F476404

General Info

Members Datasets Scaffolds Average Seq Length
705 293 1411 318

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1001480|Ga0228598_10014803
Length 377
Sequence LLDDLRALVEFAQAGSIAGAADRLYRTPSAITRQLQRLEAALGAELLDRSVKPPRLNSLGSRVLEQARDLLQRTEAMKSVASRDAEPHGLLRIGLAHALAEGTLIKPIRALTEKYPKVRLRLLSALTGELFNRLLAGELDVAVVFLPEGKTAPSPLLTNIIASDRMEIVQGAAGNIDDDWESLSRAPWVLNPSGCLLRANLIDQMERAGFTPMVAAEIHYNIHLQLALIQSGYGVGLLPARFIARNNSLDTVEVLRPPSFDLHMSVAIVRVGQLGALERAVELLEHGIRHLFEAADTTKPVTRSRRRVPAPSRHYLMAVASISIRQSFGNRAASSVVGAGRFPLKNLAYTSFIAEKSFMVLSRTTQRTTLFMLEPAA

Samples

Sample ID Description Type Environment
1 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 7.23
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 19.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0228598_1001480 3300024227 Bacteria 5168
2 SwRhRL3b_contig_17226 2162886006 Unclassified 2389
3 JGI24746J21847_1003590 3300001977 Unclassified 2443
4 JGI24737J22298_10022822 3300001990 Unclassified 1987
5 JGI24743J22301_10000391 3300001991 Unclassified 4933
6 JGI24748J21848_1001286 3300002074 Plasmid 2748
7 JGI24749J21850_1000820 3300002076 Bacteria 4457
8 JGI24744J21845_10007806 3300002077 Unclassified 2210
9 rootH1_10000877 3300003316 Bacteria 19081
10 rootH1_10000877 3300003323 Bacteria 40245
11 rootH2_10054689 3300003320 Bacteria 7192
12 rootH1_10339851 3300003323 Bacteria 1782
13 Ga0065712_10001312 3300005290 Bacteria 6484
14 Ga0065715_10091793 3300005293 Bacteria 5545
15 Ga0065707_10083813 3300005295 Bacteria 8196
16 Ga0065707_10199606 3300005295 Unclassified 1317
17 Ga0070658_10002422 3300005327 Bacteria 15621
18 Ga0070676_10001797 3300005328 Bacteria 10913
19 Ga0070676_10032469 3300005328 Unclassified 2991
20 Ga0070683_100004691 3300005329 Bacteria 11297
21 Ga0070683_100087882 3300005329 Bacteria 2915
22 Ga0070690_100003844 3300005330 Bacteria 8271
23 Ga0070690_100009570 3300005330 Bacteria 5617
24 Ga0070690_100306865 3300005330 Bacteria 1139
25 Ga0070670_100004981 3300005331 Bacteria 11175
26 Ga0070670_100026437 3300005331 Bacteria 4994
27 Ga0070677_10000565 3300005333 Bacteria 12617
28 Ga0068869_100000809 3300005334 Bacteria 17868
29 Ga0070666_10000495 3300005335 Bacteria 23727
30 Ga0070666_10014157 3300005335 Bacteria 5075
31 Ga0070666_10293171 3300005335 Unclassified 1158
32 Ga0068868_100006077 3300005338 Bacteria 8525
33 Ga0070660_100000432 3300005339 Bacteria 27735
34 Ga0070689_100000359 3300005340 Bacteria 26732
35 Ga0070689_100018603 3300005340 Bacteria 5121
36 Ga0070689_100065185 3300005340 Bacteria 2836
37 Ga0070691_10042345 3300005341 Unclassified 2155
38 Ga0070687_100000075 3300005343 Bacteria 32457
39 Ga0070687_100003726 3300005343 Bacteria 5970
40 Ga0070687_100003771 3300005343 Bacteria 5940
41 Ga0070687_100220678 3300005343 Bacteria 1161
42 Ga0070661_100000376 3300005344 Bacteria 35087
43 Ga0070661_100009954 3300005344 Bacteria 6595
44 Ga0070692_10119555 3300005345 Bacteria 1468
45 Ga0070668_100001729 3300005347 Bacteria 15874
46 Ga0070668_100273925 3300005347 Unclassified 1407
47 Ga0070669_100017768 3300005353 Bacteria 5075
48 Ga0070669_100025776 3300005353 Unclassified 4224
49 Ga0070675_100005941 3300005354 Bacteria 9351
50 Ga0070675_100243538 3300005354 Bacteria 1571
51 Ga0070671_100003699 3300005355 Bacteria 11995
52 Ga0070671_100007069 3300005355 Bacteria 8989
53 Ga0070674_100000117 3300005356 Bacteria 36761
54 Ga0070673_100000395 3300005364 Bacteria 23057
55 Ga0070673_100013391 3300005364 Bacteria 5672
56 Ga0070673_100018407 3300005364 Bacteria 4988
57 Ga0070673_100342034 3300005364 Bacteria 1326
58 Ga0070688_100000429 3300005365 Bacteria 21185
59 Ga0070688_100002165 3300005365 Bacteria 9904
60 Ga0070688_100016385 3300005365 Bacteria 4237
61 Ga0070688_100096720 3300005365 Unclassified 1940
62 Ga0070659_100000464 3300005366 Bacteria 29940
63 Ga0070667_100001501 3300005367 Bacteria 20873
64 Ga0070667_100005109 3300005367 Bacteria 10982
65 Ga0070667_100006211 3300005367 Bacteria 9938
66 Ga0070703_10037568 3300005406 Bacteria 1493
67 Ga0070709_10022544 3300005434 Unclassified 3686
68 Ga0070709_10035054 3300005434 Bacteria 3047
69 Ga0070709_10056961 3300005434 Bacteria 2474
70 Ga0070709_10211591 3300005434 Unclassified 1378
71 Ga0070709_10403020 3300005434 Bacteria 1022
72 Ga0070714_100017865 3300005435 Bacteria 5751
73 Ga0070714_100046932 3300005435 Bacteria 3666
74 Ga0070714_100070844 3300005435 Bacteria 3014
75 Ga0070714_100100833 3300005435 Bacteria 2543
76 Ga0070713_100016578 3300005436 Bacteria 5541
77 Ga0070713_100037167 3300005436 Bacteria 3936
78 Ga0070713_100168665 3300005436 Bacteria 1959
79 Ga0070713_100239917 3300005436 Unclassified 1650
80 Ga0070710_10190510 3300005437 Unclassified 1289
81 Ga0070710_10250902 3300005437 Unclassified 1137
82 Ga0070701_10017744 3300005438 Bacteria 3332
83 Ga0070701_10038203 3300005438 Bacteria 2429
84 Ga0070701_10112699 3300005438 Bacteria 1522
85 Ga0070711_100138219 3300005439 Unclassified 1823
86 Ga0070700_100007428 3300005441 Bacteria 5917
87 Ga0070694_100004992 3300005444 Bacteria 8000
88 Ga0070694_100013617 3300005444 Bacteria 5083
89 Ga0070708_100033888 3300005445 Unclassified 4438
90 Ga0070708_100369908 3300005445 Unclassified 1351
91 Ga0070663_100000532 3300005455 Bacteria 20151
92 Ga0070663_100265092 3300005455 Bacteria 1364
93 Ga0070678_100000311 3300005456 Bacteria 22630
94 Ga0070678_100020651 3300005456 Bacteria 4325
95 Ga0070662_100001208 3300005457 Bacteria 15883
96 Ga0070662_100013487 3300005457 Bacteria 5438
97 Ga0070662_100045596 3300005457 Bacteria 3147
98 Ga0070681_10000483 3300005458 Bacteria 32474
99 Ga0070681_10003239 3300005458 Bacteria 15179
100 Ga0070681_10027751 3300005458 Bacteria 5692
101 Ga0070681_10429823 3300005458 Unclassified 1232
102 Ga0068867_100001917 3300005459 Bacteria 14484
103 Ga0068867_100004664 3300005459 Bacteria 9643
104 Ga0068867_100037194 3300005459 Bacteria 3538
105 Ga0068867_100150672 3300005459 Unclassified 1826
106 Ga0068867_100185172 3300005459 Bacteria 1658
107 Ga0070685_10000591 3300005466 Bacteria 20128
108 Ga0070685_10001465 3300005466 Bacteria 12396
109 Ga0070685_10001804 3300005466 Bacteria 11156
110 Ga0070706_100009963 3300005467 Bacteria 8827
111 Ga0070706_100243727 3300005467 Unclassified 1678
112 Ga0070707_100173343 3300005468 Bacteria 2102
113 Ga0070698_100187080 3300005471 Bacteria 2008
114 Ga0070699_100002676 3300005518 Bacteria 15926
115 Ga0070699_100060378 3300005518 Bacteria 3285
116 Ga0070699_100287934 3300005518 Unclassified 1472
117 Ga0070699_100293282 3300005518 Unclassified 1459
118 Ga0070679_100012638 3300005530 Bacteria 8075
119 Ga0070679_100021836 3300005530 Bacteria 6251
120 Ga0070679_100033029 3300005530 Bacteria 5122
121 Ga0070684_100001686 3300005535 Bacteria 16057
