F476404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 705 | 293 | 1411 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300024227|Ga0228598_1001480|Ga0228598_10014803 |
| Length | 377 |
| Sequence | LLDDLRALVEFAQAGSIAGAADRLYRTPSAITRQLQRLEAALGAELLDRSVKPPRLNSLGSRVLEQARDLLQRTEAMKSVASRDAEPHGLLRIGLAHALAEGTLIKPIRALTEKYPKVRLRLLSALTGELFNRLLAGELDVAVVFLPEGKTAPSPLLTNIIASDRMEIVQGAAGNIDDDWESLSRAPWVLNPSGCLLRANLIDQMERAGFTPMVAAEIHYNIHLQLALIQSGYGVGLLPARFIARNNSLDTVEVLRPPSFDLHMSVAIVRVGQLGALERAVELLEHGIRHLFEAADTTKPVTRSRRRVPAPSRHYLMAVASISIRQSFGNRAASSVVGAGRFPLKNLAYTSFIAEKSFMVLSRTTQRTTLFMLEPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 7.23 |
| Rhizosphere | 90.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0228598_1001480 | 3300024227 | Bacteria | 5168 |
| 2 | SwRhRL3b_contig_17226 | 2162886006 | Unclassified | 2389 |
| 3 | JGI24746J21847_1003590 | 3300001977 | Unclassified | 2443 |
| 4 | JGI24737J22298_10022822 | 3300001990 | Unclassified | 1987 |
| 5 | JGI24743J22301_10000391 | 3300001991 | Unclassified | 4933 |
| 6 | JGI24748J21848_1001286 | 3300002074 | Plasmid | 2748 |
| 7 | JGI24749J21850_1000820 | 3300002076 | Bacteria | 4457 |
| 8 | JGI24744J21845_10007806 | 3300002077 | Unclassified | 2210 |
| 9 | rootH1_10000877 | 3300003316 | Bacteria | 19081 |
| 10 | rootH1_10000877 | 3300003323 | Bacteria | 40245 |
| 11 | rootH2_10054689 | 3300003320 | Bacteria | 7192 |
| 12 | rootH1_10339851 | 3300003323 | Bacteria | 1782 |
| 13 | Ga0065712_10001312 | 3300005290 | Bacteria | 6484 |
| 14 | Ga0065715_10091793 | 3300005293 | Bacteria | 5545 |
| 15 | Ga0065707_10083813 | 3300005295 | Bacteria | 8196 |
| 16 | Ga0065707_10199606 | 3300005295 | Unclassified | 1317 |
| 17 | Ga0070658_10002422 | 3300005327 | Bacteria | 15621 |
| 18 | Ga0070676_10001797 | 3300005328 | Bacteria | 10913 |
| 19 | Ga0070676_10032469 | 3300005328 | Unclassified | 2991 |
| 20 | Ga0070683_100004691 | 3300005329 | Bacteria | 11297 |
| 21 | Ga0070683_100087882 | 3300005329 | Bacteria | 2915 |
| 22 | Ga0070690_100003844 | 3300005330 | Bacteria | 8271 |
| 23 | Ga0070690_100009570 | 3300005330 | Bacteria | 5617 |
| 24 | Ga0070690_100306865 | 3300005330 | Bacteria | 1139 |
| 25 | Ga0070670_100004981 | 3300005331 | Bacteria | 11175 |
| 26 | Ga0070670_100026437 | 3300005331 | Bacteria | 4994 |
| 27 | Ga0070677_10000565 | 3300005333 | Bacteria | 12617 |
| 28 | Ga0068869_100000809 | 3300005334 | Bacteria | 17868 |
| 29 | Ga0070666_10000495 | 3300005335 | Bacteria | 23727 |
| 30 | Ga0070666_10014157 | 3300005335 | Bacteria | 5075 |
| 31 | Ga0070666_10293171 | 3300005335 | Unclassified | 1158 |
| 32 | Ga0068868_100006077 | 3300005338 | Bacteria | 8525 |
| 33 | Ga0070660_100000432 | 3300005339 | Bacteria | 27735 |
| 34 | Ga0070689_100000359 | 3300005340 | Bacteria | 26732 |
| 35 | Ga0070689_100018603 | 3300005340 | Bacteria | 5121 |
| 36 | Ga0070689_100065185 | 3300005340 | Bacteria | 2836 |
| 37 | Ga0070691_10042345 | 3300005341 | Unclassified | 2155 |
| 38 | Ga0070687_100000075 | 3300005343 | Bacteria | 32457 |
| 39 | Ga0070687_100003726 | 3300005343 | Bacteria | 5970 |
| 40 | Ga0070687_100003771 | 3300005343 | Bacteria | 5940 |
| 41 | Ga0070687_100220678 | 3300005343 | Bacteria | 1161 |
| 42 | Ga0070661_100000376 | 3300005344 | Bacteria | 35087 |
| 43 | Ga0070661_100009954 | 3300005344 | Bacteria | 6595 |
| 44 | Ga0070692_10119555 | 3300005345 | Bacteria | 1468 |
| 45 | Ga0070668_100001729 | 3300005347 | Bacteria | 15874 |
| 46 | Ga0070668_100273925 | 3300005347 | Unclassified | 1407 |
| 47 | Ga0070669_100017768 | 3300005353 | Bacteria | 5075 |
| 48 | Ga0070669_100025776 | 3300005353 | Unclassified | 4224 |
| 49 | Ga0070675_100005941 | 3300005354 | Bacteria | 9351 |
| 50 | Ga0070675_100243538 | 3300005354 | Bacteria | 1571 |
| 51 | Ga0070671_100003699 | 3300005355 | Bacteria | 11995 |
| 52 | Ga0070671_100007069 | 3300005355 | Bacteria | 8989 |
| 53 | Ga0070674_100000117 | 3300005356 | Bacteria | 36761 |
| 54 | Ga0070673_100000395 | 3300005364 | Bacteria | 23057 |
| 55 | Ga0070673_100013391 | 3300005364 | Bacteria | 5672 |
| 56 | Ga0070673_100018407 | 3300005364 | Bacteria | 4988 |
| 57 | Ga0070673_100342034 | 3300005364 | Bacteria | 1326 |
| 58 | Ga0070688_100000429 | 3300005365 | Bacteria | 21185 |
| 59 | Ga0070688_100002165 | 3300005365 | Bacteria | 9904 |
| 60 | Ga0070688_100016385 | 3300005365 | Bacteria | 4237 |
| 61 | Ga0070688_100096720 | 3300005365 | Unclassified | 1940 |
| 62 | Ga0070659_100000464 | 3300005366 | Bacteria | 29940 |
| 63 | Ga0070667_100001501 | 3300005367 | Bacteria | 20873 |
| 64 | Ga0070667_100005109 | 3300005367 | Bacteria | 10982 |
| 65 | Ga0070667_100006211 | 3300005367 | Bacteria | 9938 |
| 66 | Ga0070703_10037568 | 3300005406 | Bacteria | 1493 |
| 67 | Ga0070709_10022544 | 3300005434 | Unclassified | 3686 |
| 68 | Ga0070709_10035054 | 3300005434 | Bacteria | 3047 |
| 69 | Ga0070709_10056961 | 3300005434 | Bacteria | 2474 |
| 70 | Ga0070709_10211591 | 3300005434 | Unclassified | 1378 |
| 71 | Ga0070709_10403020 | 3300005434 | Bacteria | 1022 |
| 72 | Ga0070714_100017865 | 3300005435 | Bacteria | 5751 |
| 73 | Ga0070714_100046932 | 3300005435 | Bacteria | 3666 |
| 74 | Ga0070714_100070844 | 3300005435 | Bacteria | 3014 |
| 75 | Ga0070714_100100833 | 3300005435 | Bacteria | 2543 |
| 76 | Ga0070713_100016578 | 3300005436 | Bacteria | 5541 |
| 77 | Ga0070713_100037167 | 3300005436 | Bacteria | 3936 |
| 78 | Ga0070713_100168665 | 3300005436 | Bacteria | 1959 |
| 79 | Ga0070713_100239917 | 3300005436 | Unclassified | 1650 |
| 80 | Ga0070710_10190510 | 3300005437 | Unclassified | 1289 |
| 81 | Ga0070710_10250902 | 3300005437 | Unclassified | 1137 |
| 82 | Ga0070701_10017744 | 3300005438 | Bacteria | 3332 |
| 83 | Ga0070701_10038203 | 3300005438 | Bacteria | 2429 |
| 84 | Ga0070701_10112699 | 3300005438 | Bacteria | 1522 |
| 85 | Ga0070711_100138219 | 3300005439 | Unclassified | 1823 |
| 86 | Ga0070700_100007428 | 3300005441 | Bacteria | 5917 |
| 87 | Ga0070694_100004992 | 3300005444 | Bacteria | 8000 |
| 88 | Ga0070694_100013617 | 3300005444 | Bacteria | 5083 |
| 89 | Ga0070708_100033888 | 3300005445 | Unclassified | 4438 |
| 90 | Ga0070708_100369908 | 3300005445 | Unclassified | 1351 |
| 91 | Ga0070663_100000532 | 3300005455 | Bacteria | 20151 |
| 92 | Ga0070663_100265092 | 3300005455 | Bacteria | 1364 |
| 93 | Ga0070678_100000311 | 3300005456 | Bacteria | 22630 |
| 94 | Ga0070678_100020651 | 3300005456 | Bacteria | 4325 |
| 95 | Ga0070662_100001208 | 3300005457 | Bacteria | 15883 |
| 96 | Ga0070662_100013487 | 3300005457 | Bacteria | 5438 |
| 97 | Ga0070662_100045596 | 3300005457 | Bacteria | 3147 |
| 98 | Ga0070681_10000483 | 3300005458 | Bacteria | 32474 |
| 99 | Ga0070681_10003239 | 3300005458 | Bacteria | 15179 |
| 100 | Ga0070681_10027751 | 3300005458 | Bacteria | 5692 |
| 101 | Ga0070681_10429823 | 3300005458 | Unclassified | 1232 |
| 102 | Ga0068867_100001917 | 3300005459 | Bacteria | 14484 |
| 103 | Ga0068867_100004664 | 3300005459 | Bacteria | 9643 |
| 104 | Ga0068867_100037194 | 3300005459 | Bacteria | 3538 |
| 105 | Ga0068867_100150672 | 3300005459 | Unclassified | 1826 |
| 106 | Ga0068867_100185172 | 3300005459 | Bacteria | 1658 |
| 107 | Ga0070685_10000591 | 3300005466 | Bacteria | 20128 |
| 108 | Ga0070685_10001465 | 3300005466 | Bacteria | 12396 |
| 109 | Ga0070685_10001804 | 3300005466 | Bacteria | 11156 |
| 110 | Ga0070706_100009963 | 3300005467 | Bacteria | 8827 |
| 111 | Ga0070706_100243727 | 3300005467 | Unclassified | 1678 |
| 112 | Ga0070707_100173343 | 3300005468 | Bacteria | 2102 |
| 113 | Ga0070698_100187080 | 3300005471 | Bacteria | 2008 |
| 114 | Ga0070699_100002676 | 3300005518 | Bacteria | 15926 |
| 115 | Ga0070699_100060378 | 3300005518 | Bacteria | 3285 |
| 116 | Ga0070699_100287934 | 3300005518 | Unclassified | 1472 |
| 117 | Ga0070699_100293282 | 3300005518 | Unclassified | 1459 |
| 118 | Ga0070679_100012638 | 3300005530 | Bacteria | 8075 |
| 119 | Ga0070679_100021836 | 3300005530 | Bacteria | 6251 |
| 120 | Ga0070679_100033029 | 3300005530 | Bacteria | 5122 |
| 121 | Ga0070684_100001686 | 3300005535 | Bacteria | 16057 |
| 122 | Ga0070684_100011339 | 3300005535 | Bacteria | 7098 |
| 123 | Ga0070684_100034869 | 3300005535 | Unclassified | 4305 |
| 124 | Ga0070684_100388683 | 3300005535 | Bacteria | 1286 |
| 125 | Ga0070697_100000691 | 3300005536 | Bacteria | 25221 |
| 126 | Ga0070697_100053460 | 3300005536 | Bacteria | 3282 |
| 127 | Ga0070697_100117832 | 3300005536 | Bacteria | 2218 |
| 128 | Ga0070697_100302342 | 3300005536 | Bacteria | 1375 |
| 129 | Ga0068853_100068587 | 3300005539 | Unclassified | 3083 |
| 130 | Ga0068853_100073135 | 3300005539 | Unclassified | 2988 |
