F476407

General Info

Members Datasets Scaffolds Average Seq Length
705 525 1410 549

Family's Representative Sequence

Representative Sequence 3300027666|Ga0209282_1000222|Ga0209282_10002229
Length 625
Sequence VGRKELRTLPRPTITVQLQISDRTQTIPNHRHAVKDYFPIFMIFILMTAFAPFPAPYYTRAASGGQKGQVKLVKQWVERLFAGLSATGIVFGTVLFCASLTPSLLPRTWLMQGVLCGFSFAIGYMIGVALHAIWAYLELPEPSRHNVRGVRFLIALAAAITAIAFLWQAKDWQNSIRVLMELDPLPSAHPTKTGGLAVLVAALLIGAGRLFQVIRRFFAARSRHFLPRRLANVLGIAAAIVLSWMLLNGLIFDIGLKFADSSLKQVDSLIEPDVPRPADPLKTGSSASLMTWESLGRRGREFVAEGPAGTQISAFTHRPAKEPLRVYAGLNSAATPEERAALALQELKRVGGFERKVLLVVIPTGTGWIDPEALDTVEYLHDGDIASVAVQYSYLSSWIALLTEPDYGVETARALFEAVYGYWTTLPKETRPKLYLHGLSLGSLNSQKSSDLYDVLSDPFQGALWSGPPFSSPTWRMATNGRVEGTPEWLPRFRDSSVIRFANQYTTAHMPGVDWGPMRIVYLQYASDPITFFEAASLYRRPQWMVHHGPDVSTSFRWFPVVTLLQLGLDVAAATTAPMGYGHVYAPEHYIDAWMEVTQPQGWNAEDIQRLKMLFKARRGSTDPA

Samples

Sample ID Description Type Environment
1 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
64 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
65 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
66 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
67 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
68 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
71 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
111 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
112 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
187 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
190 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
196 2509276019 Ensifer aridi TW10 Isolate Nodule
197 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
198 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
199 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
200 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
201 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
202 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
203 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
204 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
205 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
206 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
207 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
208 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
209 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
210 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
211 2516143018 Ensifer sp. BR816 Isolate Nodule
212 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
213 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
214 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
215 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
216 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
217 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
218 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
219 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
220 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
221 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
222 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
223 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
224 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
225 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
226 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
227 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
228 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
229 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
230 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
231 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
232 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
233 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
234 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
235 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
236 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
237 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
238 2643221557 Ensifer sp. Root558 Isolate Unclassified
239 2643221568 Rhizobium sp. Root564 Isolate Unclassified
240 2643221580 Devosia sp. Root635 Isolate Unclassified
241 2643221582 Rhizobium sp. Root651 Isolate Unclassified
242 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
243 2643221607 Rhizobium sp. Root73 Isolate Unclassified
244 2643221610 Ensifer sp. Root74 Isolate Unclassified
245 2643221618 Ensifer sp. Root231 Isolate Unclassified
246 2643221621 Achromobacter sp. Root83 Isolate Unclassified
247 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
248 2643221626 Ensifer sp. Root31 Isolate Unclassified
249 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
250 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
251 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
252 2643221655 Ensifer sp. Root1252 Isolate Unclassified
253 2643221659 Ensifer sp. Root127 Isolate Unclassified
254 2643221668 Ensifer sp. Root423 Isolate Unclassified
255 2643221674 Devosia sp. Root436 Isolate Unclassified
256 2643221675 Ensifer sp. Root1298 Isolate Unclassified
257 2643221680 Ensifer sp. Root1312 Isolate Unclassified
258 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
259 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
260 2643221693 Rhizobium sp. Root491 Isolate Unclassified
261 2643221698 Ensifer sp. Root142 Isolate Unclassified
262 2643221712 Ensifer sp. Root258 Isolate Unclassified
263 2643221718 Rhizobium sp. Root268 Isolate Unclassified
264 2643221723 Ensifer sp. Root278 Isolate Unclassified
265 2643221726 Ensifer sp. Root954 Isolate Unclassified
266 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
267 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
268 2738541293 Rhizobium sp. GV031 Isolate Unclassified
269 2738543024 Aminobacter sp. AP02 Isolate Unclassified
270 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
271 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
272 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
273 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
274 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
275 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
276 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
277 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
278 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
279 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
280 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
281 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
282 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
283 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
284 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
285 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
286 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
287 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
288 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
289 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
290 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
291 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
292 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
293 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
294 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
295 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
296 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
297 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
298 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
299 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
300 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
301 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
302 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
303 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
