bacteria 941
196 Ga0450902_033232 3300042137 Bacteria 871
197 Ga0450903_002408 3300042138 Bacteria 3334
198 Ga0450903_041395 3300042138 Bacteria 681
199 Ga0450903_068904 3300042138 Bacteria 511
200 Ga0450904_002515 3300042139 Bacteria 2163
201 Ga0450905_055279 3300042142 Bacteria 654
202 Ga0450906_000365 3300042145 Bacteria 9171
203 Ga0450907_000041 3300042146 Bacteria 56455
204 Ga0450907_004429 3300042146 Bacteria 2424
205 Ga0450910_002158 3300042147 Bacteria 2571
206 Ga0450910_016516 3300042147 Bacteria 1093
207 Ga0450910_044169 3300042147 Bacteria 725
208 Ga0439446_0005290 3300042156 Bacteria 3314
209 Ga0439446_0072095 3300042156 Bacteria 1058
210 Ga0450909_004104 3300042185 Bacteria 2075
211 Ga0439434_0000189 3300042435 Bacteria 16824
212 Ga0439460_0000237 3300042461 Bacteria 11180
213 Ga0439460_0000244 3300042461 Bacteria 11102
214 Ga0450918_092649 3300042531 Bacteria 585
215 Ga0450893_0048087 3300042532 Bacteria 794
216 Ga0439440_0049062 3300042993 Bacteria 1050
217 Ga0495617_011835 3300046452 Bacteria 2975
218 Ga0495617_015738 3300046452 Bacteria 2559
219 Ga0495617_021980 3300046452 Bacteria 2155
220 Ga0495617_029311 3300046452 Bacteria 1850
221 Ga0495617_035516 3300046452 Bacteria 1673
222 Ga0495617_043263 3300046452 Bacteria 1503
223 Ga0495617_081135 3300046452 Bacteria 1062
224 Ga0495617_105275 3300046452 Bacteria 915
225 Ga0495617_111302 3300046452 Bacteria 885
226 Ga0495627_001683 3300046453 Bacteria 12175
227 Ga0495627_007877 3300046453 Bacteria 4042
228 Ga0495627_023988 3300046453 Bacteria 1992
229 Ga0495627_058651 3300046453 Bacteria 1143
230 Ga0495627_100648 3300046453 Bacteria 825
231 Ga0495592_0525989 3300046454 Bacteria 730
232 Ga0495603_0025417 3300046455 Bacteria 3581
233 Ga0495590_0000920 3300046457 Bacteria 13074
234 Ga0495590_0002563 3300046457 Bacteria 7514
235 Ga0495590_0121297 3300046457 Bacteria 937
236 Ga0495591_009294 3300046458 Bacteria 3920
237 Ga0495591_012092 3300046458 Bacteria 3231
238 Ga0495591_014423 3300046458 Bacteria 2841
239 Ga0495591_017482 3300046458 Bacteria 2461
240 Ga0495591_023300 3300046458 Bacteria 1987
241 Ga0495591_095718 3300046458 Bacteria 740
242 Ga0495591_136350 3300046458 Bacteria 593
243 Ga0495591_180684 3300046458 Bacteria 502
244 Ga0495638_0004966 3300046460 Bacteria 9989
245 Ga0495638_0006497 3300046460 Bacteria 8501
246 Ga0495638_0055267 3300046460 Bacteria 2465
247 Ga0495638_0063794 3300046460 Bacteria 2270
248 Ga0495638_0071415 3300046460 Bacteria 2123
249 Ga0495638_0146146 3300046460 Bacteria 1375
250 Ga0495638_0173488 3300046460 Bacteria 1235
251 Ga0495638_0197630 3300046460 Bacteria 1137
252 Ga0495638_0297019 3300046460 Bacteria 872
253 Ga0495638_0470231 3300046460 Bacteria 638
254 Ga0495653_0001346 3300046463 Bacteria 19072
255 Ga0495653_0023818 3300046463 Bacteria 4941
256 Ga0495650_0001786 3300046471 Bacteria 19471
257 Ga0495650_0004276 3300046471 Bacteria 9862
258 Ga0495650_0012856 3300046471 Bacteria 4471
259 Ga0495650_0014262 3300046471 Bacteria 4147
260 Ga0495650_0032146 3300046471 Bacteria 2350
261 Ga0495605_0003396 3300046474 Bacteria 9496
262 Ga0495605_0013182 3300046474 Bacteria 4566
263 Ga0495605_0014901 3300046474 Bacteria 4241
264 Ga0495605_0020247 3300046474 Bacteria 3538
265 Ga0495605_0036050 3300046474 Bacteria 2496
266 Ga0495605_0123486 3300046474 Bacteria 1172
267 Ga0495605_0225686 3300046474 Bacteria 808
268 Ga0495639_0000505 3300046475 Bacteria 18424
269 Ga0495639_0346467 3300046475 Bacteria 745
270 Ga0495584_0004653 3300046491 Bacteria 7354
271 Ga0495584_0012803 3300046491 Bacteria 4280
272 Ga0495584_0014800 3300046491 Bacteria 3975
273 Ga0495584_0040636 3300046491 Bacteria 2348
274 Ga0495584_0091340 3300046491 Bacteria 1535
275 Ga0495584_0477981 3300046491 Bacteria 634
276 Ga0495585_0000559 3300046492 Bacteria 35171
277 Ga0495585_0003008 3300046492 Bacteria 11630
278 Ga0495585_0005674 3300046492 Bacteria 7835
279 Ga0495585_0008243 3300046492 Bacteria 6326
280 Ga0495585_0032362 3300046492 Bacteria 2962
281 Ga0495585_0114257 3300046492 Bacteria 1433
282 Ga0495585_0396038 3300046492 Bacteria 665
283 Ga0495594_0345406 3300046499 Bacteria 847
284 Ga0495596_0000073 3300046500 Bacteria 74267
285 Ga0495596_0058735 3300046500 Bacteria 1499
286 Ga0495607_0001224 3300046501 Bacteria 23039
287 Ga0495607_0004193 3300046501 Bacteria 10702
288 Ga0495607_0016615 3300046501 Bacteria 4748
289 Ga0495607_0042631 3300046501 Bacteria 2688
290 Ga0495607_0050089 3300046501 Bacteria 2433
291 Ga0495607_0056723 3300046501 Bacteria 2247
292 Ga0495607_0179258 3300046501 Bacteria 1063
293 Ga0495607_0265395 3300046501 Bacteria 820
294 Ga0495607_0303669 3300046501 Bacteria 750
295 Ga0495607_0362550 3300046501 Bacteria 666
296 Ga0495607_0433864 3300046501 Bacteria 592
297 Ga0495583_0005316 3300046506 Bacteria 8792
298 Ga0495583_0029429 3300046506 Bacteria 2687
299 Ga0495606_0005454 3300046507 Bacteria 12178
300 Ga0495606_0007059 3300046507 Bacteria 10170
301 Ga0495606_0007319 3300046507 Bacteria 9929
302 Ga0495606_0007485 3300046507 Bacteria 9753
303 Ga0495606_0010240 3300046507 Bacteria 7811