| 131 | Ga0068853_100283767 | 3300005539 | Unclassified | 1527 |
| 132 | Ga0068853_100319514 | 3300005539 | Unclassified | 1439 |
| 133 | Ga0068853_100334393 | 3300005539 | Bacteria | 1406 |
| 134 | Ga0070672_100002450 | 3300005543 | Bacteria | 11783 |
| 135 | Ga0070672_100082502 | 3300005543 | Bacteria | 2579 |
| 136 | Ga0070686_100001017 | 3300005544 | Bacteria | 16133 |
| 137 | Ga0070686_100030020 | 3300005544 | Bacteria | 3313 |
| 138 | Ga0070695_100101039 | 3300005545 | Bacteria | 1942 |
| 139 | Ga0070696_100049057 | 3300005546 | Bacteria | 2931 |
| 140 | Ga0070696_100188326 | 3300005546 | Unclassified | 1535 |
| 141 | Ga0070693_100006740 | 3300005547 | Bacteria | 5578 |
| 142 | Ga0070693_100112246 | 3300005547 | Unclassified | 1679 |
| 143 | Ga0070693_100202690 | 3300005547 | Bacteria | 1289 |
| 144 | Ga0070665_100003153 | 3300005548 | Bacteria | 17739 |
| 145 | Ga0070665_100004146 | 3300005548 | Bacteria | 15246 |
| 146 | Ga0070665_100007582 | 3300005548 | Bacteria | 11033 |
| 147 | Ga0070665_100069356 | 3300005548 | Bacteria | 3533 |
| 148 | Ga0070704_100009620 | 3300005549 | Bacteria | 5853 |
| 149 | Ga0070704_100016220 | 3300005549 | Bacteria | 4703 |
| 150 | Ga0070704_100047279 | 3300005549 | Bacteria | 3007 |
| 151 | Ga0070704_100397151 | 3300005549 | Unclassified | 1176 |
| 152 | Ga0068855_100000656 | 3300005563 | Bacteria | 42261 |
| 153 | Ga0068855_100015169 | 3300005563 | Bacteria | 9280 |
| 154 | Ga0068855_100101194 | 3300005563 | Bacteria | 3317 |
| 155 | Ga0068855_100128188 | 3300005563 | Bacteria | 2900 |
| 156 | Ga0068855_100144224 | 3300005563 | Bacteria | 2712 |
| 157 | Ga0070664_100017300 | 3300005564 | Bacteria | 5919 |
| 158 | Ga0070664_100018787 | 3300005564 | Bacteria | 5684 |
| 159 | Ga0068857_100002115 | 3300005577 | Bacteria | 16151 |
| 160 | Ga0068857_100004940 | 3300005577 | Bacteria | 11322 |
| 161 | Ga0068854_100000875 | 3300005578 | Bacteria | 18072 |
| 162 | Ga0068854_100009678 | 3300005578 | Bacteria | 6228 |
| 163 | Ga0068854_100122347 | 3300005578 | Bacteria | 1977 |
| 164 | Ga0068856_100002312 | 3300005614 | Bacteria | 19625 |
| 165 | Ga0068856_100010943 | 3300005614 | Bacteria | 8803 |
| 166 | Ga0068856_100024144 | 3300005614 | Bacteria | 5915 |
| 167 | Ga0070702_100001982 | 3300005615 | Bacteria | 8618 |
| 168 | Ga0070702_100010565 | 3300005615 | Bacteria | 4555 |
| 169 | Ga0070702_100064423 | 3300005615 | Bacteria | 2144 |
| 170 | Ga0068852_100001719 | 3300005616 | Bacteria | 14920 |
| 171 | Ga0068852_100006876 | 3300005616 | Bacteria | 8266 |
| 172 | Ga0068852_100015969 | 3300005616 | Bacteria | 5844 |
| 173 | Ga0068852_100021699 | 3300005616 | Bacteria | 5135 |
| 174 | Ga0068852_100151391 | 3300005616 | Unclassified | 2158 |
| 175 | Ga0068859_100002000 | 3300005617 | Bacteria | 20803 |
| 176 | Ga0068859_100005743 | 3300005617 | Bacteria | 12617 |
| 177 | Ga0068859_100040033 | 3300005617 | Bacteria | 4704 |
| 178 | Ga0068859_100057587 | 3300005617 | Bacteria | 3914 |
| 179 | Ga0068859_100339478 | 3300005617 | Unclassified | 1596 |
| 180 | Ga0068859_100580507 | 3300005617 | Unclassified | 1215 |
| 181 | Ga0068864_100001199 | 3300005618 | Bacteria | 21527 |
| 182 | Ga0068864_100008528 | 3300005618 | Bacteria | 8457 |
| 183 | Ga0068864_100036587 | 3300005618 | Bacteria | 4185 |
| 184 | Ga0068866_10006446 | 3300005718 | Bacteria | 4887 |
| 185 | Ga0068861_100000090 | 3300005719 | Bacteria | 44319 |
| 186 | Ga0068861_100066480 | 3300005719 | Unclassified | 2779 |
| 187 | Ga0068851_10000638 | 3300005834 | Bacteria | 14931 |
| 188 | Ga0068851_10003308 | 3300005834 | Bacteria | 7160 |
| 189 | Ga0068851_10030381 | 3300005834 | Bacteria | 2679 |
| 190 | Ga0068870_10000066 | 3300005840 | Bacteria | 32686 |
| 191 | Ga0068863_100000550 | 3300005841 | Bacteria | 38165 |
| 192 | Ga0068863_100018987 | 3300005841 | Bacteria | 6580 |
| 193 | Ga0068863_100116855 | 3300005841 | Bacteria | 2542 |
| 194 | Ga0068863_100461319 | 3300005841 | Bacteria | 1248 |
| 195 | Ga0068858_100002494 | 3300005842 | Bacteria | 18569 |
| 196 | Ga0068858_100002509 | 3300005842 | Bacteria | 18511 |
| 197 | Ga0068858_100003900 | 3300005842 | Bacteria | 14731 |
| 198 | Ga0068858_100022129 | 3300005842 | Bacteria | 5936 |
| 199 | Ga0068858_100034322 | 3300005842 | Bacteria | 4705 |
| 200 | Ga0068858_100044699 | 3300005842 | Bacteria | 4105 |
| 201 | Ga0068858_100046497 | 3300005842 | Bacteria | 4023 |
| 202 | Ga0068858_100068334 | 3300005842 | Bacteria | 3292 |
| 203 | Ga0068858_100129639 | 3300005842 | Bacteria | 2364 |
| 204 | Ga0068858_100160210 | 3300005842 | Bacteria | 2118 |
| 205 | Ga0068860_100006170 | 3300005843 | Bacteria | 12054 |
| 206 | Ga0068860_100009663 | 3300005843 | Bacteria | 9580 |
| 207 | Ga0068860_100017577 | 3300005843 | Bacteria | 6967 |
| 208 | Ga0068860_100035462 | 3300005843 | Bacteria | 4784 |
| 209 | Ga0068862_100023443 | 3300005844 | Bacteria | 5171 |
| 210 | Ga0081540_1006465 | 3300005983 | Bacteria | 8528 |
| 211 | Ga0081539_10141951 | 3300005985 | Bacteria | 1166 |
| 212 | Ga0070717_10000034 | 3300006028 | Bacteria | 127047 |
| 213 | Ga0070717_10247302 | 3300006028 | Unclassified | 1574 |
| 214 | Ga0070715_10084511 | 3300006163 | Unclassified | 1447 |
| 215 | Ga0070716_100029024 | 3300006173 | Bacteria | 2986 |
| 216 | Ga0070716_100031605 | 3300006173 | Unclassified | 2880 |
| 217 | Ga0070716_100035042 | 3300006173 | Unclassified | 2757 |
| 218 | Ga0070712_100112094 | 3300006175 | Unclassified | 2037 |
| 219 | Ga0070712_100149908 | 3300006175 | Unclassified | 1789 |
| 220 | Ga0070712_100229085 | 3300006175 | Bacteria | 1475 |
| 221 | Ga0097621_100000631 | 3300006237 | Bacteria | 24844 |
| 222 | Ga0097621_100000802 | 3300006237 | Bacteria | 22144 |
| 223 | Ga0097621_100004601 | 3300006237 | Bacteria | 9630 |
| 224 | Ga0097621_100289252 | 3300006237 | Unclassified | 1444 |
| 225 | Ga0068871_100005160 | 3300006358 | Bacteria | 9134 |
| 226 | Ga0068871_100040465 | 3300006358 | Bacteria | 3733 |
| 227 | Ga0068871_100048216 | 3300006358 | Bacteria | 3438 |
| 228 | Ga0068871_100227361 | 3300006358 | Bacteria | 1618 |
| 229 | Ga0068871_100383120 | 3300006358 | Bacteria | 1249 |
| 230 | Ga0075433_10042531 | 3300006852 | Bacteria | 3942 |
| 231 | Ga0075433_10094265 | 3300006852 | Bacteria | 2649 |
| 232 | Ga0075433_10111643 | 3300006852 | Bacteria | 2425 |
| 233 | Ga0075434_100059266 | 3300006871 | Bacteria | 3806 |
| 234 | Ga0075434_100084022 | 3300006871 | Bacteria | 3182 |
| 235 | Ga0075434_100109226 | 3300006871 | Bacteria | 2776 |
| 236 | Ga0075434_100171700 | 3300006871 | Bacteria | 2188 |
| 237 | Ga0068865_100000395 | 3300006881 | Bacteria | 24331 |
| 238 | Ga0068865_100017287 | 3300006881 | Bacteria | 4636 |
| 239 | Ga0068865_100161093 | 3300006881 | Bacteria | 1711 |
| 240 | Ga0068865_100254021 | 3300006881 | Bacteria | 1388 |
| 241 | Ga0068865_100327822 | 3300006881 | Unclassified | 1234 |
| 242 | Ga0075436_100012974 | 3300006914 | Bacteria | 5712 |
| 243 | Ga0075436_100038412 | 3300006914 | Unclassified | 3304 |
| 244 | Ga0097620_100002000 | 3300006931 | Bacteria | 20803 |
| 245 | Ga0097620_100005743 | 3300006931 | Bacteria | 12617 |
| 246 | Ga0097620_100040034 | 3300006931 | Bacteria | 4704 |
| 247 | Ga0097620_100057590 | 3300006931 | Bacteria | 3914 |
| 248 | Ga0097620_100339485 | 3300006931 | Unclassified | 1596 |
| 249 | Ga0097620_100580521 | 3300006931 | Unclassified | 1215 |
| 250 | Ga0075435_100002692 | 3300007076 | Bacteria | 11865 |
| 251 | Ga0075435_100148265 | 3300007076 | Unclassified | 1971 |
| 252 | Ga0075435_100332377 | 3300007076 | Unclassified | 1301 |
| 253 | Ga0099794_10018501 | 3300007265 | Bacteria | 3125 |
| 254 | Ga0099794_10020620 | 3300007265 | Unclassified | 2985 |
| 255 | Ga0099795_10013875 | 3300007788 | Bacteria | 2484 |
| 256 | Ga0105250_10036181 | 3300009092 | Unclassified | 1981 |
| 257 | Ga0105240_10003275 | 3300009093 | Bacteria | 25313 |
| 258 | Ga0105240_10010848 | 3300009093 | Bacteria | 12760 |
| 259 | Ga0105240_10043748 | 3300009093 | Bacteria | 5694 |
| 260 | Ga0105240_10136465 | 3300009093 | Unclassified | 2937 |
| 261 | Ga0105240_10153322 | 3300009093 | Bacteria | 2743 |
| 262 | Ga0105240_10350120 | 3300009093 | Bacteria | 1676 |
| 263 | Ga0105240_10419426 | 3300009093 | Unclassified | 1504 |
| 264 | Ga0105240_10617350 | 3300009093 | Bacteria | 1192 |
| 265 | Ga0105245_10000889 | 3300009098 | Bacteria | 27201 |
| 266 | Ga0105245_10008188 | 3300009098 | Bacteria | 9144 |
| 267 | Ga0105245_10045798 | 3300009098 | Bacteria | 3907 |
| 268 | Ga0105245_10302554 | 3300009098 | Bacteria | 1570 |
| 269 | Ga0105245_10514541 | 3300009098 | Bacteria | 1215 |