122 Ga0070684_100011339 3300005535 Bacteria 7098
123 Ga0070684_100034869 3300005535 Unclassified 4305
124 Ga0070684_100388683 3300005535 Bacteria 1286
125 Ga0070697_100000691 3300005536 Bacteria 25221
126 Ga0070697_100053460 3300005536 Bacteria 3282
127 Ga0070697_100117832 3300005536 Bacteria 2218
128 Ga0070697_100302342 3300005536 Bacteria 1375
129 Ga0068853_100068587 3300005539 Unclassified 3083
130 Ga0068853_100073135 3300005539 Unclassified 2988
131 Ga0068853_100283767 3300005539 Unclassified 1527
132 Ga0068853_100319514 3300005539 Unclassified 1439
133 Ga0068853_100334393 3300005539 Bacteria 1406
134 Ga0070672_100002450 3300005543 Bacteria 11783
135 Ga0070672_100082502 3300005543 Bacteria 2579
136 Ga0070686_100001017 3300005544 Bacteria 16133
137 Ga0070686_100030020 3300005544 Bacteria 3313
138 Ga0070695_100101039 3300005545 Bacteria 1942
139 Ga0070696_100049057 3300005546 Bacteria 2931
140 Ga0070696_100188326 3300005546 Unclassified 1535
141 Ga0070693_100006740 3300005547 Bacteria 5578
142 Ga0070693_100112246 3300005547 Unclassified 1679
143 Ga0070693_100202690 3300005547 Bacteria 1289
144 Ga0070665_100003153 3300005548 Bacteria 17739
145 Ga0070665_100004146 3300005548 Bacteria 15246
146 Ga0070665_100007582 3300005548 Bacteria 11033
147 Ga0070665_100069356 3300005548 Bacteria 3533
148 Ga0070704_100009620 3300005549 Bacteria 5853
149 Ga0070704_100016220 3300005549 Bacteria 4703
150 Ga0070704_100047279 3300005549 Bacteria 3007
151 Ga0070704_100397151 3300005549 Unclassified 1176
152 Ga0068855_100000656 3300005563 Bacteria 42261
153 Ga0068855_100015169 3300005563 Bacteria 9280
154 Ga0068855_100101194 3300005563 Bacteria 3317
155 Ga0068855_100128188 3300005563 Bacteria 2900
156 Ga0068855_100144224 3300005563 Bacteria 2712
157 Ga0070664_100017300 3300005564 Bacteria 5919
158 Ga0070664_100018787 3300005564 Bacteria 5684
159 Ga0068857_100002115 3300005577 Bacteria 16151
160 Ga0068857_100004940 3300005577 Bacteria 11322
161 Ga0068854_100000875 3300005578 Bacteria 18072
162 Ga0068854_100009678 3300005578 Bacteria 6228
163 Ga0068854_100122347 3300005578 Bacteria 1977
164 Ga0068856_100002312 3300005614 Bacteria 19625
165 Ga0068856_100010943 3300005614 Bacteria 8803
166 Ga0068856_100024144 3300005614 Bacteria 5915
167 Ga0070702_100001982 3300005615 Bacteria 8618
168 Ga0070702_100010565 3300005615 Bacteria 4555
169 Ga0070702_100064423 3300005615 Bacteria 2144
170 Ga0068852_100001719 3300005616 Bacteria 14920
171 Ga0068852_100006876 3300005616 Bacteria 8266
172 Ga0068852_100015969 3300005616 Bacteria 5844
173 Ga0068852_100021699 3300005616 Bacteria 5135
174 Ga0068852_100151391 3300005616 Unclassified 2158
175 Ga0068859_100002000 3300005617 Bacteria 20803
176 Ga0068859_100005743 3300005617 Bacteria 12617
177 Ga0068859_100040033 3300005617 Bacteria 4704
178 Ga0068859_100057587 3300005617 Bacteria 3914
179 Ga0068859_100339478 3300005617 Unclassified 1596
180 Ga0068859_100580507 3300005617 Unclassified 1215
181 Ga0068864_100001199 3300005618 Bacteria 21527
182 Ga0068864_100008528 3300005618 Bacteria 8457
183 Ga0068864_100036587 3300005618 Bacteria 4185
184 Ga0068866_10006446 3300005718 Bacteria 4887
185 Ga0068861_100000090 3300005719 Bacteria 44319
186 Ga0068861_100066480 3300005719 Unclassified 2779
187 Ga0068851_10000638 3300005834 Bacteria 14931
188 Ga0068851_10003308 3300005834 Bacteria 7160
189 Ga0068851_10030381 3300005834 Bacteria 2679
190 Ga0068870_10000066 3300005840 Bacteria 32686
191 Ga0068863_100000550 3300005841 Bacteria 38165
192 Ga0068863_100018987 3300005841 Bacteria 6580
193 Ga0068863_100116855 3300005841 Bacteria 2542
194 Ga0068863_100461319 3300005841 Bacteria 1248
195 Ga0068858_100002494 3300005842 Bacteria 18569
196 Ga0068858_100002509 3300005842 Bacteria 18511
197 Ga0068858_100003900 3300005842 Bacteria 14731
198 Ga0068858_100022129 3300005842 Bacteria 5936
199 Ga0068858_100034322 3300005842 Bacteria 4705
200 Ga0068858_100044699 3300005842 Bacteria 4105
201 Ga0068858_100046497 3300005842 Bacteria 4023
202 Ga0068858_100068334 3300005842 Bacteria 3292
203 Ga0068858_100129639 3300005842 Bacteria 2364
204 Ga0068858_100160210 3300005842 Bacteria 2118
205 Ga0068860_100006170 3300005843 Bacteria 12054
206 Ga0068860_100009663 3300005843 Bacteria 9580
207 Ga0068860_100017577 3300005843 Bacteria 6967
208 Ga0068860_100035462 3300005843 Bacteria 4784
209 Ga0068862_100023443 3300005844 Bacteria 5171
210 Ga0081540_1006465 3300005983 Bacteria 8528
211 Ga0081539_10141951 3300005985 Bacteria 1166
212 Ga0070717_10000034 3300006028 Bacteria 127047
213 Ga0070717_10247302 3300006028 Unclassified 1574
214 Ga0070715_10084511 3300006163 Unclassified 1447
215 Ga0070716_100029024 3300006173 Bacteria 2986
216 Ga0070716_100031605 3300006173 Unclassified 2880
217 Ga0070716_100035042 3300006173 Unclassified 2757
218 Ga0070712_100112094 3300006175 Unclassified 2037
219 Ga0070712_100149908 3300006175 Unclassified 1789
220 Ga0070712_100229085 3300006175 Bacteria 1475
221 Ga0097621_100000631 3300006237 Bacteria 24844
222 Ga0097621_100000802 3300006237 Bacteria 22144
223 Ga0097621_100004601 3300006237 Bacteria 9630
224 Ga0097621_100289252 3300006237 Unclassified 1444
225 Ga0068871_100005160 3300006358 Bacteria 9134
226 Ga0068871_100040465 3300006358 Bacteria 3733
227 Ga0068871_100048216 3300006358 Bacteria 3438
228 Ga0068871_100227361 3300006358 Bacteria 1618
229 Ga0068871_100383120 3300006358 Bacteria 1249
230 Ga0075433_10042531 3300006852 Bacteria 3942
231 Ga0075433_10094265 3300006852 Bacteria 2649
232 Ga0075433_10111643 3300006852 Bacteria 2425
233 Ga0075434_100059266 3300006871 Bacteria 3806
234 Ga0075434_100084022 3300006871 Bacteria 3182
235 Ga0075434_100109226 3300006871 Bacteria 2776
236 Ga0075434_100171700 3300006871 Bacteria 2188
237 Ga0068865_100000395 3300006881 Bacteria 24331
238 Ga0068865_100017287 3300006881 Bacteria 4636
239 Ga0068865_100161093 3300006881 Bacteria 1711
240 Ga0068865_100254021 3300006881 Bacteria 1388
241 Ga0068865_100327822 3300006881 Unclassified 1234
242 Ga0075436_100012974 3300006914 Bacteria 5712
243 Ga0075436_100038412 3300006914 Unclassified 3304
244 Ga0097620_100002000 3300006931 Bacteria 20803
245 Ga0097620_100005743 3300006931 Bacteria 12617
246 Ga0097620_100040034 3300006931 Bacteria 4704
247 Ga0097620_100057590 3300006931 Bacteria 3914
248 Ga0097620_100339485 3300006931 Unclassified 1596
249 Ga0097620_100580521 3300006931 Unclassified 1215
250 Ga0075435_100002692 3300007076 Bacteria 11865
251 Ga0075435_100148265 3300007076 Unclassified 1971
252 Ga0075435_100332377 3300007076 Unclassified 1301
253 Ga0099794_10018501 3300007265 Bacteria 3125
254 Ga0099794_10020620 3300007265 Unclassified 2985
255 Ga0099795_10013875 3300007788 Bacteria 2484