304 Ga0495606_0036685 3300046507 Bacteria 3336
305 Ga0495606_0048733 3300046507 Bacteria 2783
306 Ga0495606_0309190 3300046507 Bacteria 853
307 Ga0495610_0005910 3300046512 Bacteria 8572
308 Ga0495610_0010229 3300046512 Bacteria 5849
309 Ga0495610_0015222 3300046512 Bacteria 4479
310 Ga0495610_0023274 3300046512 Bacteria 3371
311 Ga0495610_0033704 3300046512 Bacteria 2644
312 Ga0495610_0035149 3300046512 Bacteria 2575
313 Ga0495610_0048577 3300046512 Bacteria 2082
314 Ga0495610_0053606 3300046512 Bacteria 1952
315 Ga0495610_0132168 3300046512 Bacteria 1082
316 Ga0495616_0001130 3300046513 Bacteria 18916
317 Ga0495616_0001777 3300046513 Bacteria 14670
318 Ga0495616_0003757 3300046513 Bacteria 9685
319 Ga0495616_0023432 3300046513 Bacteria 3320
320 Ga0495616_0025856 3300046513 Bacteria 3130
321 Ga0495616_0029377 3300046513 Bacteria 2903
322 Ga0495616_0037259 3300046513 Bacteria 2503
323 Ga0495616_0133041 3300046513 Bacteria 1138
324 Ga0495616_0163645 3300046513 Bacteria 999
325 Ga0495616_0222346 3300046513 Bacteria 821
326 Ga0495620_0004849 3300046515 Bacteria 7550
327 Ga0495620_0069065 3300046515 Bacteria 1450
328 Ga0495620_0103433 3300046515 Bacteria 1133
329 Ga0495620_0135844 3300046515 Bacteria 963
330 Ga0495620_0252612 3300046515 Bacteria 672
331 Ga0495630_0804561 3300046517 Bacteria 717
332 Ga0495631_0000635 3300046518 Bacteria 22971
333 Ga0495631_0001850 3300046518 Bacteria 12495
334 Ga0495631_0004672 3300046518 Bacteria 7244
335 Ga0495631_0401693 3300046518 Bacteria 583
336 Ga0495632_0001435 3300046519 Bacteria 19869
337 Ga0495632_0025573 3300046519 Bacteria 3120
338 Ga0495632_0068184 3300046519 Bacteria 1714
339 Ga0495632_0081167 3300046519 Bacteria 1546
340 Ga0495632_0105937 3300046519 Bacteria 1322
341 Ga0495632_0113549 3300046519 Bacteria 1270
342 Ga0495632_0131698 3300046519 Bacteria 1163
343 Ga0495632_0232753 3300046519 Bacteria 830
344 Ga0495632_0345240 3300046519 Bacteria 655
345 Ga0495632_0350127 3300046519 Bacteria 649
346 Ga0495632_0375900 3300046519 Bacteria 623
347 Ga0495637_0001569 3300046520 Bacteria 13303
348 Ga0495637_0008406 3300046520 Bacteria 5075
349 Ga0495637_0012799 3300046520 Bacteria 4003
350 Ga0495637_0018735 3300046520 Bacteria 3207
351 Ga0495637_0019429 3300046520 Bacteria 3141
352 Ga0495637_0028371 3300046520 Bacteria 2500
353 Ga0495637_0030988 3300046520 Bacteria 2368
354 Ga0495637_0056493 3300046520 Bacteria 1624
355 Ga0495637_0121072 3300046520 Bacteria 1006
356 Ga0495637_0170015 3300046520 Bacteria 813
357 Ga0495637_0205868 3300046520 Bacteria 721
358 Ga0495643_0031523 3300046522 Bacteria 2949
359 Ga0495643_0032971 3300046522 Bacteria 2869
360 Ga0495643_0056650 3300046522 Bacteria 2091
361 Ga0495643_0133455 3300046522 Bacteria 1244
362 Ga0495643_0171075 3300046522 Bacteria 1062
363 Ga0495644_0002017 3300046523 Bacteria 8166
364 Ga0495644_0006147 3300046523 Bacteria 4666
365 Ga0495644_0019438 3300046523 Bacteria 2594
366 Ga0495648_0003497 3300046524 Bacteria 13777
367 Ga0495648_0007480 3300046524 Bacteria 8736
368 Ga0495648_0017358 3300046524 Bacteria 5147
369 Ga0495648_0027629 3300046524 Bacteria 3794
370 Ga0495648_0036886 3300046524 Bacteria 3146
371 Ga0495648_0039285 3300046524 Bacteria 3012
372 Ga0495648_0045503 3300046524 Bacteria 2729
373 Ga0495648_0074769 3300046524 Bacteria 1950
374 Ga0495648_0151852 3300046524 Bacteria 1207
375 Ga0495648_0267165 3300046524 Bacteria 817
376 Ga0495648_0377056 3300046524 Bacteria 640
377 Ga0495666_0006365 3300046526 Bacteria 5944
378 Ga0495666_0376068 3300046526 Bacteria 639
379 Ga0495642_0000097 3300046528 Bacteria 49030
380 Ga0495642_0000956 3300046528 Bacteria 13519
381 Ga0495654_0001879 3300046530 Bacteria 13957
382 Ga0495654_0017768 3300046530 Bacteria 3732
383 Ga0495654_0025486 3300046530 Bacteria 3045
384 Ga0495654_0038082 3300046530 Bacteria 2406
385 Ga0495654_0046285 3300046530 Bacteria 2143
386 Ga0495654_0053226 3300046530 Bacteria 1968
387 Ga0495654_0059510 3300046530 Bacteria 1839
388 Ga0495654_0080478 3300046530 Bacteria 1528
389 Ga0495654_0090732 3300046530 Bacteria 1418
390 Ga0495654_0120882 3300046530 Bacteria 1185
391 Ga0495654_0145879 3300046530 Bacteria 1050
392 Ga0495654_0196192 3300046530 Bacteria 866
393 Ga0495654_0226437 3300046530 Bacteria 788
394 Ga0495654_0284129 3300046530 Bacteria 679
395 Ga0495654_0288238 3300046530 Bacteria 673
396 Ga0495609_0005022 3300046538 Bacteria 7074
397 Ga0495609_0030470 3300046538 Bacteria 2455
398 Ga0495609_0103948 3300046538 Bacteria 1229
399 Ga0495609_0215477 3300046538 Bacteria 799
400 Ga0495609_0237926 3300046538 Bacteria 752
401 Ga0495609_0245372 3300046538 Bacteria 738
402 Ga0495609_0307663 3300046538 Bacteria 644
403 Ga0495609_0449111 3300046538 Bacteria 512
404 Ga0495597_0003828 3300046542 Bacteria 8549
405 Ga0495597_0007453 3300046542 Bacteria 5554
406 Ga0495597_0009234 3300046542 Bacteria 4885
407 Ga0495597_0018160 3300046542 Bacteria 3303
408 Ga0495597_0118089 3300046542 Bacteria 1107
409 Ga0495597_0131364 3300046542 Bacteria 1038
410 Ga0495622_0000912 3300046557 Bacteria 16032
411 Ga0495622_0205085 3300046557 Bacteria 877