| 270 | Ga0105247_10000513 | 3300009101 | Bacteria | 31766 |
| 271 | Ga0105247_10123138 | 3300009101 | Unclassified | 1682 |
| 272 | Ga0114129_10105033 | 3300009147 | Bacteria | 3904 |
| 273 | Ga0105243_10002428 | 3300009148 | Bacteria | 15584 |
| 274 | Ga0105243_10008743 | 3300009148 | Bacteria | 7762 |
| 275 | Ga0105243_10017159 | 3300009148 | Bacteria | 5475 |
| 276 | Ga0105241_10001578 | 3300009174 | Bacteria | 17423 |
| 277 | Ga0105241_10080189 | 3300009174 | Bacteria | 2554 |
| 278 | Ga0105241_10118651 | 3300009174 | Unclassified | 2127 |
| 279 | Ga0105241_10130063 | 3300009174 | Unclassified | 2037 |
| 280 | Ga0105242_10000725 | 3300009176 | Bacteria | 25717 |
| 281 | Ga0105242_10006529 | 3300009176 | Bacteria | 8978 |
| 282 | Ga0105242_10015540 | 3300009176 | Bacteria | 5912 |
| 283 | Ga0105242_10048900 | 3300009176 | Bacteria | 3438 |
| 284 | Ga0105248_10005149 | 3300009177 | Bacteria | 14416 |
| 285 | Ga0105248_10005587 | 3300009177 | Bacteria | 13822 |
| 286 | Ga0105248_10040133 | 3300009177 | Bacteria | 5247 |
| 287 | Ga0105248_10106563 | 3300009177 | Bacteria | 3160 |
| 288 | Ga0105237_10001282 | 3300009545 | Bacteria | 33518 |
| 289 | Ga0105237_10146696 | 3300009545 | Bacteria | 2354 |
| 290 | Ga0105237_10229705 | 3300009545 | Bacteria | 1856 |
| 291 | Ga0105238_10000841 | 3300009551 | Bacteria | 31739 |
| 292 | Ga0105238_10000991 | 3300009551 | Bacteria | 29014 |
| 293 | Ga0105249_10000538 | 3300009553 | Bacteria | 35017 |
| 294 | Ga0105249_10561574 | 3300009553 | Unclassified | 1193 |
| 295 | Ga0099796_10006762 | 3300010159 | Bacteria | 2957 |
| 296 | Ga0105239_10003280 | 3300010375 | Bacteria | 19956 |
| 297 | Ga0105239_10095646 | 3300010375 | Unclassified | 3281 |
| 298 | Ga0105246_10000697 | 3300011119 | Bacteria | 18938 |
| 299 | Ga0157342_1003842 | 3300012507 | Unclassified | 1307 |
| 300 | Ga0157373_10001273 | 3300013100 | Bacteria | 19276 |
| 301 | Ga0157373_10066893 | 3300013100 | Unclassified | 2541 |
| 302 | Ga0157371_10002386 | 3300013102 | Bacteria | 17971 |
| 303 | Ga0157371_10028917 | 3300013102 | Bacteria | 4013 |
| 304 | Ga0157370_10060650 | 3300013104 | Bacteria | 3591 |
| 305 | Ga0157370_10270697 | 3300013104 | Unclassified | 1569 |
| 306 | Ga0157369_10000204 | 3300013105 | Bacteria | 82045 |
| 307 | Ga0157369_10003441 | 3300013105 | Bacteria | 18771 |
| 308 | Ga0157369_10014774 | 3300013105 | Bacteria | 8809 |
| 309 | Ga0157369_10063126 | 3300013105 | Bacteria | 3992 |
| 310 | Ga0157374_10004167 | 3300013296 | Bacteria | 12138 |
| 311 | Ga0157374_10006223 | 3300013296 | Bacteria | 10120 |
| 312 | Ga0157374_10058350 | 3300013296 | Bacteria | 3606 |
| 313 | Ga0157378_10002227 | 3300013297 | Bacteria | 17202 |
| 314 | Ga0157378_10002899 | 3300013297 | Bacteria | 15264 |
| 315 | Ga0157378_10061508 | 3300013297 | Unclassified | 3351 |
| 316 | Ga0163162_10001792 | 3300013306 | Bacteria | 20152 |
| 317 | Ga0163162_10007031 | 3300013306 | Bacteria | 10914 |
| 318 | Ga0163162_10025556 | 3300013306 | Bacteria | 5836 |
| 319 | Ga0163162_10572531 | 3300013306 | Bacteria | 1257 |
| 320 | Ga0157372_10000938 | 3300013307 | Bacteria | 31857 |
| 321 | Ga0157372_10003455 | 3300013307 | Bacteria | 17048 |
| 322 | Ga0157372_10044934 | 3300013307 | Bacteria | 4896 |
| 323 | Ga0157372_10333177 | 3300013307 | Bacteria | 1767 |
| 324 | Ga0157372_10443737 | 3300013307 | Bacteria | 1512 |
| 325 | Ga0157372_10449963 | 3300013307 | Bacteria | 1501 |
| 326 | Ga0157375_10007627 | 3300013308 | Bacteria | 9464 |
| 327 | Ga0157375_10017232 | 3300013308 | Bacteria | 6513 |
| 328 | Ga0157375_10026186 | 3300013308 | Bacteria | 5431 |
| 329 | Ga0157375_10026408 | 3300013308 | Bacteria | 5411 |
| 330 | Ga0157375_10082012 | 3300013308 | Bacteria | 3266 |
| 331 | Ga0163163_10000005 | 3300014325 | Bacteria | 369548 |
| 332 | Ga0163163_10005380 | 3300014325 | Bacteria | 11064 |
| 333 | Ga0163163_10009577 | 3300014325 | Bacteria | 8657 |
| 334 | Ga0163163_10079819 | 3300014325 | Bacteria | 3271 |
| 335 | Ga0163163_10087627 | 3300014325 | Bacteria | 3123 |
| 336 | Ga0163163_10232362 | 3300014325 | Bacteria | 1893 |
| 337 | Ga0157377_10014190 | 3300014745 | Unclassified | 4049 |
| 338 | Ga0157379_10002533 | 3300014968 | Bacteria | 15321 |
| 339 | Ga0157379_10002832 | 3300014968 | Bacteria | 14622 |
| 340 | Ga0157379_10003697 | 3300014968 | Bacteria | 13012 |
| 341 | Ga0157379_10040827 | 3300014968 | Bacteria | 4142 |
| 342 | Ga0157379_10141662 | 3300014968 | Bacteria | 2167 |
| 343 | Ga0157379_10178642 | 3300014968 | Unclassified | 1917 |
| 344 | Ga0157376_10001001 | 3300014969 | Bacteria | 18414 |
| 345 | Ga0157376_10004976 | 3300014969 | Bacteria | 9265 |
| 346 | Ga0157376_10107903 | 3300014969 | Unclassified | 2445 |
| 347 | Ga0163161_10044961 | 3300017792 | Unclassified | 3182 |
| 348 | Ga0213876_10024130 | 3300021384 | Bacteria | 3210 |
| 349 | Ga0207697_10000769 | 3300025315 | Bacteria | 18175 |
| 350 | Ga0207656_10001590 | 3300025321 | Bacteria | 7559 |
| 351 | Ga0207656_10002766 | 3300025321 | Bacteria | 5956 |
| 352 | Ga0207656_10037730 | 3300025321 | Bacteria | 2035 |
| 353 | Ga0207653_10009984 | 3300025885 | Unclassified | 2961 |
| 354 | Ga0207653_10016042 | 3300025885 | Bacteria | 2352 |
| 355 | Ga0207682_10000952 | 3300025893 | Bacteria | 13429 |
| 356 | Ga0207642_10000161 | 3300025899 | Bacteria | 19124 |
| 357 | Ga0207642_10059116 | 3300025899 | Bacteria | 1771 |
| 358 | Ga0207710_10002672 | 3300025900 | Bacteria | 8201 |
| 359 | Ga0207688_10000036 | 3300025901 | Bacteria | 45651 |
| 360 | Ga0207680_10001207 | 3300025903 | Bacteria | 12237 |
| 361 | Ga0207680_10004309 | 3300025903 | Bacteria | 6744 |
| 362 | Ga0207680_10014854 | 3300025903 | Bacteria | 4046 |
| 363 | Ga0207680_10055199 | 3300025903 | Unclassified | 2393 |
| 364 | Ga0207647_10001314 | 3300025904 | Bacteria | 19085 |
| 365 | Ga0207685_10017861 | 3300025905 | Bacteria | 2305 |
| 366 | Ga0207699_10003623 | 3300025906 | Bacteria | 7384 |
| 367 | Ga0207699_10004959 | 3300025906 | Bacteria | 6363 |
| 368 | Ga0207699_10007957 | 3300025906 | Bacteria | 5204 |
| 369 | Ga0207699_10017652 | 3300025906 | Unclassified | 3763 |
| 370 | Ga0207699_10146995 | 3300025906 | Bacteria | 1555 |
| 371 | Ga0207645_10000493 | 3300025907 | Bacteria | 32522 |
| 372 | Ga0207645_10001498 | 3300025907 | Bacteria | 19105 |
| 373 | Ga0207643_10000006 | 3300025908 | Bacteria | 175924 |
| 374 | Ga0207705_10014191 | 3300025909 | Bacteria | 5739 |
| 375 | Ga0207684_10012001 | 3300025910 | Bacteria | 7545 |
| 376 | Ga0207684_10037406 | 3300025910 | Unclassified | 4118 |
| 377 | Ga0207684_10075220 | 3300025910 | Bacteria | 2870 |
| 378 | Ga0207684_10132980 | 3300025910 | Bacteria | 2135 |
| 379 | Ga0207654_10007915 | 3300025911 | Bacteria | 5358 |
| 380 | Ga0207654_10052052 | 3300025911 | Bacteria | 2359 |
| 381 | Ga0207654_10198978 | 3300025911 | Bacteria | 1318 |
| 382 | Ga0207707_10004762 | 3300025912 | Bacteria | 11895 |
| 383 | Ga0207707_10018919 | 3300025912 | Bacteria | 6004 |
| 384 | Ga0207707_10110925 | 3300025912 | Unclassified | 2398 |
| 385 | Ga0207707_10115999 | 3300025912 | Unclassified | 2340 |
| 386 | Ga0207707_10290326 | 3300025912 | Unclassified | 1415 |
| 387 | Ga0207695_10007028 | 3300025913 | Bacteria | 14444 |
| 388 | Ga0207695_10025634 | 3300025913 | Bacteria | 6595 |
| 389 | Ga0207695_10057852 | 3300025913 | Bacteria | 4026 |
| 390 | Ga0207695_10063519 | 3300025913 | Bacteria | 3806 |
| 391 | Ga0207695_10122846 | 3300025913 | Bacteria | 2562 |
| 392 | Ga0207695_10245152 | 3300025913 | Bacteria | 1692 |
| 393 | Ga0207695_10415910 | 3300025913 | Unclassified | 1229 |
| 394 | Ga0207671_10001581 | 3300025914 | Bacteria | 25872 |
| 395 | Ga0207671_10085088 | 3300025914 | Bacteria | 2375 |
| 396 | Ga0207671_10272033 | 3300025914 | Bacteria | 1335 |
| 397 | Ga0207693_10004475 | 3300025915 | Bacteria | 11819 |
| 398 | Ga0207693_10008125 | 3300025915 | Bacteria | 8601 |
| 399 | Ga0207693_10216578 | 3300025915 | Bacteria | 1505 |
| 400 | Ga0207663_10000776 | 3300025916 | Bacteria | 14293 |
| 401 | Ga0207663_10012147 | 3300025916 | Bacteria | 4646 |
| 402 | Ga0207663_10015988 | 3300025916 | Unclassified | 4151 |
| 403 | Ga0207663_10222138 | 3300025916 | Bacteria | 1375 |
| 404 | Ga0207660_10021352 | 3300025917 | Unclassified | 4354 |
| 405 | Ga0207660_10043088 | 3300025917 | Bacteria | 3170 |
| 406 | Ga0207660_10138866 | 3300025917 | Unclassified | 1856 |
| 407 | Ga0207660_10473096 | 3300025917 | Unclassified | 1015 |
| 408 | Ga0207662_10000058 | 3300025918 | Bacteria | 49029 |
| 409 | Ga0207662_10001436 | 3300025918 | Bacteria | 11559 |
| 410 | Ga0207662_10008037 | 3300025918 | Bacteria | 5756 |
| 411 | Ga0207662_10008666 | 3300025918 | Bacteria | 5578 |