256 Ga0105250_10036181 3300009092 Unclassified 1981
257 Ga0105240_10003275 3300009093 Bacteria 25313
258 Ga0105240_10010848 3300009093 Bacteria 12760
259 Ga0105240_10043748 3300009093 Bacteria 5694
260 Ga0105240_10136465 3300009093 Unclassified 2937
261 Ga0105240_10153322 3300009093 Bacteria 2743
262 Ga0105240_10350120 3300009093 Bacteria 1676
263 Ga0105240_10419426 3300009093 Unclassified 1504
264 Ga0105240_10617350 3300009093 Bacteria 1192
265 Ga0105245_10000889 3300009098 Bacteria 27201
266 Ga0105245_10008188 3300009098 Bacteria 9144
267 Ga0105245_10045798 3300009098 Bacteria 3907
268 Ga0105245_10302554 3300009098 Bacteria 1570
269 Ga0105245_10514541 3300009098 Bacteria 1215
270 Ga0105247_10000513 3300009101 Bacteria 31766
271 Ga0105247_10123138 3300009101 Unclassified 1682
272 Ga0114129_10105033 3300009147 Bacteria 3904
273 Ga0105243_10002428 3300009148 Bacteria 15584
274 Ga0105243_10008743 3300009148 Bacteria 7762
275 Ga0105243_10017159 3300009148 Bacteria 5475
276 Ga0105241_10001578 3300009174 Bacteria 17423
277 Ga0105241_10080189 3300009174 Bacteria 2554
278 Ga0105241_10118651 3300009174 Unclassified 2127
279 Ga0105241_10130063 3300009174 Unclassified 2037
280 Ga0105242_10000725 3300009176 Bacteria 25717
281 Ga0105242_10006529 3300009176 Bacteria 8978
282 Ga0105242_10015540 3300009176 Bacteria 5912
283 Ga0105242_10048900 3300009176 Bacteria 3438
284 Ga0105248_10005149 3300009177 Bacteria 14416
285 Ga0105248_10005587 3300009177 Bacteria 13822
286 Ga0105248_10040133 3300009177 Bacteria 5247
287 Ga0105248_10106563 3300009177 Bacteria 3160
288 Ga0105237_10001282 3300009545 Bacteria 33518
289 Ga0105237_10146696 3300009545 Bacteria 2354
290 Ga0105237_10229705 3300009545 Bacteria 1856
291 Ga0105238_10000841 3300009551 Bacteria 31739
292 Ga0105238_10000991 3300009551 Bacteria 29014
293 Ga0105249_10000538 3300009553 Bacteria 35017
294 Ga0105249_10561574 3300009553 Unclassified 1193
295 Ga0099796_10006762 3300010159 Bacteria 2957
296 Ga0105239_10003280 3300010375 Bacteria 19956
297 Ga0105239_10095646 3300010375 Unclassified 3281
298 Ga0105246_10000697 3300011119 Bacteria 18938
299 Ga0157342_1003842 3300012507 Unclassified 1307
300 Ga0157373_10001273 3300013100 Bacteria 19276
301 Ga0157373_10066893 3300013100 Unclassified 2541
302 Ga0157371_10002386 3300013102 Bacteria 17971
303 Ga0157371_10028917 3300013102 Bacteria 4013
304 Ga0157370_10060650 3300013104 Bacteria 3591
305 Ga0157370_10270697 3300013104 Unclassified 1569
306 Ga0157369_10000204 3300013105 Bacteria 82045
307 Ga0157369_10003441 3300013105 Bacteria 18771
308 Ga0157369_10014774 3300013105 Bacteria 8809
309 Ga0157369_10063126 3300013105 Bacteria 3992
310 Ga0157374_10004167 3300013296 Bacteria 12138
311 Ga0157374_10006223 3300013296 Bacteria 10120
312 Ga0157374_10058350 3300013296 Bacteria 3606
313 Ga0157378_10002227 3300013297 Bacteria 17202
314 Ga0157378_10002899 3300013297 Bacteria 15264
315 Ga0157378_10061508 3300013297 Unclassified 3351
316 Ga0163162_10001792 3300013306 Bacteria 20152
317 Ga0163162_10007031 3300013306 Bacteria 10914
318 Ga0163162_10025556 3300013306 Bacteria 5836
319 Ga0163162_10572531 3300013306 Bacteria 1257
320 Ga0157372_10000938 3300013307 Bacteria 31857
321 Ga0157372_10003455 3300013307 Bacteria 17048
322 Ga0157372_10044934 3300013307 Bacteria 4896
323 Ga0157372_10333177 3300013307 Bacteria 1767
324 Ga0157372_10443737 3300013307 Bacteria 1512
325 Ga0157372_10449963 3300013307 Bacteria 1501
326 Ga0157375_10007627 3300013308 Bacteria 9464
327 Ga0157375_10017232 3300013308 Bacteria 6513
328 Ga0157375_10026186 3300013308 Bacteria 5431
329 Ga0157375_10026408 3300013308 Bacteria 5411
330 Ga0157375_10082012 3300013308 Bacteria 3266
331 Ga0163163_10000005 3300014325 Bacteria 369548
332 Ga0163163_10005380 3300014325 Bacteria 11064
333 Ga0163163_10009577 3300014325 Bacteria 8657
334 Ga0163163_10079819 3300014325 Bacteria 3271
335 Ga0163163_10087627 3300014325 Bacteria 3123
336 Ga0163163_10232362 3300014325 Bacteria 1893
337 Ga0157377_10014190 3300014745 Unclassified 4049
338 Ga0157379_10002533 3300014968 Bacteria 15321
339 Ga0157379_10002832 3300014968 Bacteria 14622
340 Ga0157379_10003697 3300014968 Bacteria 13012
341 Ga0157379_10040827 3300014968 Bacteria 4142
342 Ga0157379_10141662 3300014968 Bacteria 2167
343 Ga0157379_10178642 3300014968 Unclassified 1917
344 Ga0157376_10001001 3300014969 Bacteria 18414
345 Ga0157376_10004976 3300014969 Bacteria 9265
346 Ga0157376_10107903 3300014969 Unclassified 2445
347 Ga0163161_10044961 3300017792 Unclassified 3182
348 Ga0213876_10024130 3300021384 Bacteria 3210
349 Ga0207697_10000769 3300025315 Bacteria 18175
350 Ga0207656_10001590 3300025321 Bacteria 7559
351 Ga0207656_10002766 3300025321 Bacteria 5956
352 Ga0207656_10037730 3300025321 Bacteria 2035
353 Ga0207653_10009984 3300025885 Unclassified 2961
354 Ga0207653_10016042 3300025885 Bacteria 2352
355 Ga0207682_10000952 3300025893 Bacteria 13429
356 Ga0207642_10000161 3300025899 Bacteria 19124
357 Ga0207642_10059116 3300025899 Bacteria 1771
358 Ga0207710_10002672 3300025900 Bacteria 8201
359 Ga0207688_10000036 3300025901 Bacteria 45651
360 Ga0207680_10001207 3300025903 Bacteria 12237
361 Ga0207680_10004309 3300025903 Bacteria 6744
362 Ga0207680_10014854 3300025903 Bacteria 4046
363 Ga0207680_10055199 3300025903 Unclassified 2393
364 Ga0207647_10001314 3300025904 Bacteria 19085
365 Ga0207685_10017861 3300025905 Bacteria 2305
366 Ga0207699_10003623 3300025906 Bacteria 7384
367 Ga0207699_10004959 3300025906 Bacteria 6363
368 Ga0207699_10007957 3300025906 Bacteria 5204
369 Ga0207699_10017652 3300025906 Unclassified 3763
370 Ga0207699_10146995 3300025906 Bacteria 1555
371 Ga0207645_10000493 3300025907 Bacteria 32522
372 Ga0207645_10001498 3300025907 Bacteria 19105
373 Ga0207643_10000006 3300025908 Bacteria 175924
374 Ga0207705_10014191 3300025909 Bacteria 5739
375 Ga0207684_10012001 3300025910 Bacteria 7545
376 Ga0207684_10037406 3300025910 Unclassified 4118
377 Ga0207684_10075220 3300025910 Bacteria 2870
378 Ga0207684_10132980 3300025910 Bacteria 2135
379 Ga0207654_10007915 3300025911 Bacteria 5358
380 Ga0207654_10052052 3300025911 Bacteria 2359
381 Ga0207654_10198978 3300025911 Bacteria 1318
382 Ga0207707_10004762 3300025912 Bacteria 11895
383 Ga0207707_10018919 3300025912 Bacteria 6004
384 Ga0207707_10110925 3300025912 Unclassified 2398
385 Ga0207707_10115999 3300025912 Unclassified 2340
386 Ga0207707_10290326 3300025912 Unclassified 1415
387 Ga0207695_10007028 3300025913 Bacteria 14444
388 Ga0207695_10025634 3300025913 Bacteria 6595
389 Ga0207695_10057852 3300025913 Bacteria 4026
390 Ga0207695_10063519 3300025913 Bacteria 3806
391 Ga0207695_10122846 3300025913 Bacteria 2562