412 Ga0495633_0002293 3300046558 Bacteria 13664
413 Ga0495633_0287081 3300046558 Bacteria 748
414 Ga0495656_0167346 3300046615 Bacteria 1072
415 Ga0495668_0000770 3300046616 Bacteria 37419
416 Ga0495668_0004101 3300046616 Bacteria 10556
417 Ga0495668_0009526 3300046616 Bacteria 5954
418 Ga0495668_0032913 3300046616 Bacteria 2914
419 Ga0495668_0487114 3300046616 Bacteria 679
420 Ga0495611_0000934 3300046648 Bacteria 15695
421 Ga0495611_0082221 3300046648 Bacteria 1482
422 Ga0495611_0359323 3300046648 Bacteria 668
423 Ga0495625_0005089 3300046660 Bacteria 12165
424 Ga0495625_0007191 3300046660 Bacteria 9751
425 Ga0495625_0009109 3300046660 Bacteria 8369
426 Ga0495625_0063687 3300046660 Bacteria 2603
427 Ga0495625_0205665 3300046660 Bacteria 1296
428 Ga0495625_0313567 3300046660 Bacteria 1000
429 Ga0495625_0374154 3300046660 Bacteria 895
430 Ga0495659_0320983 3300046664 Bacteria 657
431 Ga0495661_0003093 3300046665 Bacteria 12493
432 Ga0495661_0019300 3300046665 Bacteria 4470
433 Ga0495661_0125474 3300046665 Bacteria 1413
434 Ga0495661_0292291 3300046665 Bacteria 818
435 Ga0495661_0365698 3300046665 Bacteria 707
436 Ga0495661_0423207 3300046665 Bacteria 644
437 Ga0495588_0014890 3300046674 Bacteria 3732
438 Ga0495588_0305776 3300046674 Bacteria 837
439 Ga0495623_0041019 3300046679 Bacteria 2953
440 Ga0495646_0047683 3300046680 Bacteria 2606
441 Ga0495613_0097248 3300046689 Bacteria 2128
442 Ga0495613_1047136 3300046689 Bacteria 522
443 Ga0495624_0000167 3300046690 Bacteria 48623
444 Ga0495670_0007739 3300046691 Bacteria 5283
445 Ga0495670_0040081 3300046691 Bacteria 2336
446 Ga0495670_0063553 3300046691 Bacteria 1858
447 Ga0495670_0155348 3300046691 Bacteria 1200
448 Ga0495670_0288342 3300046691 Bacteria 879
449 Ga0495671_0000168 3300046692 Bacteria 57864
450 Ga0495671_0015419 3300046692 Bacteria 4092
451 Ga0495671_0017509 3300046692 Bacteria 3813
452 Ga0495671_0041190 3300046692 Bacteria 2326
453 Ga0495671_0044437 3300046692 Bacteria 2227
454 Ga0495671_0090060 3300046692 Bacteria 1501
455 Ga0495671_0136795 3300046692 Bacteria 1194
456 Ga0495671_0161867 3300046692 Bacteria 1088
457 Ga0495671_0196609 3300046692 Bacteria 978
458 Ga0495671_0229675 3300046692 Bacteria 897
459 Ga0495671_0522474 3300046692 Bacteria 566
460 Ga0495649_0006007 3300046694 Bacteria 7602
461 Ga0495649_0016282 3300046694 Bacteria 4214
462 Ga0495649_0017462 3300046694 Bacteria 4046
463 Ga0495649_0017528 3300046694 Bacteria 4039
464 Ga0495649_0025308 3300046694 Bacteria 3305
465 Ga0495649_0030266 3300046694 Bacteria 2990
466 Ga0495649_0034186 3300046694 Bacteria 2797
467 Ga0495649_0096608 3300046694 Bacteria 1572
468 Ga0495649_0197939 3300046694 Bacteria 1044
469 Ga0495649_0207657 3300046694 Bacteria 1015
470 Ga0495649_0360608 3300046694 Bacteria 733
471 Ga0495649_0486452 3300046694 Bacteria 614
472 Ga0495589_0000305 3300046794 Bacteria 39215
473 Ga0495589_0001652 3300046794 Bacteria 12768
474 Ga0495589_0005876 3300046794 Bacteria 6481
475 Ga0495589_0114566 3300046794 Bacteria 1300
476 Ga0495589_0129840 3300046794 Bacteria 1210
477 Ga0495589_0464807 3300046794 Bacteria 578
478 Ga0495600_0241840 3300046809 Bacteria 1150
479 Ga0495600_0437965 3300046809 Bacteria 809
480 Ga0495600_0754009 3300046809 Bacteria 582
481 Ga0495660_0028677 3300046810 Bacteria 3142
482 Ga0495660_0044679 3300046810 Bacteria 2435
483 Ga0495660_0125755 3300046810 Bacteria 1291
484 Ga0495660_0144817 3300046810 Bacteria 1178
485 Ga0495660_0153682 3300046810 Bacteria 1134
486 Ga0495660_0182510 3300046810 Bacteria 1014
487 Ga0495660_0232000 3300046810 Bacteria 864
488 Ga0495660_0301243 3300046810 Bacteria 726
489 Ga0495660_0351431 3300046810 Bacteria 655
490 Ga0495581_0012130 3300047315 Bacteria 4988
491 Ga0495604_0080603 3300047317 Bacteria 2438
492 Ga0495636_0085356 3300047318 Bacteria 1364
493 Ga0495672_0003371 3300047320 Bacteria 13732
494 Ga0495672_0008359 3300047320 Bacteria 7654
495 Ga0495672_0009540 3300047320 Bacteria 7018
496 Ga0495672_0011490 3300047320 Bacteria 6246
497 Ga0495672_0015367 3300047320 Bacteria 5200
498 Ga0495672_0048488 3300047320 Bacteria 2518
499 Ga0495672_0065702 3300047320 Bacteria 2072
500 Ga0495672_0069794 3300047320 Bacteria 1993
501 Ga0495672_0095654 3300047320 Bacteria 1621
502 Ga0495672_0154139 3300047320 Bacteria 1188
503 Ga0495676_0390063 3300047321 Bacteria 925
504 Ga0495680_0094236 3300047322 Bacteria 2240
505 Ga0495680_0612319 3300047322 Bacteria 727
506 Ga0495683_0002053 3300047323 Bacteria 12474
507 Ga0495683_0005600 3300047323 Bacteria 6961
508 Ga0495683_0026805 3300047323 Bacteria 2949
509 Ga0495683_0027333 3300047323 Bacteria 2916
510 Ga0495683_0063564 3300047323 Bacteria 1823
511 Ga0495683_0315719 3300047323 Bacteria 667
512 Ga0495687_004846 3300047443 Bacteria 8845
513 Ga0495687_027908 3300047443 Bacteria 2634
514 Ga0495675_0045221 3300047444 Bacteria 2803
515 Ga0495679_008217 3300047446 Bacteria 4262
516 Ga0495673_0001942 3300047469 Bacteria 15338
517 Ga0495673_0003117 3300047469 Bacteria 11099
518 Ga0495673_0004241 3300047469 Bacteria 9048
519 Ga0495673_0007619 3300047469 Bacteria 6194