| 412 | Ga0207657_10000287 | 3300025919 | Bacteria | 53627 |
| 413 | Ga0207657_10185247 | 3300025919 | Bacteria | 1681 |
| 414 | Ga0207649_10007844 | 3300025920 | Bacteria | 5808 |
| 415 | Ga0207649_10017513 | 3300025920 | Bacteria | 4061 |
| 416 | Ga0207649_10135422 | 3300025920 | Unclassified | 1679 |
| 417 | Ga0207652_10058207 | 3300025921 | Bacteria | 3330 |
| 418 | Ga0207652_10075214 | 3300025921 | Unclassified | 2943 |
| 419 | Ga0207681_10002435 | 3300025923 | Bacteria | 11800 |
| 420 | Ga0207694_10001374 | 3300025924 | Bacteria | 20950 |
| 421 | Ga0207694_10002438 | 3300025924 | Bacteria | 15161 |
| 422 | Ga0207694_10018408 | 3300025924 | Bacteria | 5279 |
| 423 | Ga0207650_10001667 | 3300025925 | Bacteria | 15809 |
| 424 | Ga0207659_10000084 | 3300025926 | Bacteria | 56518 |
| 425 | Ga0207659_10002106 | 3300025926 | Bacteria | 11787 |
| 426 | Ga0207659_10258057 | 3300025926 | Bacteria | 1417 |
| 427 | Ga0207687_10002350 | 3300025927 | Bacteria | 12858 |
| 428 | Ga0207700_10043751 | 3300025928 | Unclassified | 3291 |
| 429 | Ga0207700_10053421 | 3300025928 | Unclassified | 3027 |
| 430 | Ga0207664_10015043 | 3300025929 | Bacteria | 5604 |
| 431 | Ga0207664_10221152 | 3300025929 | Bacteria | 1642 |
| 432 | Ga0207664_10529602 | 3300025929 | Bacteria | 1056 |
| 433 | Ga0207644_10000310 | 3300025931 | Bacteria | 31669 |
| 434 | Ga0207644_10073915 | 3300025931 | Unclassified | 2500 |
| 435 | Ga0207644_10145009 | 3300025931 | Bacteria | 1832 |
| 436 | Ga0207690_10005075 | 3300025932 | Bacteria | 7777 |
| 437 | Ga0207706_10000536 | 3300025933 | Bacteria | 40290 |
| 438 | Ga0207706_10002695 | 3300025933 | Bacteria | 17320 |
| 439 | Ga0207706_10308473 | 3300025933 | Unclassified | 1378 |
| 440 | Ga0207686_10000985 | 3300025934 | Bacteria | 16956 |
| 441 | Ga0207686_10004417 | 3300025934 | Bacteria | 7543 |
| 442 | Ga0207686_10006126 | 3300025934 | Bacteria | 6460 |
| 443 | Ga0207686_10025201 | 3300025934 | Bacteria | 3456 |
| 444 | Ga0207686_10040510 | 3300025934 | Plasmid | 2833 |
| 445 | Ga0207709_10004600 | 3300025935 | Bacteria | 7942 |
| 446 | Ga0207709_10037271 | 3300025935 | Bacteria | 2888 |
| 447 | Ga0207709_10047124 | 3300025935 | Unclassified | 2619 |
| 448 | Ga0207670_10000465 | 3300025936 | Bacteria | 22581 |
| 449 | Ga0207670_10006220 | 3300025936 | Bacteria | 6611 |
| 450 | Ga0207670_10154113 | 3300025936 | Bacteria | 1708 |
| 451 | Ga0207669_10044367 | 3300025937 | Unclassified | 2611 |
| 452 | Ga0207704_10000202 | 3300025938 | Bacteria | 30625 |
| 453 | Ga0207704_10000227 | 3300025938 | Bacteria | 27993 |
| 454 | Ga0207704_10000884 | 3300025938 | Bacteria | 13285 |
| 455 | Ga0207704_10011384 | 3300025938 | Bacteria | 4378 |
| 456 | Ga0207704_10186722 | 3300025938 | Bacteria | 1504 |
| 457 | Ga0207665_10026649 | 3300025939 | Unclassified | 3816 |
| 458 | Ga0207665_10138957 | 3300025939 | Unclassified | 1730 |
| 459 | Ga0207665_10172531 | 3300025939 | Bacteria | 1562 |
| 460 | Ga0207691_10000158 | 3300025940 | Bacteria | 63253 |
| 461 | Ga0207711_10002197 | 3300025941 | Bacteria | 17511 |
| 462 | Ga0207711_10002262 | 3300025941 | Bacteria | 17276 |
| 463 | Ga0207711_10021749 | 3300025941 | Bacteria | 5357 |
| 464 | Ga0207711_10028169 | 3300025941 | Bacteria | 4726 |
| 465 | Ga0207689_10002916 | 3300025942 | Bacteria | 15787 |
| 466 | Ga0207689_10014871 | 3300025942 | Bacteria | 6605 |
| 467 | Ga0207689_10155695 | 3300025942 | Bacteria | 1884 |
| 468 | Ga0207661_10010988 | 3300025944 | Bacteria | 6540 |
| 469 | Ga0207661_10031092 | 3300025944 | Bacteria | 4119 |
| 470 | Ga0207661_10037270 | 3300025944 | Bacteria | 3802 |
| 471 | Ga0207679_10000285 | 3300025945 | Bacteria | 38370 |
| 472 | Ga0207679_10011834 | 3300025945 | Bacteria | 5671 |
| 473 | Ga0207667_10001685 | 3300025949 | Bacteria | 27840 |
| 474 | Ga0207667_10004549 | 3300025949 | Bacteria | 16995 |
| 475 | Ga0207667_10029855 | 3300025949 | Bacteria | 5906 |
| 476 | Ga0207667_10110814 | 3300025949 | Bacteria | 2831 |
| 477 | Ga0207667_10207899 | 3300025949 | Bacteria | 2006 |
| 478 | Ga0207651_10000236 | 3300025960 | Bacteria | 23920 |
| 479 | Ga0207712_10000430 | 3300025961 | Bacteria | 35819 |
| 480 | Ga0207668_10068553 | 3300025972 | Unclassified | 2522 |
| 481 | Ga0207640_10000231 | 3300025981 | Bacteria | 38522 |
| 482 | Ga0207640_10021151 | 3300025981 | Bacteria | 3872 |
| 483 | Ga0207658_10000226 | 3300025986 | Bacteria | 59037 |
| 484 | Ga0207658_10012398 | 3300025986 | Bacteria | 5822 |
| 485 | Ga0207658_10073671 | 3300025986 | Unclassified | 2592 |
| 486 | Ga0207658_10268181 | 3300025986 | Unclassified | 1458 |
| 487 | Ga0207677_10000139 | 3300026023 | Bacteria | 59238 |
| 488 | Ga0207703_10000744 | 3300026035 | Bacteria | 32129 |
| 489 | Ga0207703_10001032 | 3300026035 | Bacteria | 26743 |
| 490 | Ga0207703_10059034 | 3300026035 | Bacteria | 3134 |
| 491 | Ga0207703_10082076 | 3300026035 | Bacteria | 2689 |
| 492 | Ga0207703_10119404 | 3300026035 | Bacteria | 2261 |
| 493 | Ga0207703_10332788 | 3300026035 | Unclassified | 1393 |
| 494 | Ga0207703_10423434 | 3300026035 | Bacteria | 1239 |
| 495 | Ga0207639_10000013 | 3300026041 | Bacteria | 293084 |
| 496 | Ga0207639_10000301 | 3300026041 | Bacteria | 34996 |
| 497 | Ga0207678_10002930 | 3300026067 | Bacteria | 15467 |
| 498 | Ga0207678_10015349 | 3300026067 | Bacteria | 6737 |
| 499 | Ga0207678_10046215 | 3300026067 | Bacteria | 3765 |
| 500 | Ga0207702_10002096 | 3300026078 | Bacteria | 19216 |
| 501 | Ga0207702_10004872 | 3300026078 | Bacteria | 11818 |
| 502 | Ga0207702_10040707 | 3300026078 | Bacteria | 3895 |
| 503 | Ga0207702_10047332 | 3300026078 | Bacteria | 3624 |
| 504 | Ga0207702_10141262 | 3300026078 | Unclassified | 2179 |
| 505 | Ga0207641_10009128 | 3300026088 | Bacteria | 8189 |
| 506 | Ga0207641_10016219 | 3300026088 | Bacteria | 6101 |
| 507 | Ga0207641_10088064 | 3300026088 | Bacteria | 2710 |
| 508 | Ga0207641_10228425 | 3300026088 | Bacteria | 1729 |
| 509 | Ga0207648_10003801 | 3300026089 | Bacteria | 15787 |
| 510 | Ga0207648_10005082 | 3300026089 | Bacteria | 13332 |
| 511 | Ga0207648_10186284 | 3300026089 | Bacteria | 1839 |
| 512 | Ga0207648_10198440 | 3300026089 | Bacteria | 1779 |
| 513 | Ga0207676_10000525 | 3300026095 | Bacteria | 32174 |
| 514 | Ga0207676_10013565 | 3300026095 | Bacteria | 5849 |
| 515 | Ga0207676_10116267 | 3300026095 | Unclassified | 2247 |
| 516 | Ga0207676_10592699 | 3300026095 | Unclassified | 1064 |
| 517 | Ga0207674_10000302 | 3300026116 | Bacteria | 62546 |
| 518 | Ga0207674_10008636 | 3300026116 | Bacteria | 11738 |
| 519 | Ga0207674_10143934 | 3300026116 | Bacteria | 2343 |
| 520 | Ga0207674_10538337 | 3300026116 | Unclassified | 1128 |
| 521 | Ga0207675_100002753 | 3300026118 | Bacteria | 17283 |
| 522 | Ga0207675_100006946 | 3300026118 | Bacteria | 10709 |
| 523 | Ga0207683_10002149 | 3300026121 | Bacteria | 17319 |
| 524 | Ga0207683_10004562 | 3300026121 | Bacteria | 11929 |
| 525 | Ga0207683_10124571 | 3300026121 | Bacteria | 2315 |
| 526 | Ga0207698_10000778 | 3300026142 | Bacteria | 18550 |
| 527 | Ga0207698_10012184 | 3300026142 | Bacteria | 5614 |
| 528 | Ga0207698_10012253 | 3300026142 | Bacteria | 5603 |
| 529 | Ga0209179_1017216 | 3300027512 | Bacteria | 1367 |
| 530 | Ga0265357_1002467 | 3300028023 | Unclassified | 1516 |
| 531 | Ga0268266_10001085 | 3300028379 | Bacteria | 34116 |
| 532 | Ga0268266_10010120 | 3300028379 | Bacteria | 8268 |
| 533 | Ga0268266_10012883 | 3300028379 | Bacteria | 7219 |
| 534 | Ga0268266_10134877 | 3300028379 | Bacteria | 2210 |
| 535 | Ga0268266_10180023 | 3300028379 | Bacteria | 1924 |
| 536 | Ga0268265_10000337 | 3300028380 | Bacteria | 50945 |
| 537 | Ga0268264_10000851 | 3300028381 | Bacteria | 32561 |
| 538 | Ga0268264_10049582 | 3300028381 | Bacteria | 3494 |
| 539 | Ga0268264_10066246 | 3300028381 | Unclassified | 3045 |
| 540 | Ga0373950_0011152 | 3300034818 | Bacteria | 1464 |
| 541 | Ga0373959_0015981 | 3300034820 | Bacteria | 1385 |
| 542 | Ga0373929_0004504 | 3300035085 | Bacteria | 2494 |
| 543 | Ga0373934_0018833 | 3300035086 | Unclassified | 2644 |
| 544 | Ga0373944_0009517 | 3300035089 | Bacteria | 2636 |
| 545 | Ga0373923_0018397 | 3300035111 | Bacteria | 2688 |
| 546 | Ga0373932_0007020 | 3300035112 | Bacteria | 2675 |
| 547 | Ga0373936_0039107 | 3300035113 | Bacteria | 1898 |
| 548 | Ga0373939_0047719 | 3300035114 | Bacteria | 1316 |
| 549 | Ga0373945_0029580 | 3300035116 | Bacteria | 1925 |
| 550 | Ga0373953_0002623 | 3300035117 | Bacteria | 5438 |
| 551 | Ga0373954_0011246 | 3300035118 | Bacteria | 3962 |
| 552 | Ga0373956_0005444 | 3300035119 | Bacteria | 5098 |
| 553 | Ga0373957_0000926 | 3300035120 | Bacteria | 7681 |