392 Ga0207695_10245152 3300025913 Bacteria 1692
393 Ga0207695_10415910 3300025913 Unclassified 1229
394 Ga0207671_10001581 3300025914 Bacteria 25872
395 Ga0207671_10085088 3300025914 Bacteria 2375
396 Ga0207671_10272033 3300025914 Bacteria 1335
397 Ga0207693_10004475 3300025915 Bacteria 11819
398 Ga0207693_10008125 3300025915 Bacteria 8601
399 Ga0207693_10216578 3300025915 Bacteria 1505
400 Ga0207663_10000776 3300025916 Bacteria 14293
401 Ga0207663_10012147 3300025916 Bacteria 4646
402 Ga0207663_10015988 3300025916 Unclassified 4151
403 Ga0207663_10222138 3300025916 Bacteria 1375
404 Ga0207660_10021352 3300025917 Unclassified 4354
405 Ga0207660_10043088 3300025917 Bacteria 3170
406 Ga0207660_10138866 3300025917 Unclassified 1856
407 Ga0207660_10473096 3300025917 Unclassified 1015
408 Ga0207662_10000058 3300025918 Bacteria 49029
409 Ga0207662_10001436 3300025918 Bacteria 11559
410 Ga0207662_10008037 3300025918 Bacteria 5756
411 Ga0207662_10008666 3300025918 Bacteria 5578
412 Ga0207657_10000287 3300025919 Bacteria 53627
413 Ga0207657_10185247 3300025919 Bacteria 1681
414 Ga0207649_10007844 3300025920 Bacteria 5808
415 Ga0207649_10017513 3300025920 Bacteria 4061
416 Ga0207649_10135422 3300025920 Unclassified 1679
417 Ga0207652_10058207 3300025921 Bacteria 3330
418 Ga0207652_10075214 3300025921 Unclassified 2943
419 Ga0207681_10002435 3300025923 Bacteria 11800
420 Ga0207694_10001374 3300025924 Bacteria 20950
421 Ga0207694_10002438 3300025924 Bacteria 15161
422 Ga0207694_10018408 3300025924 Bacteria 5279
423 Ga0207650_10001667 3300025925 Bacteria 15809
424 Ga0207659_10000084 3300025926 Bacteria 56518
425 Ga0207659_10002106 3300025926 Bacteria 11787
426 Ga0207659_10258057 3300025926 Bacteria 1417
427 Ga0207687_10002350 3300025927 Bacteria 12858
428 Ga0207700_10043751 3300025928 Unclassified 3291
429 Ga0207700_10053421 3300025928 Unclassified 3027
430 Ga0207664_10015043 3300025929 Bacteria 5604
431 Ga0207664_10221152 3300025929 Bacteria 1642
432 Ga0207664_10529602 3300025929 Bacteria 1056
433 Ga0207644_10000310 3300025931 Bacteria 31669
434 Ga0207644_10073915 3300025931 Unclassified 2500
435 Ga0207644_10145009 3300025931 Bacteria 1832
436 Ga0207690_10005075 3300025932 Bacteria 7777
437 Ga0207706_10000536 3300025933 Bacteria 40290
438 Ga0207706_10002695 3300025933 Bacteria 17320
439 Ga0207706_10308473 3300025933 Unclassified 1378
440 Ga0207686_10000985 3300025934 Bacteria 16956
441 Ga0207686_10004417 3300025934 Bacteria 7543
442 Ga0207686_10006126 3300025934 Bacteria 6460
443 Ga0207686_10025201 3300025934 Bacteria 3456
444 Ga0207686_10040510 3300025934 Plasmid 2833
445 Ga0207709_10004600 3300025935 Bacteria 7942
446 Ga0207709_10037271 3300025935 Bacteria 2888
447 Ga0207709_10047124 3300025935 Unclassified 2619
448 Ga0207670_10000465 3300025936 Bacteria 22581
449 Ga0207670_10006220 3300025936 Bacteria 6611
450 Ga0207670_10154113 3300025936 Bacteria 1708
451 Ga0207669_10044367 3300025937 Unclassified 2611
452 Ga0207704_10000202 3300025938 Bacteria 30625
453 Ga0207704_10000227 3300025938 Bacteria 27993
454 Ga0207704_10000884 3300025938 Bacteria 13285
455 Ga0207704_10011384 3300025938 Bacteria 4378
456 Ga0207704_10186722 3300025938 Bacteria 1504
457 Ga0207665_10026649 3300025939 Unclassified 3816
458 Ga0207665_10138957 3300025939 Unclassified 1730
459 Ga0207665_10172531 3300025939 Bacteria 1562
460 Ga0207691_10000158 3300025940 Bacteria 63253
461 Ga0207711_10002197 3300025941 Bacteria 17511
462 Ga0207711_10002262 3300025941 Bacteria 17276
463 Ga0207711_10021749 3300025941 Bacteria 5357
464 Ga0207711_10028169 3300025941 Bacteria 4726
465 Ga0207689_10002916 3300025942 Bacteria 15787
466 Ga0207689_10014871 3300025942 Bacteria 6605
467 Ga0207689_10155695 3300025942 Bacteria 1884
468 Ga0207661_10010988 3300025944 Bacteria 6540
469 Ga0207661_10031092 3300025944 Bacteria 4119
470 Ga0207661_10037270 3300025944 Bacteria 3802
471 Ga0207679_10000285 3300025945 Bacteria 38370
472 Ga0207679_10011834 3300025945 Bacteria 5671
473 Ga0207667_10001685 3300025949 Bacteria 27840
474 Ga0207667_10004549 3300025949 Bacteria 16995
475 Ga0207667_10029855 3300025949 Bacteria 5906
476 Ga0207667_10110814 3300025949 Bacteria 2831
477 Ga0207667_10207899 3300025949 Bacteria 2006
478 Ga0207651_10000236 3300025960 Bacteria 23920
479 Ga0207712_10000430 3300025961 Bacteria 35819
480 Ga0207668_10068553 3300025972 Unclassified 2522
481 Ga0207640_10000231 3300025981 Bacteria 38522
482 Ga0207640_10021151 3300025981 Bacteria 3872
483 Ga0207658_10000226 3300025986 Bacteria 59037
484 Ga0207658_10012398 3300025986 Bacteria 5822
485 Ga0207658_10073671 3300025986 Unclassified 2592
486 Ga0207658_10268181 3300025986 Unclassified 1458
487 Ga0207677_10000139 3300026023 Bacteria 59238
488 Ga0207703_10000744 3300026035 Bacteria 32129
489 Ga0207703_10001032 3300026035 Bacteria 26743
490 Ga0207703_10059034 3300026035 Bacteria 3134
491 Ga0207703_10082076 3300026035 Bacteria 2689
492 Ga0207703_10119404 3300026035 Bacteria 2261
493 Ga0207703_10332788 3300026035 Unclassified 1393
494 Ga0207703_10423434 3300026035 Bacteria 1239
495 Ga0207639_10000013 3300026041 Bacteria 293084
496 Ga0207639_10000301 3300026041 Bacteria 34996
497 Ga0207678_10002930 3300026067 Bacteria 15467
498 Ga0207678_10015349 3300026067 Bacteria 6737
499 Ga0207678_10046215 3300026067 Bacteria 3765
500 Ga0207702_10002096 3300026078 Bacteria 19216
501 Ga0207702_10004872 3300026078 Bacteria 11818
502 Ga0207702_10040707 3300026078 Bacteria 3895
503 Ga0207702_10047332 3300026078 Bacteria 3624
504 Ga0207702_10141262 3300026078 Unclassified 2179
505 Ga0207641_10009128 3300026088 Bacteria 8189
506 Ga0207641_10016219 3300026088 Bacteria 6101
507 Ga0207641_10088064 3300026088 Bacteria 2710
508 Ga0207641_10228425 3300026088 Bacteria 1729
509 Ga0207648_10003801 3300026089 Bacteria 15787
510 Ga0207648_10005082 3300026089 Bacteria 13332
511 Ga0207648_10186284 3300026089 Bacteria 1839
512 Ga0207648_10198440 3300026089 Bacteria 1779
513 Ga0207676_10000525 3300026095 Bacteria 32174
514 Ga0207676_10013565 3300026095 Bacteria 5849
515 Ga0207676_10116267 3300026095 Unclassified 2247
516 Ga0207676_10592699 3300026095 Unclassified 1064
517 Ga0207674_10000302 3300026116 Bacteria 62546
518 Ga0207674_10008636 3300026116 Bacteria 11738
519 Ga0207674_10143934 3300026116 Bacteria 2343
520 Ga0207674_10538337 3300026116 Unclassified 1128
521 Ga0207675_100002753 3300026118 Bacteria 17283
522 Ga0207675_100006946 3300026118 Bacteria 10709
523 Ga0207683_10002149 3300026121 Bacteria 17319
524 Ga0207683_10004562 3300026121 Bacteria 11929
525 Ga0207683_10124571 3300026121 Bacteria 2315
526 Ga0207698_10000778 3300026142 Bacteria 18550
527 Ga0207698_10012184 3300026142 Bacteria 5614