304 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
305 2844163670 Ensifer sp. 1H6 Isolate Unclassified
306 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
307 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
308 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
309 2854911287 Brucella lupini LUP21 Isolate Unclassified
310 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
311 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
312 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
313 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
314 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
315 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
316 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
317 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
318 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
319 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
320 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
321 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
322 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
323 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
324 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
325 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
326 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
327 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
328 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
329 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
330 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
331 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
332 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
333 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
334 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
335 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
336 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
337 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
338 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
339 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
340 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
341 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
342 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
343 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
344 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
345 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
346 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
347 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
348 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
349 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
350 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
351 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
352 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
353 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
354 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
355 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
356 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
357 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
358 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
359 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
360 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
361 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
362 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
363 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
364 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
365 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
366 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
367 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
368 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
369 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
370 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
371 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
372 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
373 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
374 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
375 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
376 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
377 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
378 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
379 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
380 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
381 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
382 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
383 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
384 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
385 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
386 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
387 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
388 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
389 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
390 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
391 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
392 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
393 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
394 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
395 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
396 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
397 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
398 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
399 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
400 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
401 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
402 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
403 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
404 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
405 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
406 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
407 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
408 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
409 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
410 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
411 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
412 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
413 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
414 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
415 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
416 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
417 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
418 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
419 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
420 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
421 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
422 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
423 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
424 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
425 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
426 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
427 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
428 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
429 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
430 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
431 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
432 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
433 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
434 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
435 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
436 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
437 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