| 554 | Ga0373946_0040610 | 3300035171 | Unclassified | 1904 |
| 555 | Ga0373955_0017115 | 3300035172 | Unclassified | 3581 |
| 556 | Ga0373955_0033353 | 3300035172 | Bacteria | 2711 |
| 557 | Ga0373955_0072550 | 3300035172 | Bacteria | 1928 |
| 558 | Ga0373942_0001186 | 3300035207 | Bacteria | 6880 |
| 559 | Ga0373961_0003320 | 3300035241 | Bacteria | 3999 |
| 560 | Ga0373935_0051092 | 3300035692 | Unclassified | 2625 |
| 561 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 562 | Ga0373927_0003289 | 3300035695 | Bacteria | 11625 |
| 563 | Ga0373933_0017095 | 3300035724 | Bacteria | 4067 |
| 564 | Ga0373947_0087084 | 3300035725 | Unclassified | 1942 |
| 565 | Ga0373937_0039453 | 3300036401 | Unclassified | 4303 |
| 566 | Ga0373937_0158435 | 3300036401 | Bacteria | 2122 |
| 567 | Ga0373937_0356667 | 3300036401 | Bacteria | 1385 |
| 568 | Ga0373937_0522022 | 3300036401 | Bacteria | 1128 |
| 569 | Ga0373937_0662681 | 3300036401 | Unclassified | 989 |
| 570 | Ga0373925_0001491 | 3300037068 | Bacteria | 20107 |
| 571 | Ga0373925_0002736 | 3300037068 | Bacteria | 13953 |
| 572 | Ga0436365_0331968 | 3300039437 | Bacteria | 11197 |
| 573 | Ga0436365_0974486 | 3300039437 | Unclassified | 2495 |
| 574 | Ga0436365_1618990 | 3300039437 | Bacteria | 1605 |
| 575 | Ga0436363_0769682 | 3300039450 | Bacteria | 1261 |
| 576 | Ga0436363_1101025 | 3300039450 | Bacteria | 9025 |
| 577 | Ga0451577_0021412 | 3300042876 | Bacteria | 5917 |
| 578 | Ga0453683_0034709 | 3300044673 | Bacteria | 3179 |
| 579 | Ga0466959_0002177 | 3300045049 | Bacteria | 12460 |
| 580 | Ga0451576_0011992 | 3300045051 | Bacteria | 9788 |
| 581 | Ga0451576_0028567 | 3300045051 | Bacteria | 5971 |
| 582 | Ga0451576_0204434 | 3300045051 | Bacteria | 2062 |
| 583 | Ga0495592_0117256 | 3300046454 | Unclassified | 1877 |
| 584 | Ga0495603_0162849 | 3300046455 | Bacteria | 1294 |
| 585 | Ga0495629_0014013 | 3300046459 | Bacteria | 5778 |
| 586 | Ga0495653_0256785 | 3300046463 | Bacteria | 1157 |
| 587 | Ga0495580_0004169 | 3300046472 | Bacteria | 12158 |
| 588 | Ga0495580_0063065 | 3300046472 | Bacteria | 2600 |
| 589 | Ga0495580_0070136 | 3300046472 | Bacteria | 2448 |
| 590 | Ga0495580_0123182 | 3300046472 | Bacteria | 1799 |
| 591 | Ga0495639_0005130 | 3300046475 | Bacteria | 5627 |
| 592 | Ga0495639_0038437 | 3300046475 | Unclassified | 2149 |
| 593 | Ga0495662_0024979 | 3300046476 | Bacteria | 2885 |
| 594 | Ga0495662_0055275 | 3300046476 | Bacteria | 1918 |
| 595 | Ga0495594_0039110 | 3300046499 | Bacteria | 2592 |
| 596 | Ga0495608_0002384 | 3300046511 | Bacteria | 13511 |
| 597 | Ga0495628_0141900 | 3300046516 | Bacteria | 1833 |
| 598 | Ga0495630_0140515 | 3300046517 | Bacteria | 1836 |
| 599 | Ga0495630_0330969 | 3300046517 | Unclassified | 1165 |
| 600 | Ga0495666_0003273 | 3300046526 | Bacteria | 8175 |
| 601 | Ga0495665_0076022 | 3300046531 | Bacteria | 1767 |
| 602 | Ga0495586_0001734 | 3300046535 | Bacteria | 11890 |
| 603 | Ga0495586_0020456 | 3300046535 | Bacteria | 3524 |
| 604 | Ga0495586_0154189 | 3300046535 | Bacteria | 1293 |
| 605 | Ga0495587_0025081 | 3300046536 | Bacteria | 3646 |
| 606 | Ga0495587_0149087 | 3300046536 | Unclassified | 1333 |
| 607 | Ga0495645_0041363 | 3300046543 | Bacteria | 3361 |
| 608 | Ga0495645_0050149 | 3300046543 | Bacteria | 3039 |
| 609 | Ga0495667_0022298 | 3300046559 | Bacteria | 4266 |
| 610 | Ga0495635_0040303 | 3300046663 | Bacteria | 3227 |
| 611 | Ga0495635_0266231 | 3300046663 | Bacteria | 1153 |
| 612 | Ga0495647_0029969 | 3300046681 | Bacteria | 2016 |
| 613 | Ga0495658_0010096 | 3300046683 | Unclassified | 4717 |
| 614 | Ga0495658_0027054 | 3300046683 | Unclassified | 3081 |
| 615 | Ga0495658_0059082 | 3300046683 | Bacteria | 2195 |
| 616 | Ga0495658_0136958 | 3300046683 | Bacteria | 1494 |
| 617 | Ga0495613_0039829 | 3300046689 | Bacteria | 3482 |
| 618 | Ga0495613_0055576 | 3300046689 | Bacteria | 2908 |
| 619 | Ga0495613_0144619 | 3300046689 | Bacteria | 1697 |
| 620 | Ga0495624_0041188 | 3300046690 | Bacteria | 2956 |
| 621 | Ga0495624_0056175 | 3300046690 | Unclassified | 2478 |
| 622 | Ga0495600_0030591 | 3300046809 | Bacteria | 3487 |
| 623 | Ga0495581_0124705 | 3300047315 | Bacteria | 1499 |
| 624 | Ga0495581_0128620 | 3300047315 | Unclassified | 1476 |
| 625 | Ga0495674_0089577 | 3300047319 | Bacteria | 2630 |
| 626 | Ga0495674_0158279 | 3300047319 | Bacteria | 1896 |
| 627 | Ga0495674_0290172 | 3300047319 | Unclassified | 1338 |
| 628 | Ga0495676_0006246 | 3300047321 | Bacteria | 10960 |
| 629 | Ga0495680_0002407 | 3300047322 | Bacteria | 19189 |
| 630 | Ga0495675_0061140 | 3300047444 | Bacteria | 2386 |
| 631 | Ga0495675_0112917 | 3300047444 | Unclassified | 1695 |
| 632 | Ga0495675_0155657 | 3300047444 | Bacteria | 1410 |
| 633 | Ga0495684_0041582 | 3300047471 | Bacteria | 3522 |
| 634 | Ga0495614_0035790 | 3300048089 | Bacteria | 2133 |
| 635 | Ga0495614_0060229 | 3300048089 | Bacteria | 1631 |
| 636 | Ga0496100_0363956 | 3300048903 | Unclassified | 1095 |
| 637 | Ga0496101_0208726 | 3300048904 | Unclassified | 1512 |
| 638 | Ga0496102_0007908 | 3300048905 | Bacteria | 9088 |
| 639 | Ga0496102_0054168 | 3300048905 | Bacteria | 3657 |
| 640 | Ga0496102_0075606 | 3300048905 | Bacteria | 3096 |
| 641 | Ga0496102_0244169 | 3300048905 | Bacteria | 1693 |
| 642 | Ga0496102_0446483 | 3300048905 | Unclassified | 1213 |
| 643 | Ga0496103_0120574 | 3300048906 | Bacteria | 1670 |
| 644 | Ga0496103_0175842 | 3300048906 | Unclassified | 1375 |
| 645 | Ga0496104_0043838 | 3300048907 | Bacteria | 4202 |
| 646 | Ga0496104_0045374 | 3300048907 | Bacteria | 4133 |
| 647 | Ga0496104_0140054 | 3300048907 | Unclassified | 2324 |
| 648 | Ga0496104_0230403 | 3300048907 | Unclassified | 1764 |
| 649 | Ga0496104_0242813 | 3300048907 | Bacteria | 1713 |
| 650 | Ga0496104_0332461 | 3300048907 | Unclassified | 1432 |
| 651 | Ga0496104_0336690 | 3300048907 | Bacteria | 1422 |
| 652 | Ga0496104_0509589 | 3300048907 | Unclassified | 1114 |
| 653 | Ga0496105_0105093 | 3300048908 | Bacteria | 2331 |
| 654 | Ga0496106_0004837 | 3300048909 | Bacteria | 9966 |
| 655 | Ga0496106_0094018 | 3300048909 | Bacteria | 2317 |
| 656 | Ga0496106_0178675 | 3300048909 | Bacteria | 1684 |
| 657 | Ga0496106_0258798 | 3300048909 | Bacteria | 1392 |
| 658 | Ga0496107_0316086 | 3300048910 | Unclassified | 1162 |
| 659 | Ga0496108_0007609 | 3300048911 | Bacteria | 8772 |
| 660 | Ga0496108_0008710 | 3300048911 | Bacteria | 8224 |
| 661 | Ga0496108_0224673 | 3300048911 | Bacteria | 1632 |
| 662 | Ga0496108_0509436 | 3300048911 | Unclassified | 1051 |
| 663 | Ga0496109_0013119 | 3300048912 | Bacteria | 7169 |
| 664 | Ga0496109_0142542 | 3300048912 | Bacteria | 2241 |
| 665 | Ga0496109_0186054 | 3300048912 | Bacteria | 1951 |
| 666 | Ga0496109_0322444 | 3300048912 | Unclassified | 1458 |
| 667 | Ga0496110_0028390 | 3300048913 | Bacteria | 4805 |
| 668 | Ga0496110_0234598 | 3300048913 | Unclassified | 1669 |
| 669 | Ga0496110_0259050 | 3300048913 | Unclassified | 1583 |
| 670 | Ga0496110_0290657 | 3300048913 | Bacteria | 1489 |
| 671 | Ga0496110_0293559 | 3300048913 | Bacteria | 1481 |
| 672 | Ga0496111_0029228 | 3300048914 | Bacteria | 3913 |
| 673 | Ga0496111_0169862 | 3300048914 | Bacteria | 1620 |
| 674 | Ga0496112_0011731 | 3300048915 | Bacteria | 8021 |
| 675 | Ga0496112_0016657 | 3300048915 | Bacteria | 6891 |
| 676 | Ga0496112_0053239 | 3300048915 | Bacteria | 3974 |
| 677 | Ga0496112_0068036 | 3300048915 | Bacteria | 3517 |
| 678 | Ga0496113_0000059 | 3300048916 | Bacteria | 47591 |
| 679 | Ga0496113_0111833 | 3300048916 | Bacteria | 2127 |
| 680 | Ga0496113_0236226 | 3300048916 | Unclassified | 1458 |
| 681 | Ga0496114_0033432 | 3300048917 | Unclassified | 4237 |
| 682 | Ga0496114_0040024 | 3300048917 | Bacteria | 3879 |
| 683 | Ga0496115_0027414 | 3300048918 | Bacteria | 4456 |
| 684 | Ga0496115_0052152 | 3300048918 | Unclassified | 3281 |
| 685 | Ga0496115_0064748 | 3300048918 | Bacteria | 2952 |
| 686 | Ga0496115_0106532 | 3300048918 | Bacteria | 2301 |
| 687 | Ga0496117_0000303 | 3300048920 | Bacteria | 85952 |
| 688 | Ga0496118_0000300 | 3300048921 | Bacteria | 85952 |
| 689 | Ga0496124_0042796 | 3300048927 | Bacteria | 3896 |
| 690 | Ga0496126_0162779 | 3300048929 | Bacteria | 1905 |
| 691 | nmdc:mga05p37_174549_c1 | 3300050507 | Bacteria | 2619 |
| 692 | nmdc:mga0n895_200563_c1 | 3300050512 | Bacteria | 2026 |
| 693 | nmdc:mga0n895_64412_c1 | 3300050512 | Bacteria | 3626 |
| 694 | nmdc:mga0n895_65907_c1 | 3300050512 | Bacteria | 3586 |
| 695 | nmdc:mga0rr50_134998_c1 | 3300050513 | Bacteria | 1980 |
| 696 | nmdc:mga0rr50_73276_c1 | 3300050513 | Bacteria | 2618 |