528 Ga0207698_10012253 3300026142 Bacteria 5603
529 Ga0209179_1017216 3300027512 Bacteria 1367
530 Ga0265357_1002467 3300028023 Unclassified 1516
531 Ga0268266_10001085 3300028379 Bacteria 34116
532 Ga0268266_10010120 3300028379 Bacteria 8268
533 Ga0268266_10012883 3300028379 Bacteria 7219
534 Ga0268266_10134877 3300028379 Bacteria 2210
535 Ga0268266_10180023 3300028379 Bacteria 1924
536 Ga0268265_10000337 3300028380 Bacteria 50945
537 Ga0268264_10000851 3300028381 Bacteria 32561
538 Ga0268264_10049582 3300028381 Bacteria 3494
539 Ga0268264_10066246 3300028381 Unclassified 3045
540 Ga0373950_0011152 3300034818 Bacteria 1464
541 Ga0373959_0015981 3300034820 Bacteria 1385
542 Ga0373929_0004504 3300035085 Bacteria 2494
543 Ga0373934_0018833 3300035086 Unclassified 2644
544 Ga0373944_0009517 3300035089 Bacteria 2636
545 Ga0373923_0018397 3300035111 Bacteria 2688
546 Ga0373932_0007020 3300035112 Bacteria 2675
547 Ga0373936_0039107 3300035113 Bacteria 1898
548 Ga0373939_0047719 3300035114 Bacteria 1316
549 Ga0373945_0029580 3300035116 Bacteria 1925
550 Ga0373953_0002623 3300035117 Bacteria 5438
551 Ga0373954_0011246 3300035118 Bacteria 3962
552 Ga0373956_0005444 3300035119 Bacteria 5098
553 Ga0373957_0000926 3300035120 Bacteria 7681
554 Ga0373946_0040610 3300035171 Unclassified 1904
555 Ga0373955_0017115 3300035172 Unclassified 3581
556 Ga0373955_0033353 3300035172 Bacteria 2711
557 Ga0373955_0072550 3300035172 Bacteria 1928
558 Ga0373942_0001186 3300035207 Bacteria 6880
559 Ga0373961_0003320 3300035241 Bacteria 3999
560 Ga0373935_0051092 3300035692 Unclassified 2625
561 Ga0373927_0000002 3300035695 Bacteria 966219
562 Ga0373927_0003289 3300035695 Bacteria 11625
563 Ga0373933_0017095 3300035724 Bacteria 4067
564 Ga0373947_0087084 3300035725 Unclassified 1942
565 Ga0373937_0039453 3300036401 Unclassified 4303
566 Ga0373937_0158435 3300036401 Bacteria 2122
567 Ga0373937_0356667 3300036401 Bacteria 1385
568 Ga0373937_0522022 3300036401 Bacteria 1128
569 Ga0373937_0662681 3300036401 Unclassified 989
570 Ga0373925_0001491 3300037068 Bacteria 20107
571 Ga0373925_0002736 3300037068 Bacteria 13953
572 Ga0436365_0331968 3300039437 Bacteria 11197
573 Ga0436365_0974486 3300039437 Unclassified 2495
574 Ga0436365_1618990 3300039437 Bacteria 1605
575 Ga0436363_0769682 3300039450 Bacteria 1261
576 Ga0436363_1101025 3300039450 Bacteria 9025
577 Ga0451577_0021412 3300042876 Bacteria 5917
578 Ga0453683_0034709 3300044673 Bacteria 3179
579 Ga0466959_0002177 3300045049 Bacteria 12460
580 Ga0451576_0011992 3300045051 Bacteria 9788
581 Ga0451576_0028567 3300045051 Bacteria 5971
582 Ga0451576_0204434 3300045051 Bacteria 2062
583 Ga0495592_0117256 3300046454 Unclassified 1877
584 Ga0495603_0162849 3300046455 Bacteria 1294
585 Ga0495629_0014013 3300046459 Bacteria 5778
586 Ga0495653_0256785 3300046463 Bacteria 1157
587 Ga0495580_0004169 3300046472 Bacteria 12158
588 Ga0495580_0063065 3300046472 Bacteria 2600
589 Ga0495580_0070136 3300046472 Bacteria 2448
590 Ga0495580_0123182 3300046472 Bacteria 1799
591 Ga0495639_0005130 3300046475 Bacteria 5627
592 Ga0495639_0038437 3300046475 Unclassified 2149
593 Ga0495662_0024979 3300046476 Bacteria 2885
594 Ga0495662_0055275 3300046476 Bacteria 1918
595 Ga0495594_0039110 3300046499 Bacteria 2592
596 Ga0495608_0002384 3300046511 Bacteria 13511
597 Ga0495628_0141900 3300046516 Bacteria 1833
598 Ga0495630_0140515 3300046517 Bacteria 1836
599 Ga0495630_0330969 3300046517 Unclassified 1165
600 Ga0495666_0003273 3300046526 Bacteria 8175
601 Ga0495665_0076022 3300046531 Bacteria 1767
602 Ga0495586_0001734 3300046535 Bacteria 11890
603 Ga0495586_0020456 3300046535 Bacteria 3524
604 Ga0495586_0154189 3300046535 Bacteria 1293
605 Ga0495587_0025081 3300046536 Bacteria 3646
606 Ga0495587_0149087 3300046536 Unclassified 1333
607 Ga0495645_0041363 3300046543 Bacteria 3361
608 Ga0495645_0050149 3300046543 Bacteria 3039
609 Ga0495667_0022298 3300046559 Bacteria 4266
610 Ga0495635_0040303 3300046663 Bacteria 3227
611 Ga0495635_0266231 3300046663 Bacteria 1153
612 Ga0495647_0029969 3300046681 Bacteria 2016
613 Ga0495658_0010096 3300046683 Unclassified 4717
614 Ga0495658_0027054 3300046683 Unclassified 3081
615 Ga0495658_0059082 3300046683 Bacteria 2195
616 Ga0495658_0136958 3300046683 Bacteria 1494
617 Ga0495613_0039829 3300046689 Bacteria 3482
618 Ga0495613_0055576 3300046689 Bacteria 2908
619 Ga0495613_0144619 3300046689 Bacteria 1697
620 Ga0495624_0041188 3300046690 Bacteria 2956
621 Ga0495624_0056175 3300046690 Unclassified 2478
622 Ga0495600_0030591 3300046809 Bacteria 3487
623 Ga0495581_0124705 3300047315 Bacteria 1499
624 Ga0495581_0128620 3300047315 Unclassified 1476
625 Ga0495674_0089577 3300047319 Bacteria 2630
626 Ga0495674_0158279 3300047319 Bacteria 1896
627 Ga0495674_0290172 3300047319 Unclassified 1338
628 Ga0495676_0006246 3300047321 Bacteria 10960
629 Ga0495680_0002407 3300047322 Bacteria 19189
630 Ga0495675_0061140 3300047444 Bacteria 2386
631 Ga0495675_0112917 3300047444 Unclassified 1695
632 Ga0495675_0155657 3300047444 Bacteria 1410
633 Ga0495684_0041582 3300047471 Bacteria 3522
634 Ga0495614_0035790 3300048089 Bacteria 2133
635 Ga0495614_0060229 3300048089 Bacteria 1631
636 Ga0496100_0363956 3300048903 Unclassified 1095
637 Ga0496101_0208726 3300048904 Unclassified 1512
638 Ga0496102_0007908 3300048905 Bacteria 9088
639 Ga0496102_0054168 3300048905 Bacteria 3657
640 Ga0496102_0075606 3300048905 Bacteria 3096
641 Ga0496102_0244169 3300048905 Bacteria 1693
642 Ga0496102_0446483 3300048905 Unclassified 1213
643 Ga0496103_0120574 3300048906 Bacteria 1670
644 Ga0496103_0175842 3300048906 Unclassified 1375
645 Ga0496104_0043838 3300048907 Bacteria 4202
646 Ga0496104_0045374 3300048907 Bacteria 4133
647 Ga0496104_0140054 3300048907 Unclassified 2324
648 Ga0496104_0230403 3300048907 Unclassified 1764
649 Ga0496104_0242813 3300048907 Bacteria 1713
650 Ga0496104_0332461 3300048907 Unclassified 1432
651 Ga0496104_0336690 3300048907 Bacteria 1422
652 Ga0496104_0509589 3300048907 Unclassified 1114
653 Ga0496105_0105093 3300048908 Bacteria 2331
654 Ga0496106_0004837 3300048909 Bacteria 9966
655 Ga0496106_0094018 3300048909 Bacteria 2317
656 Ga0496106_0178675 3300048909 Bacteria 1684
657 Ga0496106_0258798 3300048909 Bacteria 1392
658 Ga0496107_0316086 3300048910 Unclassified 1162
659 Ga0496108_0007609 3300048911 Bacteria 8772
660 Ga0496108_0008710 3300048911 Bacteria 8224
661 Ga0496108_0224673 3300048911 Bacteria 1632
662 Ga0496108_0509436 3300048911 Unclassified 1051
663 Ga0496109_0013119 3300048912 Bacteria 7169
664 Ga0496109_0142542 3300048912 Bacteria 2241
665 Ga0496109_0186054 3300048912 Bacteria 1951
666 Ga0496109_0322444 3300048912 Unclassified 1458