520 Ga0495673_0024795 3300047469 Bacteria 2890
521 Ga0495673_0031244 3300047469 Bacteria 2494
522 Ga0495673_0076426 3300047469 Bacteria 1396
523 Ga0495673_0079329 3300047469 Bacteria 1363
524 Ga0495673_0134632 3300047469 Bacteria 968
525 Ga0495673_0177403 3300047469 Bacteria 808
526 Ga0495673_0177411 3300047469 Bacteria 808
527 Ga0495673_0296472 3300047469 Bacteria 580
528 Ga0495681_0000933 3300047470 Bacteria 22521
529 Ga0495681_0001629 3300047470 Bacteria 16673
530 Ga0495681_0002441 3300047470 Bacteria 13265
531 Ga0495681_0002802 3300047470 Bacteria 12338
532 Ga0495681_0004033 3300047470 Bacteria 10105
533 Ga0495681_0005072 3300047470 Bacteria 8878
534 Ga0495681_0015083 3300047470 Bacteria 4387
535 Ga0495684_0101071 3300047471 Bacteria 2180
536 Ga0495684_0114824 3300047471 Bacteria 2030
537 Ga0495686_0004515 3300047472 Bacteria 11407
538 Ga0495686_0005865 3300047472 Bacteria 9574
539 Ga0495686_0014938 3300047472 Bacteria 5325
540 Ga0495686_0024698 3300047472 Bacteria 3945
541 Ga0495593_0072891 3300047673 Bacteria 1782
542 Ga0495593_0275656 3300047673 Bacteria 841
543 Ga0495593_0460708 3300047673 Bacteria 636
544 Ga0495602_0053327 3300048088 Bacteria 3582
545 Ga0495614_0241956 3300048089 Bacteria 824
546 Ga0495626_0001227 3300048091 Bacteria 21100
547 Ga0495626_0002338 3300048091 Bacteria 13369
548 Ga0495626_0002462 3300048091 Bacteria 12817
549 Ga0495626_0003814 3300048091 Bacteria 9461
550 Ga0495626_0012513 3300048091 Bacteria 4444
551 Ga0495626_0018151 3300048091 Bacteria 3539
552 Ga0495626_0030868 3300048091 Bacteria 2582
553 Ga0495626_0042703 3300048091 Bacteria 2129
554 Ga0496106_0876860 3300048909 Bacteria 709
555 Ga0496107_0720161 3300048910 Bacteria 733
556 Ga0496116_0000126 3300048919 Bacteria 160425
557 Ga0496116_0001433 3300048919 Bacteria 26786
558 Ga0496116_0002028 3300048919 Bacteria 21733
559 Ga0496116_0031666 3300048919 Bacteria 3781
560 Ga0496116_0034437 3300048919 Bacteria 3573
561 Ga0496117_0003126 3300048920 Bacteria 19758
562 Ga0496117_0056171 3300048920 Bacteria 2744
563 Ga0496117_0061916 3300048920 Bacteria 2568
564 Ga0496118_0054873 3300048921 Bacteria 3013
565 Ga0496118_0055917 3300048921 Bacteria 2971
566 Ga0496118_0062275 3300048921 Bacteria 2756
567 Ga0496118_0063667 3300048921 Bacteria 2712
568 Ga0496118_0306082 3300048921 Bacteria 870
569 Ga0496119_0085081 3300048922 Bacteria 1811
570 Ga0496119_0141864 3300048922 Bacteria 1296
571 Ga0496119_0350768 3300048922 Bacteria 714
572 Ga0496120_0010283 3300048923 Bacteria 6545
573 Ga0496121_0000142 3300048924 Bacteria 160072
574 Ga0496121_0031977 3300048924 Bacteria 4795
575 Ga0496121_0043290 3300048924 Bacteria 3901
576 Ga0496121_0184725 3300048924 Bacteria 1501
577 Ga0496122_0011118 3300048925 Bacteria 9171
578 Ga0496122_0012431 3300048925 Bacteria 8475
579 Ga0496122_0087419 3300048925 Bacteria 2141
580 Ga0496123_0007328 3300048926 Bacteria 10451
581 Ga0496123_0057009 3300048926 Bacteria 2547
582 Ga0496123_0070804 3300048926 Bacteria 2179
583 Ga0496124_0010893 3300048927 Bacteria 9149
584 Ga0496124_0112876 3300048927 Bacteria 2184
585 Ga0496124_0424311 3300048927 Bacteria 915
586 Ga0496125_0010865 3300048928 Bacteria 9163
587 Ga0496125_0128836 3300048928 Bacteria 1786
588 Ga0496125_0202815 3300048928 Bacteria 1296
589 Ga0496125_0762435 3300048928 Bacteria 505
590 Ga0495678_009205 3300049459 Bacteria 4912
591 Ga0495678_012322 3300049459 Bacteria 4057
592 Ga0495678_015646 3300049459 Bacteria 3485
593 Ga0495678_015647 3300049459 Bacteria 3485
594 Ga0495678_025008 3300049459 Bacteria 2570
595 Ga0495678_035689 3300049459 Bacteria 2035
596 Ga0495678_036533 3300049459 Bacteria 2004
597 Ga0495678_044015 3300049459 Bacteria 1768
598 Ga0495678_048612 3300049459 Bacteria 1653
599 Ga0495678_051654 3300049459 Bacteria 1587
600 Ga0495678_115778 3300049459 Bacteria 907
601 Ga0495682_0000860 3300049460 Bacteria 18879
602 Ga0495682_0003401 3300049460 Bacteria 7077
603 Ga0495682_0029581 3300049460 Bacteria 2029
604 Ga0495682_0034055 3300049460 Bacteria 1879
605 Ga0495682_0069963 3300049460 Bacteria 1263
606 Ga0495682_0088649 3300049460 Bacteria 1111
607 Ga0495682_0354988 3300049460 Bacteria 516
608 Ga0501241_000766 3300049758 Bacteria 6877
609 nmdc:mga03683_316004_c1 3300050489 Bacteria 735
610 nmdc:mga03683_65488_c1 3300050489 Bacteria 1543
611 nmdc:mga00v17_387270_c1 3300050491 Bacteria 909
612 nmdc:mga00v17_505976_c1 3300050491 Bacteria 783
613 nmdc:mga08x19_1193429_c1 3300050514 Bacteria 540
614 nmdc:mga08x19_1324903_c1 3300050514 Bacteria 510
615 nmdc:mga08x19_137097_c1 3300050514 Bacteria 1650
616 Ga0500572_001262 3300053111 Bacteria 7126
617 2511267876 2511231006 Bacteria 6794709
618 2511291887 2511231010 Bacteria 6373152
619 2511294985 2511231011 Bacteria 6149768
620 2511304400 2511231012 Bacteria 6738011
621 2511333079 2511231017 Bacteria 6503007
622 2512328995 2512047018 Bacteria 6663241
623 2555668424 2554235341 Bacteria 6867980
624 2583790630 2582580891 Bacteria 6800976
625 2597856607 2597489887 Bacteria 6666321
626 2599355424 2599185160 Bacteria 6844013
627 2599360757 2599185161 Bacteria 6960462
628 2599367079 2599185162 Bacteria 6957254