438 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
439 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
440 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
441 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
442 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
443 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
444 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
445 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
446 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
447 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
448 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
449 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
450 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
451 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
452 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
453 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
454 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
455 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
456 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
457 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
458 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
459 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
460 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
461 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
462 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
463 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
464 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
465 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
466 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
467 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
468 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
469 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
470 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
471 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
472 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
473 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
474 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
475 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
476 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
477 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
478 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
479 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
480 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
481 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
482 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
483 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
484 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
485 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
486 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
487 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
488 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
489 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
490 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
491 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
492 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
493 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
494 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
495 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
496 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
497 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
498 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
499 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
500 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
501 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
502 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
503 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
504 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
505 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
506 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
507 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
508 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
509 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
510 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
511 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
512 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
513 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
514 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
515 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
516 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
517 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
518 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
519 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
520 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
521 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
522 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
523 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
524 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
525 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.91
Metatranscriptomes 0.14
Isolates 46.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 14.47
Nodule 36.74
Rhizoplane 2.55
Rhizosphere 27.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209282_1000222 3300027666 Bacteria 29551
2 JGI25162J39368_1000617 3300002737 Bacteria 25480
3 JGI25158J39367_1000251 3300002739 Bacteria 12351
4 JGI25152J39213_1000727 3300002773 Bacteria 16903
5 JGI25152J39213_1002986 3300002773 Bacteria 6000
6 JGI25152J39213_1005989 3300002773 Bacteria 3410
7 JGI25150J39212_1000160 3300002774 Bacteria 38064
8 JGI25159J45721_1000073 3300002987 Bacteria 48504
9 JGI25151J46595_10000083 3300003187 Bacteria 130658
10 JGI25151J46595_10021626 3300003187 Bacteria 2687
11 JGI25151J46595_10029039 3300003187 Bacteria 2196
12 JGI25406J46586_10002920 3300003203 Bacteria 8060
13 JGI25165J46597_1000416 3300003214 Bacteria 44195
14 JGI25153J46596_10000377 3300003215 Bacteria 30499
15 JGI25153J46596_10001690 3300003215 Bacteria 13087
16 rootH1_10145948 3300003323 Bacteria 2416
17 rootH1_10245112 3300003323 Bacteria 3295
18 JGI25160J50197_1000020 3300003354 Bacteria 232739
19 JGI25160J50197_1000087 3300003354 Bacteria 93379
20 JGI25160J50197_1012767 3300003354 Bacteria 2895
21 JGI25161J50226_1000066 3300003374 Bacteria 94505
22 JGI25161J50226_1000170 3300003374 Bacteria 44244
23 JGI25161J50226_1000856 3300003374 Bacteria 11272
24 Ga0006562J51391_1024319 3300003578 Bacteria 3410
25 Ga0055526_1002182 3300003771 Bacteria 13414
26 Ga0055526_1002581 3300003771 Bacteria 12104
27 Ga0055524_1005926 3300003775 Bacteria 5382
28 Ga0055536_1000618 3300003781 Bacteria 24148
29 Ga0055530_10001081 3300003791 Bacteria 21459
30 Ga0055530_10002197 3300003791 Bacteria 12906
31 Ga0055540_1011849 3300003792 Bacteria 2779
32 Ga0055531_10000338 3300003794 Bacteria 46156
33 Ga0055531_10004558 3300003794 Bacteria 8383
34 Ga0055543_1000068 3300004625 Bacteria 94795
35 Ga0055543_1000163 3300004625 Bacteria 55480
36 Ga0055543_1000342 3300004625 Bacteria 31912
37 Ga0065165_1000013 3300005262 Bacteria 301887
38 Ga0065165_1000839 3300005262 Bacteria 40355
39 Ga0065165_1003220 3300005262 Bacteria 11884
40 Ga0065165_1008693 3300005262 Bacteria 4696
41 Ga0065165_1012858 3300005262 Bacteria 3374
42 Ga0070680_100010201 3300005336 Bacteria 7243
43 Ga0070680_100017091 3300005336 Bacteria 5715
44 Ga0070691_10029764 3300005341 Bacteria 2556
45 Ga0070709_10032591 3300005434 Bacteria 3143
46 Ga0070701_10011473 3300005438 Bacteria 3963
47 Ga0070705_100000771 3300005440 Bacteria 18094
48 Ga0070705_100004354 3300005440 Bacteria 6892
49 Ga0070700_100001946 3300005441 Bacteria 10472
50 Ga0070694_100000473 3300005444 Bacteria 22031