667 Ga0496110_0028390 3300048913 Bacteria 4805
668 Ga0496110_0234598 3300048913 Unclassified 1669
669 Ga0496110_0259050 3300048913 Unclassified 1583
670 Ga0496110_0290657 3300048913 Bacteria 1489
671 Ga0496110_0293559 3300048913 Bacteria 1481
672 Ga0496111_0029228 3300048914 Bacteria 3913
673 Ga0496111_0169862 3300048914 Bacteria 1620
674 Ga0496112_0011731 3300048915 Bacteria 8021
675 Ga0496112_0016657 3300048915 Bacteria 6891
676 Ga0496112_0053239 3300048915 Bacteria 3974
677 Ga0496112_0068036 3300048915 Bacteria 3517
678 Ga0496113_0000059 3300048916 Bacteria 47591
679 Ga0496113_0111833 3300048916 Bacteria 2127
680 Ga0496113_0236226 3300048916 Unclassified 1458
681 Ga0496114_0033432 3300048917 Unclassified 4237
682 Ga0496114_0040024 3300048917 Bacteria 3879
683 Ga0496115_0027414 3300048918 Bacteria 4456
684 Ga0496115_0052152 3300048918 Unclassified 3281
685 Ga0496115_0064748 3300048918 Bacteria 2952
686 Ga0496115_0106532 3300048918 Bacteria 2301
687 Ga0496117_0000303 3300048920 Bacteria 85952
688 Ga0496118_0000300 3300048921 Bacteria 85952
689 Ga0496124_0042796 3300048927 Bacteria 3896
690 Ga0496126_0162779 3300048929 Bacteria 1905
691 nmdc:mga05p37_174549_c1 3300050507 Bacteria 2619
692 nmdc:mga0n895_200563_c1 3300050512 Bacteria 2026
693 nmdc:mga0n895_64412_c1 3300050512 Bacteria 3626
694 nmdc:mga0n895_65907_c1 3300050512 Bacteria 3586
695 nmdc:mga0rr50_134998_c1 3300050513 Bacteria 1980
696 nmdc:mga0rr50_73276_c1 3300050513 Bacteria 2618
697 nmdc:mga08x19_33907_c1 3300050514 Bacteria 3224
698 nmdc:mga08x19_57269_c1 3300050514 Bacteria 2518
699 nmdc:mga08x19_8171_c1 3300050514 Bacteria 6218
700 nmdc:mga0a205_307495_c1 3300050515 Unclassified 1458
701 nmdc:mga0a205_74210_c1 3300050515 Bacteria 3287
702 Ga0495601_0058743 3300053077 Bacteria 2438
703 Ga0495612_0138882 3300053078 Bacteria 1053
704 Ga0495595_0037540 3300053084 Bacteria 2203
705 Ga0495619_0039711 3300053085 Bacteria 3073
706 Ga0500566_0119161 3300053094 Bacteria 1425
707 Ga0228598_1001480
708 SwRhRL3b_contig_17226
709 JGI24746J21847_1003590
710 JGI24737J22298_10022822
711 JGI24743J22301_10000391
712 JGI24748J21848_1001286
713 JGI24749J21850_1000820
714 JGI24744J21845_10007806
715 rootH1_10000877
716 rootH2_10054689
717 rootH1_10339851
718 Ga0065712_10001312
719 Ga0065715_10091793
720 Ga0065707_10083813
721 Ga0065707_10199606
722 Ga0070658_10002422
723 Ga0070676_10001797
724 Ga0070676_10032469
725 Ga0070683_100004691
726 Ga0070683_100087882
727 Ga0070690_100003844
728 Ga0070690_100009570
729 Ga0070690_100306865
730 Ga0070670_100004981
731 Ga0070670_100026437
732 Ga0070677_10000565
733 Ga0068869_100000809
734 Ga0070666_10000495
735 Ga0070666_10014157
736 Ga0070666_10293171
737 Ga0068868_100006077
738 Ga0070660_100000432
739 Ga0070689_100000359
740 Ga0070689_100018603
741 Ga0070689_100065185
742 Ga0070691_10042345
743 Ga0070687_100000075
744 Ga0070687_100003726
745 Ga0070687_100003771
746 Ga0070687_100220678
747 Ga0070661_100000376
748 Ga0070661_100009954
749 Ga0070692_10119555
750 Ga0070668_100001729
751 Ga0070668_100273925
752 Ga0070669_100017768
753 Ga0070669_100025776
754 Ga0070675_100005941
755 Ga0070675_100243538
756 Ga0070671_100003699
757 Ga0070671_100007069
758 Ga0070674_100000117
759 Ga0070673_100000395
760 Ga0070673_100013391
761 Ga0070673_100018407
762 Ga0070673_100342034
763 Ga0070688_100000429
764 Ga0070688_100002165
765 Ga0070688_100016385
766 Ga0070688_100096720
767 Ga0070659_100000464
768 Ga0070667_100001501
769 Ga0070667_100005109
770 Ga0070667_100006211
771 Ga0070703_10037568
772 Ga0070709_10022544
773 Ga0070709_10035054
774 Ga0070709_10056961
775 Ga0070709_10211591
776 Ga0070709_10403020
777 Ga0070714_100017865
778 Ga0070714_100046932
779 Ga0070714_100070844
780 Ga0070714_100100833
781 Ga0070713_100016578
782 Ga0070713_100037167
783 Ga0070713_100168665
784 Ga0070713_100239917
785 Ga0070710_10190510
786 Ga0070710_10250902
787 Ga0070701_10017744
788 Ga0070701_10038203
789 Ga0070701_10112699
790 Ga0070711_100138219
791 Ga0070700_100007428
792 Ga0070694_100004992
793 Ga0070694_100013617
794 Ga0070708_100033888
795 Ga0070708_100369908
796 Ga0070663_100000532
797 Ga0070663_100265092
798 Ga0070678_100000311
799 Ga0070678_100020651
800 Ga0070662_100001208
801 Ga0070662_100013487
802 Ga0070662_100045596
803 Ga0070681_10000483
804 Ga0070681_10003239
805 Ga0070681_10027751
806 Ga0070681_10429823
807 Ga0068867_100001917
808 Ga0068867_100004664
809 Ga0068867_100037194
810 Ga0068867_100150672
811 Ga0068867_100185172
812 Ga0070685_10000591
813 Ga0070685_10001465
814 Ga0070685_10001804
815 Ga0070706_100009963
816 Ga0070706_100243727
817 Ga0070707_100173343
818 Ga0070698_100187080
819 Ga0070699_100002676
820 Ga0070699_100060378
821 Ga0070699_100287934
822 Ga0070699_100293282
823 Ga0070679_100012638
824 Ga0070679_100021836
825 Ga0070679_100033029
826 Ga0070684_100001686
827 Ga0070684_100011339
828 Ga0070684_100034869
829 Ga0070684_100388683
830 Ga0070697_100000691
831 Ga0070697_100053460
832 Ga0070697_100117832
833 Ga0070697_100302342
834 Ga0068853_100068587
835 Ga0068853_100073135
836 Ga0068853_100283767
837 Ga0068853_100319514
838 Ga0068853_100334393
839 Ga0070672_100002450
840 Ga0070672_100082502
841 Ga0070686_100001017
842 Ga0070686_100030020
843 Ga0070695_100101039
844 Ga0070696_100049057
845 Ga0070696_100188326
846 Ga0070693_100006740
847 Ga0070693_100112246
848 Ga0070693_100202690
849 Ga0070665_100003153
850 Ga0070665_100004146
851 Ga0070665_100007582
852 Ga0070665_100069356
853 Ga0070704_100009620
854 Ga0070704_100016220
855 Ga0070704_100047279
856 Ga0070704_100397151
857 Ga0068855_100000656
858 Ga0068855_100015169
859 Ga0068855_100101194
860 Ga0068855_100128188
861 Ga0068855_100144224
862 Ga0070664_100017300
863 Ga0070664_100018787
864 Ga0068857_100002115
865 Ga0068857_100004940
866 Ga0068854_100000875
867 Ga0068854_100009678
868 Ga0068854_100122347
869 Ga0068856_100002312
870 Ga0068856_100010943
871 Ga0068856_100024144
872 Ga0070702_100001982
873 Ga0070702_100010565
874 Ga0070702_100064423
875 Ga0068852_100001719
876 Ga0068852_100006876
877 Ga0068852_100015969
878 Ga0068852_100021699
879 Ga0068852_100151391
880 Ga0068859_100002000
881 Ga0068859_100005743
882 Ga0068859_100040033
883 Ga0068859_100057587
884 Ga0068859_100339478
885 Ga0068859_100580507
886 Ga0068864_100001199
887 Ga0068864_100008528
888 Ga0068864_100036587
889 Ga0068866_10006446
890 Ga0068861_100000090
891 Ga0068861_100066480
892 Ga0068851_10000638
893 Ga0068851_10003308
894 Ga0068851_10030381
895 Ga0068870_10000066
896 Ga0068863_100000550
897 Ga0068863_100018987
898 Ga0068863_100116855
899 Ga0068863_100461319
900 Ga0068858_100002494
901 Ga0068858_100002509
902 Ga0068858_100003900
903 Ga0068858_100022129
904 Ga0068858_100034322