629 2599373869 2599185163 Bacteria 6995158
630 2599380530 2599185164 Bacteria 6841688
631 2599386977 2599185165 Bacteria 6843250
632 2599392727 2599185166 Bacteria 6959206
633 2599404494 2599185168 Bacteria 6997636
634 2599462258 2599185181 Bacteria 6844519
635 2599466700 2599185182 Bacteria 6883168
636 2599483143 2599185185 Bacteria 6652270
637 2599490650 2599185186 Bacteria 6831633
638 2599505300 2599185188 Bacteria 6164180
639 2599507670 2599185189 Bacteria 5862825
640 2599805044 2599185257 Bacteria 6492581
641 2599931854 2599185300 Bacteria 6062622
642 2599945505 2599185302 Bacteria 5954930
643 2599956623 2599185304 Bacteria 5951361
644 2599985455 2599185309 Bacteria 5969593
645 2599991794 2599185310 Bacteria 6014457
646 2600002409 2599185312 Bacteria 5912071
647 2600049942 2599185320 Bacteria 5963263
648 2600214880 2599185356 Bacteria 6843884
649 2600363757 2600254931 Bacteria 6734225
650 2601774415 2600255313 Bacteria 6842543
651 2606127155 2603880199 Bacteria 6377649
652 2644624371 2643221713 Bacteria 6554480
653 2671098026 2667528171 Bacteria 6900659
654 2671768222 2671180172 Bacteria 6495783
655 2715751728 2713897148 Bacteria 5883533
656 2739256527 2738543015 Bacteria 6750701
657 2743736031 2740892503 Bacteria 6855563
658 2774136035 2773857673 Bacteria 6513460
659 2794596123 2791355520 Bacteria 5948615
660 2809216144 2808606445 Bacteria 6057339
661 2819654593 2818991456 Bacteria 6123676
662 2819703111 2818991464 Bacteria 6907494
663 2842832987 2842832357 Bacteria 5959113
664 2842839980 2842837860 Bacteria 6066181
665 2842848397 2842843487 Bacteria 6004777
666 2844668938 2844665904 Bacteria 6817974
667 2852658665 2852657418 Bacteria 6472974
668 2878031152 2878029506 Bacteria 6418441
669 2880232050 2880230671 Bacteria 6140320
670 2904522415 2904518522 Bacteria 6068986
671 2904551558 2904550169 Bacteria 6221258
672 2917072192 2917070673 Bacteria 6868303
673 2919064332 2919063839 Bacteria 6302690
674 2919386178 2919385768 Bacteria 5897293
675 2919462051 2919456309 Bacteria 6586567
676 2919491740 2919487758 Bacteria 5929766
677 2919700287 2919697872 Bacteria 6553725
678 2923155041 2923153595 Bacteria 6870622
679 2935354363 2935353572 Unclassified 6955622
680 2939637738 2939636861 Bacteria 6297853
681 2945961677 2945961074 Bacteria 7342064
682 2969305979 2969304461 Bacteria 6601805
683 2974292435 2974289157 Bacteria 6080362
684 2984290999 2984286254 Bacteria 6702062
685 2988733280 2988728565 Bacteria 6124362
686 2998141386 2998139840 Bacteria 6073514
687 3007512765 3007511990 Bacteria 6481491
688 3007616230 3007614139 Bacteria 6053559
689 3007620459 3007619802 Bacteria 6411688
690 3007723039 3007718800 Bacteria 5971527
691 3007855980 3007855910 Bacteria 5637581
692 3007863382 3007861166 Bacteria 6045338
693 637318786 637000220 Bacteria 7074893
694 8015689263 8015687852 Bacteria 6613826
695 8019770976 8019769354 Bacteria 6924660
696 8019776942 8019775933 Bacteria 6858656
697 8029999364 8029995093 Bacteria 5990776
698 8055772379 8055770955 Bacteria 6827675
699 8056127427 8056125926 Bacteria 6228218
700 8056133331 8056131705 Bacteria 6107031
701 8056169674 8056166840 Bacteria 5820959
702 8056175783 8056172158 Bacteria 6133900
703 8056180232 8056177738 Bacteria 6748268
704 8056570048 8056569372 Bacteria 5997322
705 8057803718 8057798959 Bacteria 6713499
706 Ga0079104_1051082
707 JGI25162J39368_1000054
708 JGI25162J39368_1000132
709 JGI25163J39215_1000844
710 JGI25163J39215_1000977
711 JGI25164J39214_1000029
712 JGI25164J39214_1000106
713 JGI25165J46597_1000111
714 JGI25165J46597_1000217
715 Ga0055538_1000099
716 Ga0055539_1000147
717 Ga0055533_1000151
718 Ga0055532_1000108
719 Ga0055525_1000199
720 Ga0055536_1000583
721 Ga0055541_1000099
722 Ga0065714_10136744
723 Ga0065714_10180514
724 Ga0065712_10325967
725 Ga0070670_100000267
726 Ga0070662_100205696
727 Ga0070665_101468037
728 Ga0075364_10083592
729 Ga0075364_10187274
730 Ga0075364_10266648
731 Ga0075432_10304610
732 Ga0075362_10118532
733 Ga0075362_10129614
734 Ga0075362_10266671
735 Ga0075436_100149165
736 Ga0075436_100881851
737 Ga0079104_1000090
738 Ga0079104_1000134
739 Ga0079104_1041140
740 Ga0099826_10003760
741 Ga0105251_10020323
742 Ga0105251_10021638
743 Ga0105251_10041371
744 Ga0105251_10219512
745 Ga0105244_10012584
746 Ga0105244_10128048
747 Ga0105244_10420730
748 Ga0105250_10003140
749 Ga0105250_10412754
750 Ga0105243_10000144
751 Ga0105242_12292032
752 Ga0105249_10190333
753 Ga0157337_1011414
754 Ga0157345_1000028
755 Ga0157373_10009220
756 Ga0157373_10021164
757 Ga0157373_10056917
758 Ga0157373_10200932
759 Ga0157373_10503145
760 Ga0157373_11105576
761 Ga0157371_10000230
762 Ga0157371_10013816
763 Ga0157371_10947773
764 Ga0157370_10076758
765 Ga0157370_10263013
766 Ga0157370_10732404
767 Ga0157369_10119570
768 Ga0157369_10119656
769 Ga0163162_10041183
770 Ga0157375_10393701
771 Ga0182008_10000783
772 Ga0182008_10017015
773 Ga0182008_10536524
774 Ga0182006_1001311
775 Ga0182006_1001590
776 Ga0182006_1005933
777 Ga0182006_1105756
778 Ga0182007_10051781
779 Ga0182005_1022958