51 Ga0070694_100001936 3300005444 Bacteria 12274
52 Ga0070708_100094484 3300005445 Bacteria 2728
53 Ga0070663_100002012 3300005455 Bacteria 11353
54 Ga0070663_100043414 3300005455 Bacteria 3164
55 Ga0070663_100128437 3300005455 Bacteria 1922
56 Ga0070681_10117168 3300005458 Bacteria 2600
57 Ga0070698_100046693 3300005471 Bacteria 4428
58 Ga0070699_100004529 3300005518 Bacteria 12302
59 Ga0070699_100007119 3300005518 Bacteria 9717
60 Ga0070679_100046589 3300005530 Bacteria 4321
61 Ga0070697_100006390 3300005536 Bacteria 9125
62 Ga0070697_100007929 3300005536 Bacteria 8275
63 Ga0070695_100000316 3300005545 Bacteria 24725
64 Ga0070695_100001732 3300005545 Bacteria 12274
65 Ga0070696_100000295 3300005546 Bacteria 30048
66 Ga0070696_100002462 3300005546 Bacteria 12274
67 Ga0070665_100015391 3300005548 Bacteria 7681
68 Ga0070704_100000136 3300005549 Bacteria 27377
69 Ga0070704_100005198 3300005549 Bacteria 7571
70 Ga0068857_100018215 3300005577 Bacteria 6159
71 Ga0068857_100093549 3300005577 Bacteria 2692
72 Ga0068859_100016079 3300005617 Bacteria 7517
73 Ga0068860_100018500 3300005843 Bacteria 6776
74 Ga0068862_100000584 3300005844 Bacteria 37976
75 Ga0068862_100003537 3300005844 Bacteria 13406
76 Ga0081455_10005789 3300005937 Bacteria 13470
77 Ga0081455_10021295 3300005937 Bacteria 6084
78 Ga0081455_10039598 3300005937 Bacteria 4164
79 Ga0081538_10046156 3300005981 Bacteria 2691
80 Ga0081538_10072829 3300005981 Bacteria 1881
81 Ga0081540_1000433 3300005983 Bacteria 41246
82 Ga0081540_1000747 3300005983 Bacteria 29934
83 Ga0081540_1004020 3300005983 Bacteria 11389
84 Ga0081539_10000501 3300005985 Bacteria 82104
85 Ga0070717_10132317 3300006028 Bacteria 2146
86 Ga0075365_10097095 3300006038 Bacteria 2014
87 Ga0075364_10000091 3300006051 Bacteria 36563
88 Ga0075364_10001796 3300006051 Bacteria 11886
89 Ga0075367_10029046 3300006178 Bacteria 3160
90 Ga0075369_10007129 3300006186 Bacteria 4248
91 Ga0075366_10013926 3300006195 Bacteria 4585
92 Ga0097620_100016079 3300006931 Bacteria 7517
93 Ga0079104_1005814 3300006946 Bacteria 4828
94 Ga0079104_1007489 3300006946 Bacteria 3949
95 Ga0099826_10000030 3300006948 Bacteria 128684
96 Ga0099826_10018729 3300006948 Bacteria 5219
97 Ga0105251_10014590 3300009011 Bacteria 4333
98 Ga0105249_10000560 3300009553 Bacteria 34270
99 Ga0105249_10012793 3300009553 Bacteria 7400
100 Ga0105249_10129164 3300009553 Bacteria 2410
101 Ga0157373_10014167 3300013100 Bacteria 5847
102 Ga0157373_10096508 3300013100 Bacteria 2081
103 Ga0157371_10000307 3300013102 Bacteria 63760
104 Ga0157371_10006146 3300013102 Bacteria 9970
105 Ga0157369_10011799 3300013105 Bacteria 9922
106 Ga0171463_1003 3300013249 Bacteria 695693
107 Ga0183363_1055 3300015690 Bacteria 36103
108 Ga0214544_1000004 3300021320 Bacteria 455869
109 Ga0214544_1000010 3300021320 Bacteria 270164
110 Ga0214542_1000012 3300021321 Bacteria 235800
111 Ga0214542_1000442 3300021321 Bacteria 74244
112 Ga0214545_1000001 3300021324 Bacteria 1092817
113 Ga0214543_1000006 3300021327 Bacteria 443395
114 Ga0214543_1000024 3300021327 Bacteria 235745
115 Ga0214543_1001113 3300021327 Bacteria 50390
116 Ga0213875_10000047 3300021388 Bacteria 148835
117 Ga0228711_1000042 3300022739 Bacteria 85993
118 Ga0228710_1000046 3300022740 Bacteria 86044
119 Ga0209436_100019 3300025208 Bacteria 112688
120 Ga0209436_101086 3300025208 Bacteria 10201
121 Ga0209437_100104 3300025233 Bacteria 220736
122 Ga0207425_1000024 3300025245 Bacteria 328978
123 Ga0207425_1001626 3300025245 Bacteria 9066
124 Ga0209129_1000184 3300025258 Bacteria 87102
125 Ga0209129_1000728 3300025258 Bacteria 21187
126 Ga0209129_1002517 3300025258 Bacteria 8932
127 Ga0209233_1000054 3300025261 Bacteria 439669
128 Ga0209673_1014342 3300025273 Bacteria 3069
129 Ga0209130_1000021 3300025284 Bacteria 374278
130 Ga0209130_1000034 3300025284 Bacteria 302439
131 Ga0209130_1000066 3300025284 Bacteria 192626
132 Ga0209130_1008799 3300025284 Bacteria 2942
133 Ga0209676_1001628 3300025292 Bacteria 19854
134 Ga0209025_1000050 3300025294 Bacteria 331531
135 Ga0209025_1000074 3300025294 Bacteria 277445
136 Ga0209025_1000080 3300025294 Bacteria 267244
137 Ga0209025_1001057 3300025294 Bacteria 40170
138 Ga0209025_1001286 3300025294 Bacteria 34383
139 Ga0209025_1009765 3300025294 Bacteria 6623
140 Ga0209025_1010207 3300025294 Bacteria 6402
141 Ga0209564_1000013 3300025295 Bacteria 775755
142 Ga0209564_1001344 3300025295 Bacteria 26108
143 Ga0209758_1000083 3300025297 Bacteria 257283
144 Ga0209758_1000298 3300025297 Bacteria 97629
145 Ga0209758_1000359 3300025297 Bacteria 81559
146 Ga0209758_1002196 3300025297 Bacteria 20426
147 Ga0209758_1002846 3300025297 Bacteria 16799
148 Ga0209050_1000014 3300025298 Bacteria 774327
149 Ga0209050_1002744 3300025298 Bacteria 14187
150 Ga0209256_1000367 3300025299 Bacteria 72603
151 Ga0209256_1001026 3300025299 Bacteria 32796
152 Ga0209256_1004515 3300025299 Bacteria 8685
153 Ga0209256_1005042 3300025299 Bacteria 7871
154 Ga0207426_1000006 3300025302 Bacteria 1025969
155 Ga0207426_1000008 3300025302 Bacteria 848730
156 Ga0207426_1000010 3300025302 Bacteria 796003
157 Ga0207426_1002621 3300025302 Bacteria 11149
158 Ga0209051_1000575 3300025303 Bacteria 44169
159 Ga0209051_1004210 3300025303 Bacteria 8974
160 Ga0209257_1000019 3300025304 Bacteria 774261
161 Ga0209257_1003075 3300025304 Bacteria 15032
162 Ga0207647_10008212 3300025904 Bacteria 7501
163 Ga0207707_10043971 3300025912 Bacteria 3895
164 Ga0207707_10096833 3300025912 Bacteria 2578
165 Ga0207660_10005487 3300025917 Bacteria 8237
166 Ga0207660_10015895 3300025917 Bacteria 4975
167 Ga0207652_10043786 3300025921 Bacteria 3812
168 Ga0207665_10057570 3300025939 Bacteria 2626
169 Ga0207689_10018681 3300025942 Bacteria 5848
170 Ga0207667_10110278 3300025949 Bacteria 2839
171 Ga0207712_10002123 3300025961 Bacteria 12960
172 Ga0207712_10002767 3300025961 Bacteria 11214
173 Ga0207678_10001625 3300026067 Bacteria 20627
174 Ga0207678_10022357 3300026067 Bacteria 5540
175 Ga0207678_10056422 3300026067 Bacteria 3381
176 Ga0207708_10006489 3300026075 Bacteria 8666
177 Ga0207708_10034417 3300026075 Bacteria 3853
178 Ga0207676_10066144 3300026095 Bacteria 2881
179 Ga0207674_10022082 3300026116 Bacteria 6841
180 Ga0207674_10026736 3300026116 Bacteria 6121
181 Ga0209281_1000246 3300027111 Bacteria 107513
182 Ga0209281_1000620 3300027111 Bacteria 39852
183 Ga0209371_1000009 3300027312 Bacteria 963030
184 Ga0209282_1000062 3300027666 Bacteria 95390
185 Ga0209282_1016609 3300027666 Bacteria 4683
186 Ga0268266_10022020 3300028379 Bacteria 5433
187 Ga0268265_10000551 3300028380 Bacteria 38156
188 Ga0268265_10001728 3300028380 Bacteria 17646
189 Ga0268264_10011226 3300028381 Bacteria 7401
190 Ga0268256_1000010 3300030500 Bacteria 963034
191 Ga0316181_1090707 3300030744 Bacteria 2578
192 Ga0265340_10017886 3300031247 Bacteria 3666
193 Ga0265339_10003416 3300031249 Bacteria 11102
194 Ga0307412_10000790 3300031911 Bacteria 18230
195 Ga0315914_1000015 3300031967 Bacteria 128727
196 Ga0315913_1000021 3300033430 Bacteria 95385
197 Ga0315915_1000020 3300033464 Bacteria 128727
198 Ga0395899_0000030 3300037312 Bacteria 329063
199 Ga0395900_0000023 3300037418 Bacteria 336048
200 Ga0395900_0056005 3300037418 Bacteria 4059
201 Ga0395898_0000038 3300037466 Bacteria 329063
202 Ga0395905_0000021 3300037471 Bacteria 329054
203 Ga0436364_1128732 3300037853 Bacteria 4292
204 Ga0395901_0000018 3300038443 Bacteria 336048
205 Ga0436360_0194844 3300039438 Bacteria 4552
206 Ga0436361_1026313 3300039447 Bacteria 3560
207 Ga0439436_0020476 3300041404 Bacteria 1970
208 Ga0451576_0008596 3300045051 Bacteria 11963
209 Ga0495592_0013730 3300046454 Bacteria 6161
210 Ga0495651_0013305 3300046462 Bacteria 6364
211 Ga0495653_0100073 3300046463 Bacteria 2102