905 Ga0068858_100044699
906 Ga0068858_100046497
907 Ga0068858_100068334
908 Ga0068858_100129639
909 Ga0068858_100160210
910 Ga0068860_100006170
911 Ga0068860_100009663
912 Ga0068860_100017577
913 Ga0068860_100035462
914 Ga0068862_100023443
915 Ga0081540_1006465
916 Ga0081539_10141951
917 Ga0070717_10000034
918 Ga0070717_10247302
919 Ga0070715_10084511
920 Ga0070716_100029024
921 Ga0070716_100031605
922 Ga0070716_100035042
923 Ga0070712_100112094
924 Ga0070712_100149908
925 Ga0070712_100229085
926 Ga0097621_100000631
927 Ga0097621_100000802
928 Ga0097621_100004601
929 Ga0097621_100289252
930 Ga0068871_100005160
931 Ga0068871_100040465
932 Ga0068871_100048216
933 Ga0068871_100227361
934 Ga0068871_100383120
935 Ga0075433_10042531
936 Ga0075433_10094265
937 Ga0075433_10111643
938 Ga0075434_100059266
939 Ga0075434_100084022
940 Ga0075434_100109226
941 Ga0075434_100171700
942 Ga0068865_100000395
943 Ga0068865_100017287
944 Ga0068865_100161093
945 Ga0068865_100254021
946 Ga0068865_100327822
947 Ga0075436_100012974
948 Ga0075436_100038412
949 Ga0097620_100002000
950 Ga0097620_100005743
951 Ga0097620_100040034
952 Ga0097620_100057590
953 Ga0097620_100339485
954 Ga0097620_100580521
955 Ga0075435_100002692
956 Ga0075435_100148265
957 Ga0075435_100332377
958 Ga0099794_10018501
959 Ga0099794_10020620
960 Ga0099795_10013875
961 Ga0105250_10036181
962 Ga0105240_10003275
963 Ga0105240_10010848
964 Ga0105240_10043748
965 Ga0105240_10136465
966 Ga0105240_10153322
967 Ga0105240_10350120
968 Ga0105240_10419426
969 Ga0105240_10617350
970 Ga0105245_10000889
971 Ga0105245_10008188
972 Ga0105245_10045798
973 Ga0105245_10302554
974 Ga0105245_10514541
975 Ga0105247_10000513
976 Ga0105247_10123138
977 Ga0114129_10105033
978 Ga0105243_10002428
979 Ga0105243_10008743
980 Ga0105243_10017159
981 Ga0105241_10001578
982 Ga0105241_10080189
983 Ga0105241_10118651
984 Ga0105241_10130063
985 Ga0105242_10000725
986 Ga0105242_10006529
987 Ga0105242_10015540
988 Ga0105242_10048900
989 Ga0105248_10005149
990 Ga0105248_10005587
991 Ga0105248_10040133
992 Ga0105248_10106563
993 Ga0105237_10001282
994 Ga0105237_10146696
995 Ga0105237_10229705
996 Ga0105238_10000841
997 Ga0105238_10000991
998 Ga0105249_10000538
999 Ga0105249_10561574
1000 Ga0099796_10006762
1001 Ga0105239_10003280
1002 Ga0105239_10095646
1003 Ga0105246_10000697
1004 Ga0157342_1003842
1005 Ga0157373_10001273
1006 Ga0157373_10066893
1007 Ga0157371_10002386
1008 Ga0157371_10028917
1009 Ga0157370_10060650
1010 Ga0157370_10270697
1011 Ga0157369_10000204
1012 Ga0157369_10003441
1013 Ga0157369_10014774
1014 Ga0157369_10063126
1015 Ga0157374_10004167
1016 Ga0157374_10006223
1017 Ga0157374_10058350
1018 Ga0157378_10002227
1019 Ga0157378_10002899
1020 Ga0157378_10061508
1021 Ga0163162_10001792
1022 Ga0163162_10007031
1023 Ga0163162_10025556
1024 Ga0163162_10572531
1025 Ga0157372_10000938
1026 Ga0157372_10003455
1027 Ga0157372_10044934
1028 Ga0157372_10333177
1029 Ga0157372_10443737
1030 Ga0157372_10449963
1031 Ga0157375_10007627
1032 Ga0157375_10017232
1033 Ga0157375_10026186
1034 Ga0157375_10026408
1035 Ga0157375_10082012
1036 Ga0163163_10000005
1037 Ga0163163_10005380
1038 Ga0163163_10009577
1039 Ga0163163_10079819
1040 Ga0163163_10087627
1041 Ga0163163_10232362
1042 Ga0157377_10014190
1043 Ga0157379_10002533
1044 Ga0157379_10002832
1045 Ga0157379_10003697
1046 Ga0157379_10040827
1047 Ga0157379_10141662
1048 Ga0157379_10178642
1049 Ga0157376_10001001
1050 Ga0157376_10004976
1051 Ga0157376_10107903
1052 Ga0163161_10044961
1053 Ga0213876_10024130
1054 Ga0207697_10000769
1055 Ga0207656_10001590
1056 Ga0207656_10002766
1057 Ga0207656_10037730
1058 Ga0207653_10009984
1059 Ga0207653_10016042
1060 Ga0207682_10000952
1061 Ga0207642_10000161
1062 Ga0207642_10059116
1063 Ga0207710_10002672
1064 Ga0207688_10000036
1065 Ga0207680_10001207
1066 Ga0207680_10004309
1067 Ga0207680_10014854
1068 Ga0207680_10055199
1069 Ga0207647_10001314
1070 Ga0207685_10017861
1071 Ga0207699_10003623
1072 Ga0207699_10004959
1073 Ga0207699_10007957
1074 Ga0207699_10017652
1075 Ga0207699_10146995
1076 Ga0207645_10000493
1077 Ga0207645_10001498
1078 Ga0207643_10000006
1079 Ga0207705_10014191
1080 Ga0207684_10012001
1081 Ga0207684_10037406
1082 Ga0207684_10075220
1083 Ga0207684_10132980
1084 Ga0207654_10007915
1085 Ga0207654_10052052
1086 Ga0207654_10198978
1087 Ga0207707_10004762
1088 Ga0207707_10018919
1089 Ga0207707_10110925
1090 Ga0207707_10115999
1091 Ga0207707_10290326
1092 Ga0207695_10007028
1093 Ga0207695_10025634
1094 Ga0207695_10057852
1095 Ga0207695_10063519
1096 Ga0207695_10122846
1097 Ga0207695_10245152
1098 Ga0207695_10415910
1099 Ga0207671_10001581
1100 Ga0207671_10085088
1101 Ga0207671_10272033
1102 Ga0207693_10004475
1103 Ga0207693_10008125
1104 Ga0207693_10216578
1105 Ga0207663_10000776
1106 Ga0207663_10012147
1107 Ga0207663_10015988
1108 Ga0207663_10222138
1109 Ga0207660_10021352
1110 Ga0207660_10043088
1111 Ga0207660_10138866
1112 Ga0207660_10473096
1113 Ga0207662_10000058
1114 Ga0207662_10001436
1115 Ga0207662_10008037
1116 Ga0207662_10008666
1117 Ga0207657_10000287
1118 Ga0207657_10185247
1119 Ga0207649_10007844
1120 Ga0207649_10017513
1121 Ga0207649_10135422
1122 Ga0207652_10058207
1123 Ga0207652_10075214
1124 Ga0207681_10002435
1125 Ga0207694_10001374
1126 Ga0207694_10002438
1127 Ga0207694_10018408
1128 Ga0207650_10001667
1129 Ga0207659_10000084
1130 Ga0207659_10002106
1131 Ga0207659_10258057
1132 Ga0207687_10002350
1133 Ga0207700_10043751
1134 Ga0207700_10053421
1135 Ga0207664_10015043
1136 Ga0207664_10221152
1137 Ga0207664_10529602
1138 Ga0207644_10000310
1139 Ga0207644_10073915
1140 Ga0207644_10145009
1141 Ga0207690_10005075
1142 Ga0207706_10000536
1143 Ga0207706_10002695
1144 Ga0207706_10308473
1145 Ga0207686_10000985
1146 Ga0207686_10004417
1147 Ga0207686_10006126
1148 Ga0207686_10025201
1149 Ga0207686_10040510
1150 Ga0207709_10004600
1151 Ga0207709_10037271
1152 Ga0207709_10047124
1153 Ga0207670_10000465
1154 Ga0207670_10006220
1155 Ga0207670_10154113
1156 Ga0207669_10044367
1157 Ga0207704_10000202
1158 Ga0207704_10000227
1159 Ga0207704_10000884
1160 Ga0207704_10011384
1161 Ga0207704_10186722
1162 Ga0207665_10026649
1163 Ga0207665_10138957
1164 Ga0207665_10172531
1165 Ga0207691_10000158
1166 Ga0207711_10002197
1167 Ga0207711_10002262
1168 Ga0207711_10021749
1169 Ga0207711_10028169
1170 Ga0207689_10002916
1171 Ga0207689_10014871
1172 Ga0207689_10155695
1173 Ga0207661_10010988
1174 Ga0207661_10031092
1175 Ga0207661_10037270
1176 Ga0207679_10000285
1177 Ga0207679_10011834
1178 Ga0207667_10001685
1179 Ga0207667_10004549
1180 Ga0207667_10029855
1181 Ga0207667_10110814
1182 Ga0207667_10207899
1183 Ga0207651_10000236
1184 Ga0207712_10000430
1185 Ga0207668_10068553