780 Ga0182005_1050351
781 Ga0182005_1170483
782 Ga0182005_1210933
783 Ga0163161_10004555
784 Ga0163161_10015005
785 Ga0163161_10956007
786 Ga0209760_100015
787 Ga0209760_100047
788 Ga0209784_100015
789 Ga0209566_100012
790 Ga0209674_100027
791 Ga0209147_100019
792 Ga0209563_100031
793 Ga0209563_100515
794 Ga0207427_100001
795 Ga0207427_100029
796 Ga0209437_100003
797 Ga0209437_100009
798 Ga0209258_100364
799 Ga0209646_1000199
800 Ga0209677_100016
801 Ga0209759_1006450
802 Ga0209233_1000007
803 Ga0209233_1000032
804 Ga0209675_1011935
805 Ga0209676_1000080
806 Ga0209676_1003397
807 Ga0209050_1000117
808 Ga0209050_1001816
809 Ga0209051_1000077
810 Ga0209051_1028897
811 Ga0209257_1050473
812 Ga0209257_1056648
813 Ga0207696_1000083
814 Ga0207696_1012583
815 Ga0207696_1049592
816 Ga0207655_1004205
817 Ga0207655_1009831
818 Ga0207655_1010304
819 Ga0207655_1105394
820 Ga0207713_1008305
821 Ga0207713_1016990
822 Ga0207713_1036422
823 Ga0207706_10087349
824 Ga0207709_10000250
825 Ga0207712_10091085
826 Ga0209281_1000013
827 Ga0209281_1000172
828 Ga0209281_1015713
829 Ga0209281_1037532
830 Ga0209282_1050965
831 Ga0207428_10032474
832 Ga0207428_10112061
833 Ga0207428_10155769
834 Ga0207428_10410893
835 Ga0207428_10481447
836 Ga0207428_10805527
837 Ga0207428_10884545
838 Ga0307517_10538606
839 Ga0316178_1048493
840 Ga0307408_100051624
841 Ga0307405_10067256
842 Ga0307413_10252956
843 Ga0307407_10056603
844 Ga0307407_10246726
845 Ga0307412_10070109
846 Ga0307416_100234366
847 Ga0307414_11427210
848 Ga0307411_10103522
849 Ga0307411_10381395
850 Ga0307510_10054802
851 Ga0439438_001945
852 Ga0439438_002440
853 Ga0439438_003854
854 Ga0439438_009356
855 Ga0439438_014528
856 Ga0439438_015152
857 Ga0439438_053192
858 Ga0439438_059314
859 Ga0439447_000502
860 Ga0439447_002323
861 Ga0439447_011139
862 Ga0439447_060517
863 Ga0439447_088569
864 Ga0439447_112879
865 Ga0439466_0007459
866 Ga0439466_0008849
867 Ga0439466_0010442
868 Ga0439466_0027365
869 Ga0439466_0038434
870 Ga0439466_0168687
871 Ga0451841_0539425
872 Ga0439431_0004827
873 Ga0439445_0085012
874 Ga0439445_0134961
875 Ga0439432_006081
876 Ga0439432_019659
877 Ga0439432_032882
878 Ga0439432_067713
879 Ga0439432_137397
880 Ga0439451_053027
881 Ga0439452_000135
882 Ga0439452_000233
883 Ga0439452_000500
884 Ga0439452_008224
885 Ga0439452_042839
886 Ga0439452_051685
887 Ga0439452_062889
888 Ga0439456_005258
889 Ga0439456_006396
890 Ga0439456_109741
891 Ga0439463_001060
892 Ga0439463_006107
893 Ga0450911_000292
894 Ga0450920_011174
895 Ga0450922_017496
896 Ga0450891_014726
897 Ga0450892_015510
898 Ga0450900_001045
899 Ga0450902_002439
900 Ga0450902_028276
901 Ga0450902_033232
902 Ga0450903_002408
903 Ga0450903_041395
904 Ga0450903_068904
905 Ga0450904_002515
906 Ga0450905_055279
907 Ga0450906_000365
908 Ga0450907_000041
909 Ga0450907_004429
910 Ga0450910_002158
911 Ga0450910_016516
912 Ga0450910_044169
913 Ga0439446_0005290
914 Ga0439446_0072095
915 Ga0450909_004104
916 Ga0439434_0000189
917 Ga0439460_0000237
918 Ga0439460_0000244
919 Ga0450918_092649
920 Ga0450893_0048087
921 Ga0439440_0049062
922 Ga0495617_011835
923 Ga0495617_015738
924 Ga0495617_021980
925 Ga0495617_029311
926 Ga0495617_035516
927 Ga0495617_043263
928 Ga0495617_081135
929 Ga0495617_105275
930 Ga0495617_111302
931 Ga0495627_001683
932 Ga0495627_007877
933 Ga0495627_023988
934 Ga0495627_058651
935 Ga0495627_100648
936 Ga0495592_0525989
937 Ga0495603_0025417
938 Ga0495590_0000920
939 Ga0495590_0002563
940 Ga0495590_0121297
941 Ga0495591_009294
942 Ga0495591_012092
943 Ga0495591_014423
944 Ga0495591_017482
945 Ga0495591_023300
946 Ga0495591_095718
947 Ga0495591_136350
948 Ga0495591_180684
949 Ga0495638_0004966
950 Ga0495638_0006497
951 Ga0495638_0055267
952 Ga0495638_0063794
953 Ga0495638_0071415
954 Ga0495638_0146146
955 Ga0495638_0173488
956 Ga0495638_0197630
957 Ga0495638_0297019
958 Ga0495638_0470231
959 Ga0495653_0001346
960 Ga0495653_0023818
961 Ga0495650_0001786
962 Ga0495650_0004276
963 Ga0495650_0012856
964 Ga0495650_0014262
965 Ga0495650_0032146
966 Ga0495605_0003396
967 Ga0495605_0013182
968 Ga0495605_0014901
969 Ga0495605_0020247
970 Ga0495605_0036050
971 Ga0495605_0123486
972 Ga0495605_0225686
973 Ga0495639_0000505
974 Ga0495639_0346467
975 Ga0495584_0004653
976 Ga0495584_0012803
977 Ga0495584_0014800
978 Ga0495584_0040636
979 Ga0495584_0091340
980 Ga0495584_0477981
981 Ga0495585_0000559
982 Ga0495585_0003008
983 Ga0495585_0005674
984 Ga0495585_0008243
985 Ga0495585_0032362
986 Ga0495585_0114257
987 Ga0495585_0396038
988 Ga0495594_0345406
989 Ga0495596_0000073
990 Ga0495596_0058735
991 Ga0495607_0001224
992 Ga0495607_0004193
993 Ga0495607_0016615
994 Ga0495607_0042631
995 Ga0495607_0050089
996 Ga0495607_0056723
997 Ga0495607_0179258
998 Ga0495607_0265395
999 Ga0495607_0303669
1000 Ga0495607_0362550
1001 Ga0495607_0433864
1002 Ga0495583_0005316
1003 Ga0495583_0029429
1004 Ga0495606_0005454
1005 Ga0495606_0007059
1006 Ga0495606_0007319
1007 Ga0495606_0007485
1008 Ga0495606_0010240
1009 Ga0495606_0036685
1010 Ga0495606_0048733
1011 Ga0495606_0309190
1012 Ga0495610_0005910