212 Ga0495585_0038650 3300046492 Bacteria 2685
213 Ga0495583_0003907 3300046506 Bacteria 11034
214 Ga0495632_0002130 3300046519 Bacteria 15407
215 Ga0495654_0003939 3300046530 Bacteria 8962
216 Ga0495597_0016358 3300046542 Bacteria 3502
217 Ga0495667_0005052 3300046559 Bacteria 8922
218 Ga0495668_0025525 3300046616 Bacteria 3357
219 Ga0495657_0011788 3300046675 Bacteria 6517
220 Ga0495599_0005809 3300046678 Bacteria 7409
221 Ga0495623_0001850 3300046679 Bacteria 14179
222 Ga0495613_0118356 3300046689 Bacteria 1904
223 Ga0495600_0000403 3300046809 Bacteria 22314
224 Ga0495604_0033751 3300047317 Bacteria 4050
225 Ga0495674_0067704 3300047319 Bacteria 3092
226 Ga0495680_0005382 3300047322 Bacteria 12066
227 Ga0495681_0004400 3300047470 Bacteria 9620
228 Ga0495602_0009085 3300048088 Bacteria 10348
229 Ga0496102_0002456 3300048905 Bacteria 15813
230 Ga0496102_0005213 3300048905 Bacteria 11035
231 Ga0496102_0005565 3300048905 Bacteria 10699
232 Ga0496103_0011349 3300048906 Bacteria 5276
233 Ga0496103_0011407 3300048906 Bacteria 5265
234 Ga0496103_0045650 3300048906 Bacteria 2703
235 Ga0496105_0008863 3300048908 Bacteria 7837
236 Ga0496106_0000115 3300048909 Bacteria 61349
237 Ga0496106_0004960 3300048909 Bacteria 9845
238 Ga0496106_0098734 3300048909 Bacteria 2263
239 Ga0496107_0002608 3300048910 Bacteria 11767
240 Ga0496109_0206616 3300048912 Bacteria 1846
241 Ga0496110_0046246 3300048913 Bacteria 3807
242 Ga0496111_0000859 3300048914 Bacteria 16467
243 Ga0496116_0000036 3300048919 Bacteria 388508
244 Ga0496116_0001253 3300048919 Bacteria 29488
245 Ga0496116_0003264 3300048919 Bacteria 16159
246 Ga0496116_0005563 3300048919 Bacteria 11622
247 Ga0496116_0016958 3300048919 Bacteria 5677
248 Ga0496116_0020883 3300048919 Bacteria 4956
249 Ga0496116_0023111 3300048919 Bacteria 4638
250 Ga0496116_0072316 3300048919 Bacteria 2180
251 Ga0496117_0000002 3300048920 Bacteria 2483758
252 Ga0496117_0001902 3300048920 Bacteria 28009
253 Ga0496117_0003834 3300048920 Bacteria 17102
254 Ga0496117_0004894 3300048920 Bacteria 14430
255 Ga0496117_0013953 3300048920 Bacteria 6961
256 Ga0496118_0000084 3300048921 Bacteria 181733
257 Ga0496118_0037537 3300048921 Bacteria 3897
258 Ga0496118_0040021 3300048921 Bacteria 3732
259 Ga0496118_0049598 3300048921 Bacteria 3231
260 Ga0496120_0000087 3300048923 Bacteria 152857
261 Ga0496120_0007817 3300048923 Bacteria 7890
262 Ga0496121_0000001 3300048924 Bacteria 1830318
263 Ga0496121_0041758 3300048924 Bacteria 4003
264 Ga0496121_0055289 3300048924 Bacteria 3308
265 Ga0496121_0061973 3300048924 Bacteria 3066
266 Ga0496121_0063335 3300048924 Bacteria 3022
267 Ga0496122_0000001 3300048925 Bacteria 1827766
268 Ga0496122_0000047 3300048925 Bacteria 274226
269 Ga0496122_0001509 3300048925 Bacteria 37119
270 Ga0496122_0004312 3300048925 Bacteria 17816
271 Ga0496122_0013093 3300048925 Bacteria 8164
272 Ga0496122_0015896 3300048925 Bacteria 7164
273 Ga0496122_0033054 3300048925 Bacteria 4262
274 Ga0496122_0039895 3300048925 Bacteria 3738
275 Ga0496122_0043762 3300048925 Bacteria 3503
276 Ga0496123_0000001 3300048926 Bacteria 1831497
277 Ga0496123_0000077 3300048926 Bacteria 192607
278 Ga0496123_0000950 3300048926 Bacteria 45086
279 Ga0496123_0002482 3300048926 Bacteria 22770
280 Ga0496123_0005090 3300048926 Bacteria 13427
281 Ga0496123_0031021 3300048926 Bacteria 3899
282 Ga0496123_0047314 3300048926 Bacteria 2908
283 Ga0496124_0001512 3300048927 Bacteria 33884
284 Ga0496124_0001806 3300048927 Bacteria 29682
285 Ga0496124_0002257 3300048927 Bacteria 25595
286 Ga0496124_0007793 3300048927 Bacteria 11310
287 Ga0496124_0015792 3300048927 Bacteria 7215
288 Ga0496124_0017462 3300048927 Bacteria 6761
289 Ga0496124_0064483 3300048927 Bacteria 3057
290 Ga0496124_0064830 3300048927 Bacteria 3048
291 Ga0496125_0000001 3300048928 Bacteria 1766138
292 Ga0496125_0001018 3300048928 Bacteria 43593
293 Ga0496125_0001877 3300048928 Bacteria 28869
294 Ga0496125_0003374 3300048928 Bacteria 19453
295 Ga0496125_0004867 3300048928 Bacteria 15242
296 Ga0496125_0066033 3300048928 Bacteria 2862
297 Ga0496126_0001111 3300048929 Bacteria 45099
298 Ga0496126_0006138 3300048929 Bacteria 13464
299 Ga0496126_0009586 3300048929 Bacteria 10269
300 Ga0496126_0033390 3300048929 Bacteria 4842
301 Ga0496126_0069562 3300048929 Bacteria 3139
302 Ga0501031_0000034 3300049568 Bacteria 75416
303 Ga0501031_0007232 3300049568 Bacteria 7244
304 Ga0501031_0009776 3300049568 Bacteria 6244
305 Ga0501032_0000006 3300049569 Bacteria 261727
306 Ga0501033_0000053 3300049570 Bacteria 109042
307 Ga0501033_0014699 3300049570 Bacteria 5941
308 Ga0501033_0035489 3300049570 Bacteria 3738
309 Ga0501034_0000030 3300049571 Bacteria 248180
310 Ga0501034_0001128 3300049571 Bacteria 37285
311 Ga0501034_0019677 3300049571 Bacteria 6902
312 Ga0501034_0021196 3300049571 Bacteria 6627
313 Ga0501034_0021642 3300049571 Bacteria 6549
314 Ga0501036_0000003 3300049572 Bacteria 261545
315 Ga0501036_0013008 3300049572 Bacteria 6910
316 Ga0501036_0029049 3300049572 Bacteria 4673
317 Ga0501037_0000003 3300049573 Bacteria 261548
318 Ga0501037_0011432 3300049573 Bacteria 6532
319 Ga0501037_0019572 3300049573 Bacteria 4994
320 Ga0501038_0000004 3300049574 Bacteria 261289
321 Ga0501038_0006146 3300049574 Bacteria 11117
322 Ga0501038_0036635 3300049574 Bacteria 4304
323 Ga0501038_0043325 3300049574 Bacteria 3913
324 Ga0501039_0000008 3300049575 Bacteria 274778
325 Ga0501039_0012414 3300049575 Bacteria 6504
326 Ga0501040_0001474 3300049576 Bacteria 14927
327 Ga0501043_0002232 3300049579 Bacteria 16500
328 Ga0501043_0007886 3300049579 Bacteria 8416
329 Ga0501043_0017564 3300049579 Bacteria 5609
330 Ga0501046_0011556 3300049580 Bacteria 7549
331 Ga0501047_0002997 3300049581 Bacteria 16024
332 Ga0501047_0017162 3300049581 Bacteria 6927
333 Ga0501047_0037718 3300049581 Bacteria 4673
334 Ga0501047_0099887 3300049581 Bacteria 2781
335 Ga0501070_0009380 3300049586 Bacteria 8274
336 Ga0501070_0019021 3300049586 Bacteria 5760
337 Ga0501070_0019149 3300049586 Bacteria 5742
338 Ga0501071_0049311 3300049587 Bacteria 3031
339 Ga0501074_0052406 3300049590 Bacteria 2945
340 Ga0501075_0010771 3300049591 Bacteria 6442
341 Ga0501080_0013103 3300049742 Bacteria 7616
342 Ga0501080_0030615 3300049742 Bacteria 5015
343 Ga0501080_0045314 3300049742 Bacteria 4094
344 Ga0501083_0009419 3300049744 Bacteria 6898
345 Ga0501035_0000031 3300049822 Bacteria 175591
346 Ga0501035_0005792 3300049822 Bacteria 11647
347 Ga0501035_0033428 3300049822 Bacteria 4677
348 Ga0501035_0044170 3300049822 Bacteria 4013
349 Ga0501044_0000008 3300049823 Bacteria 274778
350 Ga0501044_0012449 3300049823 Bacteria 9211
351 Ga0501044_0017596 3300049823 Bacteria 7666
352 Ga0501044_0073089 3300049823 Bacteria 3485
353 Ga0501044_0127957 3300049823 Bacteria 2536
354 Ga0501044_0171212 3300049823 Bacteria 2143
355 Ga0501045_0047945 3300049824 Bacteria 3113
356 nmdc:mga00v17_1042_c1 3300050491 Bacteria 14699
357 nmdc:mga00v17_52_c1 3300050491 Bacteria 72738
358 nmdc:mga00v17_84169_c1 3300050491 Bacteria 1990
359 nmdc:mga0yw44_19110_c1 3300050492 Bacteria 3771
360 nmdc:mga06z11_19283_c1 3300050494 Bacteria 3132
361 Ga0500635_0022501 3300053080 Bacteria 1955
362 Ga0500560_004145 3300053107 Bacteria 3041
363 Ga0500560_004674 3300053107 Bacteria 2942
364 Ga0500561_0000638 3300053137 Bacteria 5565
365 Ga0500568_0000203 3300053139 Bacteria 52356
366 Ga0500568_0000487 3300053139 Bacteria 29332
367 Ga0500624_000717 3300053157 Bacteria 8287
368 Ga0500634_0016218 3300053161 Bacteria 3972
369 Ga0500636_0000004 3300053177 Bacteria 202392
370 Ga0500636_0000173 3300053177 Bacteria 34092
371 Ga0500636_0001087 3300053177 Bacteria 14555
372 Ga0500609_003296 3300053731 Bacteria 2279
373 Ga0501082_0023119 3300060353 Bacteria 5361
374 Ga0530510_0139181 3300061734 Bacteria 1788