| 697 | nmdc:mga08x19_33907_c1 | 3300050514 | Bacteria | 3224 |
| 698 | nmdc:mga08x19_57269_c1 | 3300050514 | Bacteria | 2518 |
| 699 | nmdc:mga08x19_8171_c1 | 3300050514 | Bacteria | 6218 |
| 700 | nmdc:mga0a205_307495_c1 | 3300050515 | Unclassified | 1458 |
| 701 | nmdc:mga0a205_74210_c1 | 3300050515 | Bacteria | 3287 |
| 702 | Ga0495601_0058743 | 3300053077 | Bacteria | 2438 |
| 703 | Ga0495612_0138882 | 3300053078 | Bacteria | 1053 |
| 704 | Ga0495595_0037540 | 3300053084 | Bacteria | 2203 |
| 705 | Ga0495619_0039711 | 3300053085 | Bacteria | 3073 |
| 706 | Ga0500566_0119161 | 3300053094 | Bacteria | 1425 |
| 707 | Ga0228598_1001480 | |||
| 708 | SwRhRL3b_contig_17226 | |||
| 709 | JGI24746J21847_1003590 | |||
| 710 | JGI24737J22298_10022822 | |||
| 711 | JGI24743J22301_10000391 | |||
| 712 | JGI24748J21848_1001286 | |||
| 713 | JGI24749J21850_1000820 | |||
| 714 | JGI24744J21845_10007806 | |||
| 715 | rootH1_10000877 | |||
| 716 | rootH2_10054689 | |||
| 717 | rootH1_10339851 | |||
| 718 | Ga0065712_10001312 | |||
| 719 | Ga0065715_10091793 | |||
| 720 | Ga0065707_10083813 | |||
| 721 | Ga0065707_10199606 | |||
| 722 | Ga0070658_10002422 | |||
| 723 | Ga0070676_10001797 | |||
| 724 | Ga0070676_10032469 | |||
| 725 | Ga0070683_100004691 | |||
| 726 | Ga0070683_100087882 | |||
| 727 | Ga0070690_100003844 | |||
| 728 | Ga0070690_100009570 | |||
| 729 | Ga0070690_100306865 | |||
| 730 | Ga0070670_100004981 | |||
| 731 | Ga0070670_100026437 | |||
| 732 | Ga0070677_10000565 | |||
| 733 | Ga0068869_100000809 | |||
| 734 | Ga0070666_10000495 | |||
| 735 | Ga0070666_10014157 | |||
| 736 | Ga0070666_10293171 | |||
| 737 | Ga0068868_100006077 | |||
| 738 | Ga0070660_100000432 | |||
| 739 | Ga0070689_100000359 | |||
| 740 | Ga0070689_100018603 | |||
| 741 | Ga0070689_100065185 | |||
| 742 | Ga0070691_10042345 | |||
| 743 | Ga0070687_100000075 | |||
| 744 | Ga0070687_100003726 | |||
| 745 | Ga0070687_100003771 | |||
| 746 | Ga0070687_100220678 | |||
| 747 | Ga0070661_100000376 | |||
| 748 | Ga0070661_100009954 | |||
| 749 | Ga0070692_10119555 | |||
| 750 | Ga0070668_100001729 | |||
| 751 | Ga0070668_100273925 | |||
| 752 | Ga0070669_100017768 | |||
| 753 | Ga0070669_100025776 | |||
| 754 | Ga0070675_100005941 | |||
| 755 | Ga0070675_100243538 | |||
| 756 | Ga0070671_100003699 | |||
| 757 | Ga0070671_100007069 | |||
| 758 | Ga0070674_100000117 | |||
| 759 | Ga0070673_100000395 | |||
| 760 | Ga0070673_100013391 | |||
| 761 | Ga0070673_100018407 | |||
| 762 | Ga0070673_100342034 | |||
| 763 | Ga0070688_100000429 | |||
| 764 | Ga0070688_100002165 | |||
| 765 | Ga0070688_100016385 | |||
| 766 | Ga0070688_100096720 | |||
| 767 | Ga0070659_100000464 | |||
| 768 | Ga0070667_100001501 | |||
| 769 | Ga0070667_100005109 | |||
| 770 | Ga0070667_100006211 | |||
| 771 | Ga0070703_10037568 | |||
| 772 | Ga0070709_10022544 | |||
| 773 | Ga0070709_10035054 | |||
| 774 | Ga0070709_10056961 | |||
| 775 | Ga0070709_10211591 | |||
| 776 | Ga0070709_10403020 | |||
| 777 | Ga0070714_100017865 | |||
| 778 | Ga0070714_100046932 | |||
| 779 | Ga0070714_100070844 | |||
| 780 | Ga0070714_100100833 | |||
| 781 | Ga0070713_100016578 | |||
| 782 | Ga0070713_100037167 | |||
| 783 | Ga0070713_100168665 | |||
| 784 | Ga0070713_100239917 | |||
| 785 | Ga0070710_10190510 | |||
| 786 | Ga0070710_10250902 | |||
| 787 | Ga0070701_10017744 | |||
| 788 | Ga0070701_10038203 | |||
| 789 | Ga0070701_10112699 | |||
| 790 | Ga0070711_100138219 | |||
| 791 | Ga0070700_100007428 | |||
| 792 | Ga0070694_100004992 | |||
| 793 | Ga0070694_100013617 | |||
| 794 | Ga0070708_100033888 | |||
| 795 | Ga0070708_100369908 | |||
| 796 | Ga0070663_100000532 | |||
| 797 | Ga0070663_100265092 | |||
| 798 | Ga0070678_100000311 | |||
| 799 | Ga0070678_100020651 | |||
| 800 | Ga0070662_100001208 | |||
| 801 | Ga0070662_100013487 | |||
| 802 | Ga0070662_100045596 | |||
| 803 | Ga0070681_10000483 | |||
| 804 | Ga0070681_10003239 | |||
| 805 | Ga0070681_10027751 | |||
| 806 | Ga0070681_10429823 | |||
| 807 | Ga0068867_100001917 | |||
| 808 | Ga0068867_100004664 | |||
| 809 | Ga0068867_100037194 | |||
| 810 | Ga0068867_100150672 | |||
| 811 | Ga0068867_100185172 | |||
| 812 | Ga0070685_10000591 | |||
| 813 | Ga0070685_10001465 | |||
| 814 | Ga0070685_10001804 | |||
| 815 | Ga0070706_100009963 | |||
| 816 | Ga0070706_100243727 | |||
| 817 | Ga0070707_100173343 | |||
| 818 | Ga0070698_100187080 | |||
| 819 | Ga0070699_100002676 | |||
| 820 | Ga0070699_100060378 | |||
| 821 | Ga0070699_100287934 | |||
| 822 | Ga0070699_100293282 | |||
| 823 | Ga0070679_100012638 | |||
| 824 | Ga0070679_100021836 | |||
| 825 | Ga0070679_100033029 | |||
| 826 | Ga0070684_100001686 | |||
| 827 | Ga0070684_100011339 | |||
| 828 | Ga0070684_100034869 | |||
| 829 | Ga0070684_100388683 | |||
| 830 | Ga0070697_100000691 | |||
| 831 | Ga0070697_100053460 | |||
| 832 | Ga0070697_100117832 | |||
| 833 | Ga0070697_100302342 | |||
| 834 | Ga0068853_100068587 | |||
| 835 | Ga0068853_100073135 | |||
| 836 | Ga0068853_100283767 | |||
| 837 | Ga0068853_100319514 | |||
| 838 | Ga0068853_100334393 | |||
| 839 | Ga0070672_100002450 | |||
| 840 | Ga0070672_100082502 | |||
| 841 | Ga0070686_100001017 | |||
| 842 | Ga0070686_100030020 | |||
| 843 | Ga0070695_100101039 | |||
| 844 | Ga0070696_100049057 | |||
| 845 | Ga0070696_100188326 | |||
| 846 | Ga0070693_100006740 | |||
| 847 | Ga0070693_100112246 | |||
| 848 | Ga0070693_100202690 | |||
| 849 | Ga0070665_100003153 | |||
| 850 | Ga0070665_100004146 | |||
| 851 | Ga0070665_100007582 | |||
| 852 | Ga0070665_100069356 | |||
| 853 | Ga0070704_100009620 | |||
| 854 | Ga0070704_100016220 | |||
| 855 | Ga0070704_100047279 | |||
| 856 | Ga0070704_100397151 | |||
| 857 | Ga0068855_100000656 | |||
| 858 | Ga0068855_100015169 | |||
| 859 | Ga0068855_100101194 | |||
| 860 | Ga0068855_100128188 | |||
| 861 | Ga0068855_100144224 | |||
| 862 | Ga0070664_100017300 | |||
| 863 | Ga0070664_100018787 | |||
| 864 | Ga0068857_100002115 | |||
| 865 | Ga0068857_100004940 | |||
| 866 | Ga0068854_100000875 | |||
| 867 | Ga0068854_100009678 | |||
| 868 | Ga0068854_100122347 | |||
| 869 | Ga0068856_100002312 | |||
| 870 | Ga0068856_100010943 | |||
| 871 | Ga0068856_100024144 | |||
| 872 | Ga0070702_100001982 | |||
| 873 | Ga0070702_100010565 | |||
| 874 | Ga0070702_100064423 | |||
| 875 | Ga0068852_100001719 | |||
| 876 | Ga0068852_100006876 | |||
| 877 | Ga0068852_100015969 | |||
| 878 | Ga0068852_100021699 | |||
| 879 | Ga0068852_100151391 | |||
| 880 | Ga0068859_100002000 | |||
| 881 | Ga0068859_100005743 | |||
| 882 | Ga0068859_100040033 | |||
| 883 | Ga0068859_100057587 | |||
| 884 | Ga0068859_100339478 | |||
| 885 | Ga0068859_100580507 | |||
| 886 | Ga0068864_100001199 | |||
| 887 | Ga0068864_100008528 | |||
| 888 | Ga0068864_100036587 | |||
| 889 | Ga0068866_10006446 | |||
| 890 | Ga0068861_100000090 | |||
| 891 | Ga0068861_100066480 | |||
| 892 | Ga0068851_10000638 | |||
| 893 | Ga0068851_10003308 | |||
| 894 | Ga0068851_10030381 | |||
| 895 | Ga0068870_10000066 | |||
| 896 | Ga0068863_100000550 | |||
| 897 | Ga0068863_100018987 | |||
| 898 | Ga0068863_100116855 | |||
| 899 | Ga0068863_100461319 | |||
| 900 | Ga0068858_100002494 | |||
| 901 | Ga0068858_100002509 | |||
| 902 | Ga0068858_100003900 | |||
| 903 | Ga0068858_100022129 | |||
| 904 | Ga0068858_100034322 | |||
| 905 | Ga0068858_100044699 | |||
| 906 | Ga0068858_100046497 | |||
| 907 | Ga0068858_100068334 | |||
| 908 | Ga0068858_100129639 | |||
| 909 | Ga0068858_100160210 | |||
| 910 | Ga0068860_100006170 | |||
| 911 | Ga0068860_100009663 | |||
| 912 | Ga0068860_100017577 | |||
| 913 | Ga0068860_100035462 | |||
| 914 | Ga0068862_100023443 | |||
| 915 | Ga0081540_1006465 | |||
| 916 | Ga0081539_10141951 | |||
| 917 | Ga0070717_10000034 | |||
| 918 | Ga0070717_10247302 | |||
| 919 | Ga0070715_10084511 | |||
| 920 | Ga0070716_100029024 | |||
| 921 | Ga0070716_100031605 | |||
| 922 | Ga0070716_100035042 | |||
| 923 | Ga0070712_100112094 | |||
| 924 | Ga0070712_100149908 | |||
| 925 | Ga0070712_100229085 | |||
| 926 | Ga0097621_100000631 | |||
| 927 | Ga0097621_100000802 | |||
| 928 | Ga0097621_100004601 | |||
| 929 | Ga0097621_100289252 | |||
| 930 | Ga0068871_100005160 | |||
| 931 | Ga0068871_100040465 | |||
| 932 | Ga0068871_100048216 | |||
| 933 | Ga0068871_100227361 | |||
| 934 | Ga0068871_100383120 | |||
| 935 | Ga0075433_10042531 | |||
| 936 | Ga0075433_10094265 | |||
| 937 | Ga0075433_10111643 | |||
| 938 | Ga0075434_100059266 | |||
| 939 | Ga0075434_100084022 | |||
| 940 | Ga0075434_100109226 | |||
| 941 | Ga0075434_100171700 | |||
| 942 | Ga0068865_100000395 | |||