1013 Ga0495610_0010229
1014 Ga0495610_0015222
1015 Ga0495610_0023274
1016 Ga0495610_0033704
1017 Ga0495610_0035149
1018 Ga0495610_0048577
1019 Ga0495610_0053606
1020 Ga0495610_0132168
1021 Ga0495616_0001130
1022 Ga0495616_0001777
1023 Ga0495616_0003757
1024 Ga0495616_0023432
1025 Ga0495616_0025856
1026 Ga0495616_0029377
1027 Ga0495616_0037259
1028 Ga0495616_0133041
1029 Ga0495616_0163645
1030 Ga0495616_0222346
1031 Ga0495620_0004849
1032 Ga0495620_0069065
1033 Ga0495620_0103433
1034 Ga0495620_0135844
1035 Ga0495620_0252612
1036 Ga0495630_0804561
1037 Ga0495631_0000635
1038 Ga0495631_0001850
1039 Ga0495631_0004672
1040 Ga0495631_0401693
1041 Ga0495632_0001435
1042 Ga0495632_0025573
1043 Ga0495632_0068184
1044 Ga0495632_0081167
1045 Ga0495632_0105937
1046 Ga0495632_0113549
1047 Ga0495632_0131698
1048 Ga0495632_0232753
1049 Ga0495632_0345240
1050 Ga0495632_0350127
1051 Ga0495632_0375900
1052 Ga0495637_0001569
1053 Ga0495637_0008406
1054 Ga0495637_0012799
1055 Ga0495637_0018735
1056 Ga0495637_0019429
1057 Ga0495637_0028371
1058 Ga0495637_0030988
1059 Ga0495637_0056493
1060 Ga0495637_0121072
1061 Ga0495637_0170015
1062 Ga0495637_0205868
1063 Ga0495643_0031523
1064 Ga0495643_0032971
1065 Ga0495643_0056650
1066 Ga0495643_0133455
1067 Ga0495643_0171075
1068 Ga0495644_0002017
1069 Ga0495644_0006147
1070 Ga0495644_0019438
1071 Ga0495648_0003497
1072 Ga0495648_0007480
1073 Ga0495648_0017358
1074 Ga0495648_0027629
1075 Ga0495648_0036886
1076 Ga0495648_0039285
1077 Ga0495648_0045503
1078 Ga0495648_0074769
1079 Ga0495648_0151852
1080 Ga0495648_0267165
1081 Ga0495648_0377056
1082 Ga0495666_0006365
1083 Ga0495666_0376068
1084 Ga0495642_0000097
1085 Ga0495642_0000956
1086 Ga0495654_0001879
1087 Ga0495654_0017768
1088 Ga0495654_0025486
1089 Ga0495654_0038082
1090 Ga0495654_0046285
1091 Ga0495654_0053226
1092 Ga0495654_0059510
1093 Ga0495654_0080478
1094 Ga0495654_0090732
1095 Ga0495654_0120882
1096 Ga0495654_0145879
1097 Ga0495654_0196192
1098 Ga0495654_0226437
1099 Ga0495654_0284129
1100 Ga0495654_0288238
1101 Ga0495609_0005022
1102 Ga0495609_0030470
1103 Ga0495609_0103948
1104 Ga0495609_0215477
1105 Ga0495609_0237926
1106 Ga0495609_0245372
1107 Ga0495609_0307663
1108 Ga0495609_0449111
1109 Ga0495597_0003828
1110 Ga0495597_0007453
1111 Ga0495597_0009234
1112 Ga0495597_0018160
1113 Ga0495597_0118089
1114 Ga0495597_0131364
1115 Ga0495622_0000912
1116 Ga0495622_0205085
1117 Ga0495633_0002293
1118 Ga0495633_0287081
1119 Ga0495656_0167346
1120 Ga0495668_0000770
1121 Ga0495668_0004101
1122 Ga0495668_0009526
1123 Ga0495668_0032913
1124 Ga0495668_0487114
1125 Ga0495611_0000934
1126 Ga0495611_0082221
1127 Ga0495611_0359323
1128 Ga0495625_0005089
1129 Ga0495625_0007191
1130 Ga0495625_0009109
1131 Ga0495625_0063687
1132 Ga0495625_0205665
1133 Ga0495625_0313567
1134 Ga0495625_0374154
1135 Ga0495659_0320983
1136 Ga0495661_0003093
1137 Ga0495661_0019300
1138 Ga0495661_0125474
1139 Ga0495661_0292291
1140 Ga0495661_0365698
1141 Ga0495661_0423207
1142 Ga0495588_0014890
1143 Ga0495588_0305776
1144 Ga0495623_0041019
1145 Ga0495646_0047683
1146 Ga0495613_0097248
1147 Ga0495613_1047136
1148 Ga0495624_0000167
1149 Ga0495670_0007739
1150 Ga0495670_0040081
1151 Ga0495670_0063553
1152 Ga0495670_0155348
1153 Ga0495670_0288342
1154 Ga0495671_0000168
1155 Ga0495671_0015419
1156 Ga0495671_0017509
1157 Ga0495671_0041190
1158 Ga0495671_0044437
1159 Ga0495671_0090060
1160 Ga0495671_0136795
1161 Ga0495671_0161867
1162 Ga0495671_0196609
1163 Ga0495671_0229675
1164 Ga0495671_0522474
1165 Ga0495649_0006007
1166 Ga0495649_0016282
1167 Ga0495649_0017462
1168 Ga0495649_0017528
1169 Ga0495649_0025308
1170 Ga0495649_0030266
1171 Ga0495649_0034186
1172 Ga0495649_0096608
1173 Ga0495649_0197939
1174 Ga0495649_0207657
1175 Ga0495649_0360608
1176 Ga0495649_0486452
1177 Ga0495589_0000305
1178 Ga0495589_0001652
1179 Ga0495589_0005876
1180 Ga0495589_0114566
1181 Ga0495589_0129840
1182 Ga0495589_0464807
1183 Ga0495600_0241840
1184 Ga0495600_0437965
1185 Ga0495600_0754009
1186 Ga0495660_0028677
1187 Ga0495660_0044679
1188 Ga0495660_0125755
1189 Ga0495660_0144817
1190 Ga0495660_0153682
1191 Ga0495660_0182510
1192 Ga0495660_0232000
1193 Ga0495660_0301243
1194 Ga0495660_0351431
1195 Ga0495581_0012130
1196 Ga0495604_0080603
1197 Ga0495636_0085356
1198 Ga0495672_0003371
1199 Ga0495672_0008359
1200 Ga0495672_0009540
1201 Ga0495672_0011490
1202 Ga0495672_0015367
1203 Ga0495672_0048488
1204 Ga0495672_0065702
1205 Ga0495672_0069794
1206 Ga0495672_0095654
1207 Ga0495672_0154139
1208 Ga0495676_0390063
1209 Ga0495680_0094236
1210 Ga0495680_0612319
1211 Ga0495683_0002053
1212 Ga0495683_0005600
1213 Ga0495683_0026805
1214 Ga0495683_0027333
1215 Ga0495683_0063564
1216 Ga0495683_0315719
1217 Ga0495687_004846
1218 Ga0495687_027908
1219 Ga0495675_0045221
1220 Ga0495679_008217
1221 Ga0495673_0001942
1222 Ga0495673_0003117
1223 Ga0495673_0004241
1224 Ga0495673_0007619
1225 Ga0495673_0024795
1226 Ga0495673_0031244
1227 Ga0495673_0076426
1228 Ga0495673_0079329
1229 Ga0495673_0134632
1230 Ga0495673_0177403
1231 Ga0495673_0177411
1232 Ga0495673_0296472