375 2509108302 2508501122 Bacteria 6292184
376 2509376568 2509276019 Bacteria 6802256
377 2510307760 2510065057 Bacteria 6649661
378 2510842204 2510461069 Bacteria 5505000
379 2511502339 2511231052 Bacteria 6974333
380 2512970580 2512875026 Bacteria 6861065
381 2513587236 2513237086 Bacteria 7265287
382 2513601642 2513237089 Bacteria 6553624
383 2513619253 2513237091 Bacteria 6900273
384 2513885556 2513237140 Bacteria 7076289
385 2513905972 2513237143 Bacteria 6664116
386 2513929214 2513237146 Bacteria 7166346
387 2513984205 2513237156 Bacteria 6402557
388 2514002915 2513237160 Bacteria 6650282
389 2514586992 2513237351 Bacteria 6968952
390 2515609126 2515154107 Bacteria 6795637
391 2516204220 2516143018 Bacteria 6951533
392 2516893719 2516653046 Bacteria 6989037
393 2517570449 2517487022 Bacteria 7227575
394 2524448446 2524023207 Bacteria 6813453
395 2537875572 2537561587 Bacteria 5425293
396 2551681137 2551306084 Bacteria 8942552
397 2551687573 2551306085 Bacteria 7347181
398 2551690196 2551306086 Bacteria 6843938
399 2551698696 2551306087 Bacteria 7351905
400 2551736702 2551306092 Bacteria 6992595
401 2551742518 2551306093 Bacteria 7064773
402 2554246971 2554235003 Bacteria 5877155
403 2558864363 2558860100 Bacteria 8458965
404 2559294197 2558860242 Bacteria 5568029
405 2585164471 2582581283 Bacteria 6030556
406 2585229916 2582581299 Bacteria 6518058
407 2585334849 2582581316 Bacteria 7774528
408 2585394772 2582581866 Bacteria 6859583
409 2585846806 2585427594 Bacteria 6180594
410 2599415557 2599185170 Bacteria 7295545
411 2599603469 2599185210 Bacteria 5624189
412 2599718703 2599185236 Bacteria 6875203
413 2601608820 2600255279 Bacteria 5605316
414 2601745594 2600255308 Bacteria 5611129
415 2616552846 2615840698 Bacteria 7319877
416 2617372559 2617270741 Bacteria 8201522
417 2643773983 2643221550 Bacteria 4619371
418 2643802961 2643221557 Bacteria 7184309
419 2643856013 2643221568 Bacteria 5187270
420 2643909729 2643221580 Bacteria 3816678
421 2643918568 2643221582 Bacteria 5804683
422 2643949983 2643221588 Bacteria 3692460
423 2644051571 2643221607 Bacteria 6314006
424 2644063324 2643221610 Bacteria 7480339
425 2644107157 2643221618 Bacteria 7717186
426 2644121627 2643221621 Bacteria 6212786
427 2644131222 2643221623 Bacteria 5239945
428 2644150722 2643221626 Bacteria 8069654
429 2644192698 2643221634 Bacteria 6705461
430 2644200069 2643221636 Bacteria 6583769
431 2644207221 2643221637 Bacteria 5345260
432 2644308553 2643221655 Bacteria 7722067
433 2644335369 2643221659 Bacteria 7890716
434 2644374606 2643221668 Bacteria 7306521
435 2644413584 2643221674 Bacteria 3919126
436 2644414087 2643221675 Bacteria 7473456
437 2644447615 2643221680 Bacteria 7473610
438 2644480440 2643221686 Bacteria 6310811
439 2644498830 2643221689 Bacteria 6042950
440 2644518887 2643221693 Bacteria 5513853
441 2644539774 2643221698 Bacteria 7756764
442 2644614493 2643221712 Bacteria 7729434
443 2644650869 2643221718 Bacteria 5345506
444 2644675957 2643221723 Bacteria 7095460
445 2644690088 2643221726 Bacteria 7455827
446 2657681623 2657244999 Bacteria 5946535
447 2692315464 2690316117 Bacteria 6800650
448 2738804231 2738541293 Bacteria 7065685
449 2739310687 2738543024 Bacteria 5603683
450 2753462098 2751185821 Bacteria 6189929
451 2776916107 2775507049 Bacteria 6284736
452 2778174473 2775507266 Bacteria 7392367
453 2792585055 2791355082 Bacteria 5973319
454 2792620696 2791355091 Bacteria 6135441
455 2792626056 2791355092 Bacteria 6248105
456 2792638997 2791355094 Bacteria 7011481
457 2802716934 2802428858 Bacteria 6636079
458 2802725683 2802428859 Bacteria 6667919
459 2802730228 2802428860 Bacteria 6525526
460 2802737801 2802428861 Bacteria 6534206
461 2802742745 2802428862 Bacteria 6633353
462 2802750233 2802428863 Bacteria 6410669
463 2804752812 2802429268 Bacteria 6094027
464 2808986027 2808606387 Bacteria 5697198
465 2819556148 2818991439 Bacteria 6907412
466 2838035675 2838035591 Bacteria 7166484
467 2838076766 2838074704 Bacteria 6785777
468 2838665268 2838661181 Bacteria 7385261
469 2838676876 2838675328 Bacteria 4909118
470 2838715761 2838714209 Bacteria 5525906
471 2838720438 2838719591 Bacteria 5523910
472 2838726516 2838724970 Bacteria 4908691
473 2841847369 2841846520 Bacteria 5345850
474 2841860094 2841859092 Bacteria 5436171
475 2842126601 2842124991 Bacteria 5346824
476 2842131769 2842130223 Bacteria 4909145
477 2842153062 2842152218 Bacteria 4908957
478 2842172005 2842170452 Bacteria 5525737
479 2842176681 2842175837 Bacteria 4908771
480 2842188870 2842187318 Bacteria 5524014
481 2842213182 2842211629 Bacteria 5523832
482 2842225200 2842224351 Bacteria 5524473
483 2842485354 2842482326 Bacteria 7212537
484 2842516879 2842515876 Bacteria 5436280
485 2844164702 2844163670 Bacteria 7266046
486 2847419476 2847417321 Bacteria 6913799
487 2848994505 2848992105 Bacteria 6810864
488 2850081567 2850079185 Bacteria 6848280
489 2854916526 2854911287 Bacteria 5582813
490 2855826443 2855825444 Bacteria 6785811
491 2855841834 2855839649 Bacteria 7135830
492 2855872448 2855872281 Bacteria 6964271
493 2858804473 2858800743 Bacteria 6603254
494 2874170071 2874168670 Bacteria 8062617
495 2876369027 2876363079 Bacteria 6544991
496 2885366531 2885366525 Bacteria 8326213
497 2889037469 2889033259 Bacteria 9099371
498 2889795655 2889790730 Bacteria 5689708
499 2891373461 2891373044 Bacteria 5202277
500 2896392294 2896384573 Bacteria 7700774
501 2898798226 2898795034 Bacteria 4294459
502 2899792160 2899792073 Bacteria 4926588
503 2899846263 2899845264 Bacteria 5672268
504 2903449118 2903448605 Bacteria 7357801
505 2913299233 2913295892 Bacteria 6333755
506 2915983050 2915980308 Bacteria 6624279
507 2915992134 2915986958 Bacteria 6739310
508 2915997866 2915993759 Bacteria 7016183
509 2916006215 2916000859 Bacteria 6865702
510 2916013704 2916007675 Bacteria 6898660
511 2916018431 2916014648 Bacteria 6946486
512 2916023384 2916021584 Bacteria 6854472
513 2916033868 2916028427 Bacteria 6748433
514 2916039145 2916035215 Bacteria 6755766
515 2916047332 2916041962 Bacteria 6820487
516 2916053233 2916048683 Bacteria 6543552
517 2916060267 2916055098 Bacteria 6758838
518 2916064371 2916061851 Bacteria 6737736
519 2916070395 2916068649 Bacteria 6943657
520 2916082894 2916076590 Bacteria 6596108
521 2919115964 2919114240 Bacteria 5700270
522 2919167221 2919166419 Bacteria 4952238
523 2920761426 2920760137 Bacteria 7427611
524 2921208221 2921201388 Bacteria 6926299
525 2921213075 2921208531 Bacteria 6745326
526 2921241674 2921237296 Bacteria 6876710
527 2921246113 2921244191 Bacteria 6568419
528 2921253897 2921250672 Bacteria 6677771
529 2921262585 2921257292 Bacteria 6808382
530 2921269382 2921263974 Bacteria 6864552
531 2921288898 2921282425 Bacteria 6826397
532 2921300105 2921296804 Bacteria 7176999
533 2924147238 2924144063 Bacteria 6883928
534 2924157426 2924150972 Bacteria 7169444
535 2924161099 2924158325 Bacteria 7188855
536 2924171876 2924165586 Bacteria 7260590
537 2924178507 2924172951 Bacteria 6749356
538 2924185235 2924179722 Bacteria 6843264
539 2924192567 2924186466 Bacteria 6876637
540 2924196128 2924193448 Bacteria 6955718
541 2924207004 2924200457 Bacteria 6757188
542 2924207963 2924207177 Bacteria 6917007
543 2924221534 2924214083 Bacteria 7080103
544 2924221952 2924221636 Bacteria 7113495
545 2924231619 2924228884 Bacteria 6633132
546 2926756917 2926754445 Bacteria 5964435
547 2926761141 2926760298 Bacteria 5505990
548 2929139309 2929138655 Bacteria 5810547
549 2933007705 2933006813 Bacteria 4912075
550 2933012479 2933011516 Bacteria 5439334
551 2933594919 2933594066 Bacteria 5594265
552 2936998325 2936996657 Bacteria 6298727
553 2937005621 2937002841 Bacteria 6934057
554 2937011824 2937009748 Bacteria 6746052