| 943 | Ga0068865_100017287 | |||
| 944 | Ga0068865_100161093 | |||
| 945 | Ga0068865_100254021 | |||
| 946 | Ga0068865_100327822 | |||
| 947 | Ga0075436_100012974 | |||
| 948 | Ga0075436_100038412 | |||
| 949 | Ga0097620_100002000 | |||
| 950 | Ga0097620_100005743 | |||
| 951 | Ga0097620_100040034 | |||
| 952 | Ga0097620_100057590 | |||
| 953 | Ga0097620_100339485 | |||
| 954 | Ga0097620_100580521 | |||
| 955 | Ga0075435_100002692 | |||
| 956 | Ga0075435_100148265 | |||
| 957 | Ga0075435_100332377 | |||
| 958 | Ga0099794_10018501 | |||
| 959 | Ga0099794_10020620 | |||
| 960 | Ga0099795_10013875 | |||
| 961 | Ga0105250_10036181 | |||
| 962 | Ga0105240_10003275 | |||
| 963 | Ga0105240_10010848 | |||
| 964 | Ga0105240_10043748 | |||
| 965 | Ga0105240_10136465 | |||
| 966 | Ga0105240_10153322 | |||
| 967 | Ga0105240_10350120 | |||
| 968 | Ga0105240_10419426 | |||
| 969 | Ga0105240_10617350 | |||
| 970 | Ga0105245_10000889 | |||
| 971 | Ga0105245_10008188 | |||
| 972 | Ga0105245_10045798 | |||
| 973 | Ga0105245_10302554 | |||
| 974 | Ga0105245_10514541 | |||
| 975 | Ga0105247_10000513 | |||
| 976 | Ga0105247_10123138 | |||
| 977 | Ga0114129_10105033 | |||
| 978 | Ga0105243_10002428 | |||
| 979 | Ga0105243_10008743 | |||
| 980 | Ga0105243_10017159 | |||
| 981 | Ga0105241_10001578 | |||
| 982 | Ga0105241_10080189 | |||
| 983 | Ga0105241_10118651 | |||
| 984 | Ga0105241_10130063 | |||
| 985 | Ga0105242_10000725 | |||
| 986 | Ga0105242_10006529 | |||
| 987 | Ga0105242_10015540 | |||
| 988 | Ga0105242_10048900 | |||
| 989 | Ga0105248_10005149 | |||
| 990 | Ga0105248_10005587 | |||
| 991 | Ga0105248_10040133 | |||
| 992 | Ga0105248_10106563 | |||
| 993 | Ga0105237_10001282 | |||
| 994 | Ga0105237_10146696 | |||
| 995 | Ga0105237_10229705 | |||
| 996 | Ga0105238_10000841 | |||
| 997 | Ga0105238_10000991 | |||
| 998 | Ga0105249_10000538 | |||
| 999 | Ga0105249_10561574 | |||
| 1000 | Ga0099796_10006762 | |||
| 1001 | Ga0105239_10003280 | |||
| 1002 | Ga0105239_10095646 | |||
| 1003 | Ga0105246_10000697 | |||
| 1004 | Ga0157342_1003842 | |||
| 1005 | Ga0157373_10001273 | |||
| 1006 | Ga0157373_10066893 | |||
| 1007 | Ga0157371_10002386 | |||
| 1008 | Ga0157371_10028917 | |||
| 1009 | Ga0157370_10060650 | |||
| 1010 | Ga0157370_10270697 | |||
| 1011 | Ga0157369_10000204 | |||
| 1012 | Ga0157369_10003441 | |||
| 1013 | Ga0157369_10014774 | |||
| 1014 | Ga0157369_10063126 | |||
| 1015 | Ga0157374_10004167 | |||
| 1016 | Ga0157374_10006223 | |||
| 1017 | Ga0157374_10058350 | |||
| 1018 | Ga0157378_10002227 | |||
| 1019 | Ga0157378_10002899 | |||
| 1020 | Ga0157378_10061508 | |||
| 1021 | Ga0163162_10001792 | |||
| 1022 | Ga0163162_10007031 | |||
| 1023 | Ga0163162_10025556 | |||
| 1024 | Ga0163162_10572531 | |||
| 1025 | Ga0157372_10000938 | |||
| 1026 | Ga0157372_10003455 | |||
| 1027 | Ga0157372_10044934 | |||
| 1028 | Ga0157372_10333177 | |||
| 1029 | Ga0157372_10443737 | |||
| 1030 | Ga0157372_10449963 | |||
| 1031 | Ga0157375_10007627 | |||
| 1032 | Ga0157375_10017232 | |||
| 1033 | Ga0157375_10026186 | |||
| 1034 | Ga0157375_10026408 | |||
| 1035 | Ga0157375_10082012 | |||
| 1036 | Ga0163163_10000005 | |||
| 1037 | Ga0163163_10005380 | |||
| 1038 | Ga0163163_10009577 | |||
| 1039 | Ga0163163_10079819 | |||
| 1040 | Ga0163163_10087627 | |||
| 1041 | Ga0163163_10232362 | |||
| 1042 | Ga0157377_10014190 | |||
| 1043 | Ga0157379_10002533 | |||
| 1044 | Ga0157379_10002832 | |||
| 1045 | Ga0157379_10003697 | |||
| 1046 | Ga0157379_10040827 | |||
| 1047 | Ga0157379_10141662 | |||
| 1048 | Ga0157379_10178642 | |||
| 1049 | Ga0157376_10001001 | |||
| 1050 | Ga0157376_10004976 | |||
| 1051 | Ga0157376_10107903 | |||
| 1052 | Ga0163161_10044961 | |||
| 1053 | Ga0213876_10024130 | |||
| 1054 | Ga0207697_10000769 | |||
| 1055 | Ga0207656_10001590 | |||
| 1056 | Ga0207656_10002766 | |||
| 1057 | Ga0207656_10037730 | |||
| 1058 | Ga0207653_10009984 | |||
| 1059 | Ga0207653_10016042 | |||
| 1060 | Ga0207682_10000952 | |||
| 1061 | Ga0207642_10000161 | |||
| 1062 | Ga0207642_10059116 | |||
| 1063 | Ga0207710_10002672 | |||
| 1064 | Ga0207688_10000036 | |||
| 1065 | Ga0207680_10001207 | |||
| 1066 | Ga0207680_10004309 | |||
| 1067 | Ga0207680_10014854 | |||
| 1068 | Ga0207680_10055199 | |||
| 1069 | Ga0207647_10001314 | |||
| 1070 | Ga0207685_10017861 | |||
| 1071 | Ga0207699_10003623 | |||
| 1072 | Ga0207699_10004959 | |||
| 1073 | Ga0207699_10007957 | |||
| 1074 | Ga0207699_10017652 | |||
| 1075 | Ga0207699_10146995 | |||
| 1076 | Ga0207645_10000493 | |||
| 1077 | Ga0207645_10001498 | |||
| 1078 | Ga0207643_10000006 | |||
| 1079 | Ga0207705_10014191 | |||
| 1080 | Ga0207684_10012001 | |||
| 1081 | Ga0207684_10037406 | |||
| 1082 | Ga0207684_10075220 | |||
| 1083 | Ga0207684_10132980 | |||
| 1084 | Ga0207654_10007915 | |||
| 1085 | Ga0207654_10052052 | |||
| 1086 | Ga0207654_10198978 | |||
| 1087 | Ga0207707_10004762 | |||
| 1088 | Ga0207707_10018919 | |||
| 1089 | Ga0207707_10110925 | |||
| 1090 | Ga0207707_10115999 | |||
| 1091 | Ga0207707_10290326 | |||
| 1092 | Ga0207695_10007028 | |||
| 1093 | Ga0207695_10025634 | |||
| 1094 | Ga0207695_10057852 | |||
| 1095 | Ga0207695_10063519 | |||
| 1096 | Ga0207695_10122846 | |||
| 1097 | Ga0207695_10245152 | |||
| 1098 | Ga0207695_10415910 | |||
| 1099 | Ga0207671_10001581 | |||
| 1100 | Ga0207671_10085088 | |||
| 1101 | Ga0207671_10272033 | |||
| 1102 | Ga0207693_10004475 | |||
| 1103 | Ga0207693_10008125 | |||
| 1104 | Ga0207693_10216578 | |||
| 1105 | Ga0207663_10000776 | |||
| 1106 | Ga0207663_10012147 | |||
| 1107 | Ga0207663_10015988 | |||
| 1108 | Ga0207663_10222138 | |||
| 1109 | Ga0207660_10021352 | |||
| 1110 | Ga0207660_10043088 | |||
| 1111 | Ga0207660_10138866 | |||
| 1112 | Ga0207660_10473096 | |||
| 1113 | Ga0207662_10000058 | |||
| 1114 | Ga0207662_10001436 | |||
| 1115 | Ga0207662_10008037 | |||
| 1116 | Ga0207662_10008666 | |||
| 1117 | Ga0207657_10000287 | |||
| 1118 | Ga0207657_10185247 | |||
| 1119 | Ga0207649_10007844 | |||
| 1120 | Ga0207649_10017513 | |||
| 1121 | Ga0207649_10135422 | |||
| 1122 | Ga0207652_10058207 | |||
| 1123 | Ga0207652_10075214 | |||
| 1124 | Ga0207681_10002435 | |||
| 1125 | Ga0207694_10001374 | |||
| 1126 | Ga0207694_10002438 | |||
| 1127 | Ga0207694_10018408 | |||
| 1128 | Ga0207650_10001667 | |||
| 1129 | Ga0207659_10000084 | |||
| 1130 | Ga0207659_10002106 | |||
| 1131 | Ga0207659_10258057 | |||
| 1132 | Ga0207687_10002350 | |||
| 1133 | Ga0207700_10043751 | |||
| 1134 | Ga0207700_10053421 | |||
| 1135 | Ga0207664_10015043 | |||
| 1136 | Ga0207664_10221152 | |||
| 1137 | Ga0207664_10529602 | |||
| 1138 | Ga0207644_10000310 | |||
| 1139 | Ga0207644_10073915 | |||
| 1140 | Ga0207644_10145009 | |||
| 1141 | Ga0207690_10005075 | |||
| 1142 | Ga0207706_10000536 | |||
| 1143 | Ga0207706_10002695 | |||
| 1144 | Ga0207706_10308473 | |||
| 1145 | Ga0207686_10000985 | |||
| 1146 | Ga0207686_10004417 | |||
| 1147 | Ga0207686_10006126 | |||
| 1148 | Ga0207686_10025201 | |||
| 1149 | Ga0207686_10040510 | |||
| 1150 | Ga0207709_10004600 | |||
| 1151 | Ga0207709_10037271 | |||
| 1152 | Ga0207709_10047124 | |||
| 1153 | Ga0207670_10000465 | |||
| 1154 | Ga0207670_10006220 | |||
| 1155 | Ga0207670_10154113 | |||
| 1156 | Ga0207669_10044367 | |||
| 1157 | Ga0207704_10000202 | |||
| 1158 | Ga0207704_10000227 | |||
| 1159 | Ga0207704_10000884 | |||
| 1160 | Ga0207704_10011384 | |||
| 1161 | Ga0207704_10186722 | |||
| 1162 | Ga0207665_10026649 | |||
| 1163 | Ga0207665_10138957 | |||
| 1164 | Ga0207665_10172531 | |||
| 1165 | Ga0207691_10000158 | |||
| 1166 | Ga0207711_10002197 | |||
| 1167 | Ga0207711_10002262 | |||
| 1168 | Ga0207711_10021749 | |||
| 1169 | Ga0207711_10028169 | |||
| 1170 | Ga0207689_10002916 | |||
| 1171 | Ga0207689_10014871 | |||
| 1172 | Ga0207689_10155695 | |||
| 1173 | Ga0207661_10010988 | |||
| 1174 | Ga0207661_10031092 | |||
| 1175 | Ga0207661_10037270 | |||
| 1176 | Ga0207679_10000285 | |||
| 1177 | Ga0207679_10011834 | |||
| 1178 | Ga0207667_10001685 | |||
| 1179 | Ga0207667_10004549 | |||
| 1180 | Ga0207667_10029855 | |||
| 1181 | Ga0207667_10110814 | |||
| 1182 | Ga0207667_10207899 | |||
| 1183 | Ga0207651_10000236 | |||
| 1184 | Ga0207712_10000430 | |||
| 1185 | Ga0207668_10068553 | |||
| 1186 | Ga0207640_10000231 | |||
| 1187 | Ga0207640_10021151 | |||
| 1188 | Ga0207658_10000226 | |||
| 1189 | Ga0207658_10012398 | |||
| 1190 | Ga0207658_10073671 | |||
| 1191 | Ga0207658_10268181 | |||
| 1192 | Ga0207677_10000139 | |||
| 1193 | Ga0207703_10000744 | |||
| 1194 | Ga0207703_10001032 | |||
| 1195 | Ga0207703_10059034 | |||
| 1196 | Ga0207703_10082076 | |||
| 1197 | Ga0207703_10119404 | |||