1186 Ga0207640_10000231
1187 Ga0207640_10021151
1188 Ga0207658_10000226
1189 Ga0207658_10012398
1190 Ga0207658_10073671
1191 Ga0207658_10268181
1192 Ga0207677_10000139
1193 Ga0207703_10000744
1194 Ga0207703_10001032
1195 Ga0207703_10059034
1196 Ga0207703_10082076
1197 Ga0207703_10119404
1198 Ga0207703_10332788
1199 Ga0207703_10423434
1200 Ga0207639_10000013
1201 Ga0207639_10000301
1202 Ga0207678_10002930
1203 Ga0207678_10015349
1204 Ga0207678_10046215
1205 Ga0207702_10002096
1206 Ga0207702_10004872
1207 Ga0207702_10040707
1208 Ga0207702_10047332
1209 Ga0207702_10141262
1210 Ga0207641_10009128
1211 Ga0207641_10016219
1212 Ga0207641_10088064
1213 Ga0207641_10228425
1214 Ga0207648_10003801
1215 Ga0207648_10005082
1216 Ga0207648_10186284
1217 Ga0207648_10198440
1218 Ga0207676_10000525
1219 Ga0207676_10013565
1220 Ga0207676_10116267
1221 Ga0207676_10592699
1222 Ga0207674_10000302
1223 Ga0207674_10008636
1224 Ga0207674_10143934
1225 Ga0207674_10538337
1226 Ga0207675_100002753
1227 Ga0207675_100006946
1228 Ga0207683_10002149
1229 Ga0207683_10004562
1230 Ga0207683_10124571
1231 Ga0207698_10000778
1232 Ga0207698_10012184
1233 Ga0207698_10012253
1234 Ga0209179_1017216
1235 Ga0265357_1002467
1236 Ga0268266_10001085
1237 Ga0268266_10010120
1238 Ga0268266_10012883
1239 Ga0268266_10134877
1240 Ga0268266_10180023
1241 Ga0268265_10000337
1242 Ga0268264_10000851
1243 Ga0268264_10049582
1244 Ga0268264_10066246
1245 Ga0373950_0011152
1246 Ga0373959_0015981
1247 Ga0373929_0004504
1248 Ga0373934_0018833
1249 Ga0373944_0009517
1250 Ga0373923_0018397
1251 Ga0373932_0007020
1252 Ga0373936_0039107
1253 Ga0373939_0047719
1254 Ga0373945_0029580
1255 Ga0373953_0002623
1256 Ga0373954_0011246
1257 Ga0373956_0005444
1258 Ga0373957_0000926
1259 Ga0373946_0040610
1260 Ga0373955_0017115
1261 Ga0373955_0033353
1262 Ga0373955_0072550
1263 Ga0373942_0001186
1264 Ga0373961_0003320
1265 Ga0373935_0051092
1266 Ga0373927_0000002
1267 Ga0373927_0003289
1268 Ga0373933_0017095
1269 Ga0373947_0087084
1270 Ga0373937_0039453
1271 Ga0373937_0158435
1272 Ga0373937_0356667
1273 Ga0373937_0522022
1274 Ga0373937_0662681
1275 Ga0373925_0001491
1276 Ga0373925_0002736
1277 Ga0436365_0331968
1278 Ga0436365_0974486
1279 Ga0436365_1618990
1280 Ga0436363_0769682
1281 Ga0436363_1101025
1282 Ga0451577_0021412
1283 Ga0453683_0034709
1284 Ga0466959_0002177
1285 Ga0451576_0011992
1286 Ga0451576_0028567
1287 Ga0451576_0204434
1288 Ga0495592_0117256
1289 Ga0495603_0162849
1290 Ga0495629_0014013
1291 Ga0495653_0256785
1292 Ga0495580_0004169
1293 Ga0495580_0063065
1294 Ga0495580_0070136
1295 Ga0495580_0123182
1296 Ga0495639_0005130
1297 Ga0495639_0038437
1298 Ga0495662_0024979
1299 Ga0495662_0055275
1300 Ga0495594_0039110
1301 Ga0495608_0002384
1302 Ga0495628_0141900
1303 Ga0495630_0140515
1304 Ga0495630_0330969
1305 Ga0495666_0003273
1306 Ga0495665_0076022
1307 Ga0495586_0001734
1308 Ga0495586_0020456
1309 Ga0495586_0154189
1310 Ga0495587_0025081
1311 Ga0495587_0149087
1312 Ga0495645_0041363
1313 Ga0495645_0050149
1314 Ga0495667_0022298
1315 Ga0495635_0040303
1316 Ga0495635_0266231
1317 Ga0495647_0029969
1318 Ga0495658_0010096
1319 Ga0495658_0027054
1320 Ga0495658_0059082
1321 Ga0495658_0136958
1322 Ga0495613_0039829
1323 Ga0495613_0055576
1324 Ga0495613_0144619
1325 Ga0495624_0041188
1326 Ga0495624_0056175
1327 Ga0495600_0030591
1328 Ga0495581_0124705
1329 Ga0495581_0128620
1330 Ga0495674_0089577
1331 Ga0495674_0158279
1332 Ga0495674_0290172
1333 Ga0495676_0006246
1334 Ga0495680_0002407
1335 Ga0495675_0061140
1336 Ga0495675_0112917
1337 Ga0495675_0155657
1338 Ga0495684_0041582
1339 Ga0495614_0035790
1340 Ga0495614_0060229
1341 Ga0496100_0363956
1342 Ga0496101_0208726
1343 Ga0496102_0007908
1344 Ga0496102_0054168
1345 Ga0496102_0075606
1346 Ga0496102_0244169
1347 Ga0496102_0446483
1348 Ga0496103_0120574
1349 Ga0496103_0175842
1350 Ga0496104_0043838
1351 Ga0496104_0045374
1352 Ga0496104_0140054
1353 Ga0496104_0230403
1354 Ga0496104_0242813
1355 Ga0496104_0332461
1356 Ga0496104_0336690
1357 Ga0496104_0509589
1358 Ga0496105_0105093
1359 Ga0496106_0004837
1360 Ga0496106_0094018
1361 Ga0496106_0178675
1362 Ga0496106_0258798
1363 Ga0496107_0316086
1364 Ga0496108_0007609
1365 Ga0496108_0008710
1366 Ga0496108_0224673
1367 Ga0496108_0509436
1368 Ga0496109_0013119
1369 Ga0496109_0142542
1370 Ga0496109_0186054
1371 Ga0496109_0322444
1372 Ga0496110_0028390
1373 Ga0496110_0234598
1374 Ga0496110_0259050
1375 Ga0496110_0290657
1376 Ga0496110_0293559
1377 Ga0496111_0029228
1378 Ga0496111_0169862
1379 Ga0496112_0011731
1380 Ga0496112_0016657
1381 Ga0496112_0053239
1382 Ga0496112_0068036
1383 Ga0496113_0000059
1384 Ga0496113_0111833
1385 Ga0496113_0236226
1386 Ga0496114_0033432
1387 Ga0496114_0040024
1388 Ga0496115_0027414
1389 Ga0496115_0052152
1390 Ga0496115_0064748
1391 Ga0496115_0106532
1392 Ga0496117_0000303
1393 Ga0496118_0000300
1394 Ga0496124_0042796
1395 Ga0496126_0162779
1396 nmdc:mga05p37_174549_c1
1397 nmdc:mga0n895_200563_c1
1398 nmdc:mga0n895_64412_c1
1399 nmdc:mga0n895_65907_c1
1400 nmdc:mga0rr50_134998_c1
1401 nmdc:mga0rr50_73276_c1
1402 nmdc:mga08x19_33907_c1
1403 nmdc:mga08x19_57269_c1
1404 nmdc:mga08x19_8171_c1
1405 nmdc:mga0a205_307495_c1
1406 nmdc:mga0a205_74210_c1
1407 Ga0495601_0058743
1408 Ga0495612_0138882
1409 Ga0495595_0037540
1410 Ga0495619_0039711
1411 Ga0500566_0119161

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

2

61

0.93

PF03466

LysR_substrate

LysR substrate binding domain

84

287

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9463 1 79
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9454 1 80
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9437 1 79
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9431 1 79
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9421 1 79
ID Description Score Start End Superfamily
af_P0ACQ4_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9625 1 81 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9586 1 78 1.10.10.10
af_P36771_5_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9578 1 79 1.10.10.10
af_P67660_2_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9576 1 78 1.10.10.10
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.956 1 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Z0D4P5-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.8773 84 297 GO:0000976
GO:0006355
AF-A0A4U3ADC5-F1-model_v4 deleted 0.8612 84 256
AF-A0A3S2C6S0-F1-model_v4 LysR family transcriptional regulator 0.8566 163 263 GO:0000976
GO:0006355
AF-A0A6L4A263-F1-model_v4 LysR family transcriptional regulator 0.8473 165 262 GO:0000976
GO:0006355
AF-A0A7Z0D4P5-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.8259 84 297 GO:0000976
GO:0006355

Map