555 2937021961 2937016420 Bacteria 6782579
556 2937027799 2937023124 Bacteria 6815156
557 2937031034 2937029754 Bacteria 6424026
558 2937037096 2937036028 Bacteria 6846469
559 2937044342 2937042894 Bacteria 6741576
560 2937053730 2937049772 Bacteria 6757901
561 2937057853 2937056579 Bacteria 7107896
562 2937069988 2937063883 Bacteria 7199456
563 2937076026 2937071275 Bacteria 6984483
564 2937081646 2937078374 Bacteria 6610289
565 2937085322 2937084907 Bacteria 6618516
566 2937094498 2937091812 Bacteria 6979387
567 2937101954 2937098957 Bacteria 7249374
568 2937112033 2937106411 Bacteria 6947143
569 2937118094 2937113482 Bacteria 6505872
570 2937122632 2937119839 Bacteria 6597547
571 2937129712 2937126314 Bacteria 6771275
572 2941502009 2941499720 Bacteria 7599444
573 2957378447 2957375807 Bacteria 6425588
574 2957388443 2957382221 Bacteria 6737050
575 2957393139 2957388812 Bacteria 6778072
576 2957400857 2957395598 Bacteria 6822399
577 2957408478 2957402308 Bacteria 6741770
578 2957414519 2957408893 Bacteria 6558585
579 2957415765 2957415311 Bacteria 6991633
580 2957428872 2957422303 Bacteria 7172205
581 2957432439 2957430029 Bacteria 7022557
582 2957438121 2957437181 Bacteria 6568994
583 2957449744 2957443900 Bacteria 6869977
584 2957454396 2957450854 Bacteria 6765715
585 2957462509 2957457609 Bacteria 6967680
586 2957468943 2957464669 Bacteria 6568877
587 2957475994 2957471148 Bacteria 6797643
588 2957483111 2957478035 Bacteria 6756658
589 2957488933 2957484790 Bacteria 6703082
590 2957497739 2957491536 Bacteria 6695180
591 2957504082 2957498199 Bacteria 7126688
592 2957512362 2957505466 Bacteria 7253085
593 2960585239 2960584000 Bacteria 6864594
594 2960594173 2960591022 Bacteria 6622873
595 2960603712 2960597568 Bacteria 6550735
596 2960607424 2960603979 Bacteria 6898737
597 2960615223 2960610863 Bacteria 6691244
598 2960620318 2960617483 Bacteria 6727748
599 2960624571 2960624210 Bacteria 6875384
600 2960633703 2960631154 Bacteria 6732508
601 2960644389 2960637947 Bacteria 7296468
602 2960652041 2960645483 Bacteria 7211087
603 2960659610 2960652885 Bacteria 7083688
604 2960666277 2960660292 Bacteria 7041660
605 2960671070 2960667422 Bacteria 6763020
606 2960678438 2960674078 Bacteria 6609048
607 2960680963 2960680706 Bacteria 6624464
608 2960693073 2960687367 Bacteria 6535474
609 2960700100 2960693952 Bacteria 6749742
610 2964609450 2964607997 Bacteria 7101408
611 2964621838 2964615318 Bacteria 6809089
612 2964626020 2964621998 Bacteria 6834995
613 2964631262 2964628898 Bacteria 7083044
614 2964642739 2964636051 Bacteria 7091832
615 2964643892 2964643177 Bacteria 6820887
616 2964652554 2964649959 Bacteria 6675118
617 2964661063 2964656573 Bacteria 7100150
618 2964665335 2964663802 Bacteria 7019362
619 2964673274 2964670856 Bacteria 6851364
620 2964678527 2964678106 Bacteria 6792020
621 2964687187 2964685014 Bacteria 6839111
622 2964694300 2964691889 Bacteria 6802758
623 2964699437 2964698721 Bacteria 6765331
624 2964707721 2964705432 Bacteria 7114648
625 2964713804 2964712639 Bacteria 6695970
626 2964723862 2964719344 Bacteria 7286602
627 2967669071 2967664464 Bacteria 6948836
628 2967674892 2967671571 Bacteria 7021409
629 2967682026 2967678726 Bacteria 7264382
630 2967692946 2967686174 Bacteria 6678622
631 2967695704 2967693043 Bacteria 6804451
632 2967704876 2967699805 Bacteria 6854538
633 2967714151 2967706974 Bacteria 7186053
634 2967716904 2967714385 Bacteria 7000047
635 2967725547 2967721400 Bacteria 7073753
636 2967730107 2967728569 Bacteria 6641507
637 2967735880 2967735183 Bacteria 6827012
638 2967747930 2967742019 Bacteria 6794534
639 2967752288 2967748971 Bacteria 6733771
640 2967760721 2967755722 Bacteria 6814706
641 2967767961 2967762386 Bacteria 6923502
642 2967775052 2967769361 Bacteria 6587838
643 2967778673 2967775926 Bacteria 6738189
644 2968086063 2968083720 Bacteria 7351627
645 2970024154 2970019648 Bacteria 7072033
646 2970031750 2970026789 Bacteria 6785236
647 2970039870 2970033650 Bacteria 7118744
648 2970046320 2970040964 Bacteria 6731123
649 2970053096 2970047711 Bacteria 7088379
650 2970060283 2970054988 Bacteria 6611507
651 2970063219 2970061556 Bacteria 7099761
652 2970070751 2970068827 Bacteria 7123112
653 2970078711 2970076120 Bacteria 6697332
654 2970086805 2970082768 Bacteria 6183754
655 2970091035 2970088815 Bacteria 6933825
656 2970098894 2970095765 Bacteria 6936963
657 2970107260 2970102677 Bacteria 6812532
658 2970115476 2970109326 Bacteria 6863976
659 2970119323 2970116247 Bacteria 6501857
660 2970124837 2970122695 Bacteria 6625855
661 2970132169 2970129317 Bacteria 6806560
662 2970137079 2970136068 Bacteria 7207982
663 2970145203 2970143518 Bacteria 6446480
664 2970152281 2970149975 Bacteria 6779706
665 2970164114 2970156795 Bacteria 7168044
666 2970164533 2970164137 Bacteria 6861252
667 2970172734 2970170962 Bacteria 6876229
668 2970184161 2970177841 Bacteria 6768001
669 2970188909 2970184632 Bacteria 7054431
670 2970198010 2970191845 Bacteria 7032787
671 2977522839 2977516862 Bacteria 6940108
672 2977524864 2977523885 Bacteria 6960446
673 2977531525 2977530762 Bacteria 6951399
674 2977540742 2977537788 Bacteria 6929320
675 2977551211 2977544691 Bacteria 6875412
676 2977555763 2977551784 Bacteria 7125765
677 2977560328 2977558990 Bacteria 6863948
678 2977566574 2977565890 Bacteria 6901543
679 2977575646 2977572785 Bacteria 6763888
680 2977582300 2977579622 Bacteria 6772100
681 2978973647 2978969890 Bacteria 5400756
682 2979093575 2979089926 Bacteria 5670289
683 2979099037 2979095461 Bacteria 5669583
684 2979105555 2979100975 Bacteria 5423623
685 2984512597 2984509177 Bacteria 5274802
686 2984521043 2984518228 Bacteria 5277463
687 2984540337 2984537506 Bacteria 5277481
688 2984591921 2984587000 Bacteria 5263363
689 2984602533 2984601300 Bacteria 5455244
690 2989349913 2989349275 Bacteria 6349068
691 3003934318 3003930520 Bacteria 5667563
692 3005448070 3005445848 Bacteria 6906074
693 637078645 637000159 Bacteria 7596297
694 643826381 643692032 Bacteria 6891900
695 648738070 648276728 Bacteria 6968865
696 650739389 650716007 Bacteria 5573770
697 8002290392 8002285264 Bacteria 6717907
698 8003015809 8003014200 Bacteria 4059994
699 8003570429 8003570095 Bacteria 5747666
700 8003994267 8003992118 Bacteria 7266902
701 8004001915 8003999396 Bacteria 7063185
702 8049295397 8049293176 Bacteria 6128433
703 8054461739 8054460903 Bacteria 4872905
704 8054564642 8054563764 Bacteria 5592885
705 8056685616 8056681323 Bacteria 8472857
706 Ga0209282_1000222
707 JGI25162J39368_1000617
708 JGI25158J39367_1000251
709 JGI25152J39213_1000727
710 JGI25152J39213_1002986
711 JGI25152J39213_1005989
712 JGI25150J39212_1000160
713 JGI25159J45721_1000073
714 JGI25151J46595_10000083
715 JGI25151J46595_10021626
716 JGI25151J46595_10029039
717 JGI25406J46586_10002920
718 JGI25165J46597_1000416
719 JGI25153J46596_10000377
720 JGI25153J46596_10001690
721 rootH1_10145948
722 rootH1_10245112
723 JGI25160J50197_1000020
724 JGI25160J50197_1000087
725 JGI25160J50197_1012767
726 JGI25161J50226_1000066
727 JGI25161J50226_1000170
728 JGI25161J50226_1000856
729 Ga0006562J51391_1024319
730 Ga0055526_1002182
731 Ga0055526_1002581
732 Ga0055524_1005926
733 Ga0055536_1000618
734 Ga0055530_10001081
735 Ga0055530_10002197
736 Ga0055540_1011849
737 Ga0055531_10000338
738 Ga0055531_10004558
739 Ga0055543_1000068
740 Ga0055543_1000163
741 Ga0055543_1000342
742 Ga0065165_1000013
743 Ga0065165_1000839
744 Ga0065165_1003220
745 Ga0065165_1008693
746 Ga0065165_1012858
747 Ga0070680_100010201
748 Ga0070680_100017091
749 Ga0070691_10029764
750 Ga0070709_10032591
751 Ga0070701_10011473
752 Ga0070705_100000771
753 Ga0070705_100004354
754 Ga0070700_100001946
755 Ga0070694_100000473
756 Ga0070694_100001936
757 Ga0070708_100094484