| 1198 | Ga0207703_10332788 | |||
| 1199 | Ga0207703_10423434 | |||
| 1200 | Ga0207639_10000013 | |||
| 1201 | Ga0207639_10000301 | |||
| 1202 | Ga0207678_10002930 | |||
| 1203 | Ga0207678_10015349 | |||
| 1204 | Ga0207678_10046215 | |||
| 1205 | Ga0207702_10002096 | |||
| 1206 | Ga0207702_10004872 | |||
| 1207 | Ga0207702_10040707 | |||
| 1208 | Ga0207702_10047332 | |||
| 1209 | Ga0207702_10141262 | |||
| 1210 | Ga0207641_10009128 | |||
| 1211 | Ga0207641_10016219 | |||
| 1212 | Ga0207641_10088064 | |||
| 1213 | Ga0207641_10228425 | |||
| 1214 | Ga0207648_10003801 | |||
| 1215 | Ga0207648_10005082 | |||
| 1216 | Ga0207648_10186284 | |||
| 1217 | Ga0207648_10198440 | |||
| 1218 | Ga0207676_10000525 | |||
| 1219 | Ga0207676_10013565 | |||
| 1220 | Ga0207676_10116267 | |||
| 1221 | Ga0207676_10592699 | |||
| 1222 | Ga0207674_10000302 | |||
| 1223 | Ga0207674_10008636 | |||
| 1224 | Ga0207674_10143934 | |||
| 1225 | Ga0207674_10538337 | |||
| 1226 | Ga0207675_100002753 | |||
| 1227 | Ga0207675_100006946 | |||
| 1228 | Ga0207683_10002149 | |||
| 1229 | Ga0207683_10004562 | |||
| 1230 | Ga0207683_10124571 | |||
| 1231 | Ga0207698_10000778 | |||
| 1232 | Ga0207698_10012184 | |||
| 1233 | Ga0207698_10012253 | |||
| 1234 | Ga0209179_1017216 | |||
| 1235 | Ga0265357_1002467 | |||
| 1236 | Ga0268266_10001085 | |||
| 1237 | Ga0268266_10010120 | |||
| 1238 | Ga0268266_10012883 | |||
| 1239 | Ga0268266_10134877 | |||
| 1240 | Ga0268266_10180023 | |||
| 1241 | Ga0268265_10000337 | |||
| 1242 | Ga0268264_10000851 | |||
| 1243 | Ga0268264_10049582 | |||
| 1244 | Ga0268264_10066246 | |||
| 1245 | Ga0373950_0011152 | |||
| 1246 | Ga0373959_0015981 | |||
| 1247 | Ga0373929_0004504 | |||
| 1248 | Ga0373934_0018833 | |||
| 1249 | Ga0373944_0009517 | |||
| 1250 | Ga0373923_0018397 | |||
| 1251 | Ga0373932_0007020 | |||
| 1252 | Ga0373936_0039107 | |||
| 1253 | Ga0373939_0047719 | |||
| 1254 | Ga0373945_0029580 | |||
| 1255 | Ga0373953_0002623 | |||
| 1256 | Ga0373954_0011246 | |||
| 1257 | Ga0373956_0005444 | |||
| 1258 | Ga0373957_0000926 | |||
| 1259 | Ga0373946_0040610 | |||
| 1260 | Ga0373955_0017115 | |||
| 1261 | Ga0373955_0033353 | |||
| 1262 | Ga0373955_0072550 | |||
| 1263 | Ga0373942_0001186 | |||
| 1264 | Ga0373961_0003320 | |||
| 1265 | Ga0373935_0051092 | |||
| 1266 | Ga0373927_0000002 | |||
| 1267 | Ga0373927_0003289 | |||
| 1268 | Ga0373933_0017095 | |||
| 1269 | Ga0373947_0087084 | |||
| 1270 | Ga0373937_0039453 | |||
| 1271 | Ga0373937_0158435 | |||
| 1272 | Ga0373937_0356667 | |||
| 1273 | Ga0373937_0522022 | |||
| 1274 | Ga0373937_0662681 | |||
| 1275 | Ga0373925_0001491 | |||
| 1276 | Ga0373925_0002736 | |||
| 1277 | Ga0436365_0331968 | |||
| 1278 | Ga0436365_0974486 | |||
| 1279 | Ga0436365_1618990 | |||
| 1280 | Ga0436363_0769682 | |||
| 1281 | Ga0436363_1101025 | |||
| 1282 | Ga0451577_0021412 | |||
| 1283 | Ga0453683_0034709 | |||
| 1284 | Ga0466959_0002177 | |||
| 1285 | Ga0451576_0011992 | |||
| 1286 | Ga0451576_0028567 | |||
| 1287 | Ga0451576_0204434 | |||
| 1288 | Ga0495592_0117256 | |||
| 1289 | Ga0495603_0162849 | |||
| 1290 | Ga0495629_0014013 | |||
| 1291 | Ga0495653_0256785 | |||
| 1292 | Ga0495580_0004169 | |||
| 1293 | Ga0495580_0063065 | |||
| 1294 | Ga0495580_0070136 | |||
| 1295 | Ga0495580_0123182 | |||
| 1296 | Ga0495639_0005130 | |||
| 1297 | Ga0495639_0038437 | |||
| 1298 | Ga0495662_0024979 | |||
| 1299 | Ga0495662_0055275 | |||
| 1300 | Ga0495594_0039110 | |||
| 1301 | Ga0495608_0002384 | |||
| 1302 | Ga0495628_0141900 | |||
| 1303 | Ga0495630_0140515 | |||
| 1304 | Ga0495630_0330969 | |||
| 1305 | Ga0495666_0003273 | |||
| 1306 | Ga0495665_0076022 | |||
| 1307 | Ga0495586_0001734 | |||
| 1308 | Ga0495586_0020456 | |||
| 1309 | Ga0495586_0154189 | |||
| 1310 | Ga0495587_0025081 | |||
| 1311 | Ga0495587_0149087 | |||
| 1312 | Ga0495645_0041363 | |||
| 1313 | Ga0495645_0050149 | |||
| 1314 | Ga0495667_0022298 | |||
| 1315 | Ga0495635_0040303 | |||
| 1316 | Ga0495635_0266231 | |||
| 1317 | Ga0495647_0029969 | |||
| 1318 | Ga0495658_0010096 | |||
| 1319 | Ga0495658_0027054 | |||
| 1320 | Ga0495658_0059082 | |||
| 1321 | Ga0495658_0136958 | |||
| 1322 | Ga0495613_0039829 | |||
| 1323 | Ga0495613_0055576 | |||
| 1324 | Ga0495613_0144619 | |||
| 1325 | Ga0495624_0041188 | |||
| 1326 | Ga0495624_0056175 | |||
| 1327 | Ga0495600_0030591 | |||
| 1328 | Ga0495581_0124705 | |||
| 1329 | Ga0495581_0128620 | |||
| 1330 | Ga0495674_0089577 | |||
| 1331 | Ga0495674_0158279 | |||
| 1332 | Ga0495674_0290172 | |||
| 1333 | Ga0495676_0006246 | |||
| 1334 | Ga0495680_0002407 | |||
| 1335 | Ga0495675_0061140 | |||
| 1336 | Ga0495675_0112917 | |||
| 1337 | Ga0495675_0155657 | |||
| 1338 | Ga0495684_0041582 | |||
| 1339 | Ga0495614_0035790 | |||
| 1340 | Ga0495614_0060229 | |||
| 1341 | Ga0496100_0363956 | |||
| 1342 | Ga0496101_0208726 | |||
| 1343 | Ga0496102_0007908 | |||
| 1344 | Ga0496102_0054168 | |||
| 1345 | Ga0496102_0075606 | |||
| 1346 | Ga0496102_0244169 | |||
| 1347 | Ga0496102_0446483 | |||
| 1348 | Ga0496103_0120574 | |||
| 1349 | Ga0496103_0175842 | |||
| 1350 | Ga0496104_0043838 | |||
| 1351 | Ga0496104_0045374 | |||
| 1352 | Ga0496104_0140054 | |||
| 1353 | Ga0496104_0230403 | |||
| 1354 | Ga0496104_0242813 | |||
| 1355 | Ga0496104_0332461 | |||
| 1356 | Ga0496104_0336690 | |||
| 1357 | Ga0496104_0509589 | |||
| 1358 | Ga0496105_0105093 | |||
| 1359 | Ga0496106_0004837 | |||
| 1360 | Ga0496106_0094018 | |||
| 1361 | Ga0496106_0178675 | |||
| 1362 | Ga0496106_0258798 | |||
| 1363 | Ga0496107_0316086 | |||
| 1364 | Ga0496108_0007609 | |||
| 1365 | Ga0496108_0008710 | |||
| 1366 | Ga0496108_0224673 | |||
| 1367 | Ga0496108_0509436 | |||
| 1368 | Ga0496109_0013119 | |||
| 1369 | Ga0496109_0142542 | |||
| 1370 | Ga0496109_0186054 | |||
| 1371 | Ga0496109_0322444 | |||
| 1372 | Ga0496110_0028390 | |||
| 1373 | Ga0496110_0234598 | |||
| 1374 | Ga0496110_0259050 | |||
| 1375 | Ga0496110_0290657 | |||
| 1376 | Ga0496110_0293559 | |||
| 1377 | Ga0496111_0029228 | |||
| 1378 | Ga0496111_0169862 | |||
| 1379 | Ga0496112_0011731 | |||
| 1380 | Ga0496112_0016657 | |||
| 1381 | Ga0496112_0053239 | |||
| 1382 | Ga0496112_0068036 | |||
| 1383 | Ga0496113_0000059 | |||
| 1384 | Ga0496113_0111833 | |||
| 1385 | Ga0496113_0236226 | |||
| 1386 | Ga0496114_0033432 | |||
| 1387 | Ga0496114_0040024 | |||
| 1388 | Ga0496115_0027414 | |||
| 1389 | Ga0496115_0052152 | |||
| 1390 | Ga0496115_0064748 | |||
| 1391 | Ga0496115_0106532 | |||
| 1392 | Ga0496117_0000303 | |||
| 1393 | Ga0496118_0000300 | |||
| 1394 | Ga0496124_0042796 | |||
| 1395 | Ga0496126_0162779 | |||
| 1396 | nmdc:mga05p37_174549_c1 | |||
| 1397 | nmdc:mga0n895_200563_c1 | |||
| 1398 | nmdc:mga0n895_64412_c1 | |||
| 1399 | nmdc:mga0n895_65907_c1 | |||
| 1400 | nmdc:mga0rr50_134998_c1 | |||
| 1401 | nmdc:mga0rr50_73276_c1 | |||
| 1402 | nmdc:mga08x19_33907_c1 | |||
| 1403 | nmdc:mga08x19_57269_c1 | |||
| 1404 | nmdc:mga08x19_8171_c1 | |||
| 1405 | nmdc:mga0a205_307495_c1 | |||
| 1406 | nmdc:mga0a205_74210_c1 | |||
| 1407 | Ga0495601_0058743 | |||
| 1408 | Ga0495612_0138882 | |||
| 1409 | Ga0495595_0037540 | |||
| 1410 | Ga0495619_0039711 | |||
| 1411 | Ga0500566_0119161 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9463 | 1 | 79 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.9454 | 1 | 80 |
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9437 | 1 | 79 |
| 4iht-assembly2.cif.gz_C | crystal structure of benm_dbd/bena site 1 dna complex | 0.9431 | 1 | 79 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9421 | 1 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACQ4_1_84_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9625 | 1 | 81 | 1.10.10.10 |
| af_P37682_6_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9586 | 1 | 78 | 1.10.10.10 |
| af_P36771_5_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9578 | 1 | 79 | 1.10.10.10 |
| af_P67660_2_90_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9576 | 1 | 78 | 1.10.10.10 |
| af_P0ACR7_1_84_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.956 | 1 | 78 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z0D4P5-F1-model_v4 | DNA-binding transcriptional LysR family regulator | 0.8773 | 84 | 297 |
GO:0000976
GO:0006355 |
| AF-A0A4U3ADC5-F1-model_v4 | deleted | 0.8612 | 84 | 256 |
|
| AF-A0A3S2C6S0-F1-model_v4 | LysR family transcriptional regulator | 0.8566 | 163 | 263 |
GO:0000976
GO:0006355 |
| AF-A0A6L4A263-F1-model_v4 | LysR family transcriptional regulator | 0.8473 | 165 | 262 |
GO:0000976
GO:0006355 |
| AF-A0A7Z0D4P5-F1-model_v4 | DNA-binding transcriptional LysR family regulator | 0.8259 | 84 | 297 |
GO:0000976
GO:0006355 |