1233 Ga0495681_0000933
1234 Ga0495681_0001629
1235 Ga0495681_0002441
1236 Ga0495681_0002802
1237 Ga0495681_0004033
1238 Ga0495681_0005072
1239 Ga0495681_0015083
1240 Ga0495684_0101071
1241 Ga0495684_0114824
1242 Ga0495686_0004515
1243 Ga0495686_0005865
1244 Ga0495686_0014938
1245 Ga0495686_0024698
1246 Ga0495593_0072891
1247 Ga0495593_0275656
1248 Ga0495593_0460708
1249 Ga0495602_0053327
1250 Ga0495614_0241956
1251 Ga0495626_0001227
1252 Ga0495626_0002338
1253 Ga0495626_0002462
1254 Ga0495626_0003814
1255 Ga0495626_0012513
1256 Ga0495626_0018151
1257 Ga0495626_0030868
1258 Ga0495626_0042703
1259 Ga0496106_0876860
1260 Ga0496107_0720161
1261 Ga0496116_0000126
1262 Ga0496116_0001433
1263 Ga0496116_0002028
1264 Ga0496116_0031666
1265 Ga0496116_0034437
1266 Ga0496117_0003126
1267 Ga0496117_0056171
1268 Ga0496117_0061916
1269 Ga0496118_0054873
1270 Ga0496118_0055917
1271 Ga0496118_0062275
1272 Ga0496118_0063667
1273 Ga0496118_0306082
1274 Ga0496119_0085081
1275 Ga0496119_0141864
1276 Ga0496119_0350768
1277 Ga0496120_0010283
1278 Ga0496121_0000142
1279 Ga0496121_0031977
1280 Ga0496121_0043290
1281 Ga0496121_0184725
1282 Ga0496122_0011118
1283 Ga0496122_0012431
1284 Ga0496122_0087419
1285 Ga0496123_0007328
1286 Ga0496123_0057009
1287 Ga0496123_0070804
1288 Ga0496124_0010893
1289 Ga0496124_0112876
1290 Ga0496124_0424311
1291 Ga0496125_0010865
1292 Ga0496125_0128836
1293 Ga0496125_0202815
1294 Ga0496125_0762435
1295 Ga0495678_009205
1296 Ga0495678_012322
1297 Ga0495678_015646
1298 Ga0495678_015647
1299 Ga0495678_025008
1300 Ga0495678_035689
1301 Ga0495678_036533
1302 Ga0495678_044015
1303 Ga0495678_048612
1304 Ga0495678_051654
1305 Ga0495678_115778
1306 Ga0495682_0000860
1307 Ga0495682_0003401
1308 Ga0495682_0029581
1309 Ga0495682_0034055
1310 Ga0495682_0069963
1311 Ga0495682_0088649
1312 Ga0495682_0354988
1313 Ga0501241_000766
1314 nmdc:mga03683_316004_c1
1315 nmdc:mga03683_65488_c1
1316 nmdc:mga00v17_387270_c1
1317 nmdc:mga00v17_505976_c1
1318 nmdc:mga08x19_1193429_c1
1319 nmdc:mga08x19_1324903_c1
1320 nmdc:mga08x19_137097_c1
1321 Ga0500572_001262
1322 2511267876
1323 2511291887
1324 2511294985
1325 2511304400
1326 2511333079
1327 2512328995
1328 2555668424
1329 2583790630
1330 2597856607
1331 2599355424
1332 2599360757
1333 2599367079
1334 2599373869
1335 2599380530
1336 2599386977
1337 2599392727
1338 2599404494
1339 2599462258
1340 2599466700
1341 2599483143
1342 2599490650
1343 2599505300
1344 2599507670
1345 2599805044
1346 2599931854
1347 2599945505
1348 2599956623
1349 2599985455
1350 2599991794
1351 2600002409
1352 2600049942
1353 2600214880
1354 2600363757
1355 2601774415
1356 2606127155
1357 2644624371
1358 2671098026
1359 2671768222
1360 2715751728
1361 2739256527
1362 2743736031
1363 2774136035
1364 2794596123
1365 2809216144
1366 2819654593
1367 2819703111
1368 2842832987
1369 2842839980
1370 2842848397
1371 2844668938
1372 2852658665
1373 2878031152
1374 2880232050
1375 2904522415
1376 2904551558
1377 2917072192
1378 2919064332
1379 2919386178
1380 2919462051
1381 2919491740
1382 2919700287
1383 2923155041
1384 2935354363
1385 2939637738
1386 2945961677
1387 2969305979
1388 2974292435
1389 2984290999
1390 2988733280
1391 2998141386
1392 3007512765
1393 3007616230
1394 3007620459
1395 3007723039
1396 3007855980
1397 3007863382
1398 637318786
1399 8015689263
1400 8019770976
1401 8019776942
1402 8029999364
1403 8055772379
1404 8056127427
1405 8056133331
1406 8056169674
1407 8056175783
1408 8056180232
1409 8056570048
1410 8057803718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07254

Cpta_toxin

Membrane-bound toxin component of toxin-antitoxin system

6

136

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwk-assembly1.cif.gz_B diacylglycerol kinase solved by multi crystal multi orientation native sad 0.9127 14 46
7ak1-assembly1.cif.gz_A human malt1(329-729) in complex with a chromane urea containing inhibitor 0.7338 98 121
7ur8-assembly1.cif.gz_A 170_h_ob, a small beta-barrel de novo designed protein 0.6927 84 117
8p5d-assembly1.cif.gz_SCC spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.6004 86 117
3o4u-assembly1.cif.gz_A crystal structure of heptp with an atypically open wpd loop 0.5971 86 115
ID Description Score Start End Superfamily
af_Q7Y152_274_421_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.9416 19 50 1.20.1440.340
4brbA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9223 14 46 1.10.287.3610
5dwkB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9127 14 46 1.10.287.3610
5d57A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9112 14 46 1.10.287.3610
4uxzB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8949 14 46 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A1X9NBD6-F1-model_v4 Toxin CptA 0.9349 1 135 GO:0016020
AF-A0A177QS89-F1-model_v4 YcxB-like protein domain-containing protein 0.9326 3 135 GO:0016020
AF-K2B868-F1-model_v4 Integron gene cassette protein 0.9273 2 134 GO:0016020
AF-A0A2P5N5W7-F1-model_v4 Toxin CptA 0.9175 2 141 GO:0016020
AF-A0A545U3R1-F1-model_v4 Toxin CptA 0.916 3 135 GO:0016020

Map