758 Ga0070663_100002012
759 Ga0070663_100043414
760 Ga0070663_100128437
761 Ga0070681_10117168
762 Ga0070698_100046693
763 Ga0070699_100004529
764 Ga0070699_100007119
765 Ga0070679_100046589
766 Ga0070697_100006390
767 Ga0070697_100007929
768 Ga0070695_100000316
769 Ga0070695_100001732
770 Ga0070696_100000295
771 Ga0070696_100002462
772 Ga0070665_100015391
773 Ga0070704_100000136
774 Ga0070704_100005198
775 Ga0068857_100018215
776 Ga0068857_100093549
777 Ga0068859_100016079
778 Ga0068860_100018500
779 Ga0068862_100000584
780 Ga0068862_100003537
781 Ga0081455_10005789
782 Ga0081455_10021295
783 Ga0081455_10039598
784 Ga0081538_10046156
785 Ga0081538_10072829
786 Ga0081540_1000433
787 Ga0081540_1000747
788 Ga0081540_1004020
789 Ga0081539_10000501
790 Ga0070717_10132317
791 Ga0075365_10097095
792 Ga0075364_10000091
793 Ga0075364_10001796
794 Ga0075367_10029046
795 Ga0075369_10007129
796 Ga0075366_10013926
797 Ga0097620_100016079
798 Ga0079104_1005814
799 Ga0079104_1007489
800 Ga0099826_10000030
801 Ga0099826_10018729
802 Ga0105251_10014590
803 Ga0105249_10000560
804 Ga0105249_10012793
805 Ga0105249_10129164
806 Ga0157373_10014167
807 Ga0157373_10096508
808 Ga0157371_10000307
809 Ga0157371_10006146
810 Ga0157369_10011799
811 Ga0171463_1003
812 Ga0183363_1055
813 Ga0214544_1000004
814 Ga0214544_1000010
815 Ga0214542_1000012
816 Ga0214542_1000442
817 Ga0214545_1000001
818 Ga0214543_1000006
819 Ga0214543_1000024
820 Ga0214543_1001113
821 Ga0213875_10000047
822 Ga0228711_1000042
823 Ga0228710_1000046
824 Ga0209436_100019
825 Ga0209436_101086
826 Ga0209437_100104
827 Ga0207425_1000024
828 Ga0207425_1001626
829 Ga0209129_1000184
830 Ga0209129_1000728
831 Ga0209129_1002517
832 Ga0209233_1000054
833 Ga0209673_1014342
834 Ga0209130_1000021
835 Ga0209130_1000034
836 Ga0209130_1000066
837 Ga0209130_1008799
838 Ga0209676_1001628
839 Ga0209025_1000050
840 Ga0209025_1000074
841 Ga0209025_1000080
842 Ga0209025_1001057
843 Ga0209025_1001286
844 Ga0209025_1009765
845 Ga0209025_1010207
846 Ga0209564_1000013
847 Ga0209564_1001344
848 Ga0209758_1000083
849 Ga0209758_1000298
850 Ga0209758_1000359
851 Ga0209758_1002196
852 Ga0209758_1002846
853 Ga0209050_1000014
854 Ga0209050_1002744
855 Ga0209256_1000367
856 Ga0209256_1001026
857 Ga0209256_1004515
858 Ga0209256_1005042
859 Ga0207426_1000006
860 Ga0207426_1000008
861 Ga0207426_1000010
862 Ga0207426_1002621
863 Ga0209051_1000575
864 Ga0209051_1004210
865 Ga0209257_1000019
866 Ga0209257_1003075
867 Ga0207647_10008212
868 Ga0207707_10043971
869 Ga0207707_10096833
870 Ga0207660_10005487
871 Ga0207660_10015895
872 Ga0207652_10043786
873 Ga0207665_10057570
874 Ga0207689_10018681
875 Ga0207667_10110278
876 Ga0207712_10002123
877 Ga0207712_10002767
878 Ga0207678_10001625
879 Ga0207678_10022357
880 Ga0207678_10056422
881 Ga0207708_10006489
882 Ga0207708_10034417
883 Ga0207676_10066144
884 Ga0207674_10022082
885 Ga0207674_10026736
886 Ga0209281_1000246
887 Ga0209281_1000620
888 Ga0209371_1000009
889 Ga0209282_1000062
890 Ga0209282_1016609
891 Ga0268266_10022020
892 Ga0268265_10000551
893 Ga0268265_10001728
894 Ga0268264_10011226
895 Ga0268256_1000010
896 Ga0316181_1090707
897 Ga0265340_10017886
898 Ga0265339_10003416
899 Ga0307412_10000790
900 Ga0315914_1000015
901 Ga0315913_1000021
902 Ga0315915_1000020
903 Ga0395899_0000030
904 Ga0395900_0000023
905 Ga0395900_0056005
906 Ga0395898_0000038
907 Ga0395905_0000021
908 Ga0436364_1128732
909 Ga0395901_0000018
910 Ga0436360_0194844
911 Ga0436361_1026313
912 Ga0439436_0020476
913 Ga0451576_0008596
914 Ga0495592_0013730
915 Ga0495651_0013305
916 Ga0495653_0100073
917 Ga0495585_0038650
918 Ga0495583_0003907
919 Ga0495632_0002130
920 Ga0495654_0003939
921 Ga0495597_0016358
922 Ga0495667_0005052
923 Ga0495668_0025525
924 Ga0495657_0011788
925 Ga0495599_0005809
926 Ga0495623_0001850
927 Ga0495613_0118356
928 Ga0495600_0000403
929 Ga0495604_0033751
930 Ga0495674_0067704
931 Ga0495680_0005382
932 Ga0495681_0004400
933 Ga0495602_0009085
934 Ga0496102_0002456
935 Ga0496102_0005213
936 Ga0496102_0005565
937 Ga0496103_0011349
938 Ga0496103_0011407
939 Ga0496103_0045650
940 Ga0496105_0008863
941 Ga0496106_0000115
942 Ga0496106_0004960
943 Ga0496106_0098734
944 Ga0496107_0002608
945 Ga0496109_0206616
946 Ga0496110_0046246
947 Ga0496111_0000859
948 Ga0496116_0000036
949 Ga0496116_0001253
950 Ga0496116_0003264
951 Ga0496116_0005563
952 Ga0496116_0016958
953 Ga0496116_0020883
954 Ga0496116_0023111
955 Ga0496116_0072316
956 Ga0496117_0000002
957 Ga0496117_0001902
958 Ga0496117_0003834
959 Ga0496117_0004894
960 Ga0496117_0013953
961 Ga0496118_0000084
962 Ga0496118_0037537
963 Ga0496118_0040021
964 Ga0496118_0049598
965 Ga0496120_0000087
966 Ga0496120_0007817
967 Ga0496121_0000001
968 Ga0496121_0041758
969 Ga0496121_0055289
970 Ga0496121_0061973
971 Ga0496121_0063335
972 Ga0496122_0000001
973 Ga0496122_0000047
974 Ga0496122_0001509
975 Ga0496122_0004312
976 Ga0496122_0013093
977 Ga0496122_0015896
978 Ga0496122_0033054
979 Ga0496122_0039895
980 Ga0496122_0043762
981 Ga0496123_0000001
982 Ga0496123_0000077
983 Ga0496123_0000950
984 Ga0496123_0002482
985 Ga0496123_0005090
986 Ga0496123_0031021
987 Ga0496123_0047314
988 Ga0496124_0001512
989 Ga0496124_0001806
990 Ga0496124_0002257
991 Ga0496124_0007793
992 Ga0496124_0015792
993 Ga0496124_0017462
994 Ga0496124_0064483
995 Ga0496124_0064830
996 Ga0496125_0000001
997 Ga0496125_0001018
998 Ga0496125_0001877
999 Ga0496125_0003374
1000 Ga0496125_0004867
1001 Ga0496125_0066033
1002 Ga0496126_0001111
1003 Ga0496126_0006138
1004 Ga0496126_0009586
1005 Ga0496126_0033390
1006 Ga0496126_0069562
1007 Ga0501031_0000034
1008 Ga0501031_0007232
1009 Ga0501031_0009776
1010 Ga0501032_0000006
1011 Ga0501033_0000053
1012 Ga0501033_0014699
1013 Ga0501033_0035489
1014 Ga0501034_0000030
1015 Ga0501034_0001128
1016 Ga0501034_0019677
1017 Ga0501034_0021196
1018 Ga0501034_0021642
1019 Ga0501036_0000003
1020 Ga0501036_0013008
1021 Ga0501036_0029049
1022 Ga0501037_0000003
1023 Ga0501037_0011432
1024 Ga0501037_0019572
1025 Ga0501038_0000004
1026 Ga0501038_0006146
1027 Ga0501038_0036635
1028 Ga0501038_0043325
1029 Ga0501039_0000008
1030 Ga0501039_0012414
1031 Ga0501040_0001474
1032 Ga0501043_0002232
1033 Ga0501043_0007886
1034 Ga0501043_0017564
1035 Ga0501046_0011556
1036 Ga0501047_0002997
1037 Ga0501047_0017162
1038 Ga0501047_0037718
1039 Ga0501047_0099887
1040 Ga0501070_0009380
1041 Ga0501070_0019021
1042 Ga0501070_0019149
1043 Ga0501071_0049311
1044 Ga0501074_0052406
1045 Ga0501075_0010771
1046 Ga0501080_0013103
1047 Ga0501080_0030615
1048 Ga0501080_0045314
1049 Ga0501083_0009419
1050 Ga0501035_0000031
1051 Ga0501035_0005792
1052 Ga0501035_0033428
1053 Ga0501035_0044170
1054 Ga0501044_0000008
1055 Ga0501044_0012449
1056 Ga0501044_0017596
1057 Ga0501044_0073089
1058 Ga0501044_0127957
1059 Ga0501044_0171212
1060 Ga0501045_0047945
1061 nmdc:mga00v17_1042_c1
1062 nmdc:mga00v17_52_c1
1063 nmdc:mga00v17_84169_c1
1064 nmdc:mga0yw44_19110_c1
1065 nmdc:mga06z11_19283_c1
1066 Ga0500635_0022501
1067 Ga0500560_004145
1068 Ga0500560_004674
1069 Ga0500561_0000638
1070 Ga0500568_0000203
1071 Ga0500568_0000487
1072 Ga0500624_000717
1073 Ga0500634_0016218
1074 Ga0500636_0000004
1075 Ga0500636_0000173
1076 Ga0500636_0001087
1077 Ga0500609_003296
1078 Ga0501082_0023119
1079 Ga0530510_0139181
1080 2509108302
1081 2509376568
1082 2510307760
1083 2510842204
1084 2511502339
1085 2512970580
1086 2513587236
1087 2513601642
1088 2513619253
1089 2513885556
1090 2513905972
1091 2513929214
1092 2513984205
1093 2514002915
1094 2514586992
1095 2515609126
1096 2516204220
1097 2516893719
1098 2517570449
1099 2524448446
1100 2537875572
1101 2551681137
1102 2551687573
1103 2551690196
1104 2551698696
1105 2551736702
1106 2551742518
1107 2554246971
1108 2558864363
1109 2559294197
1110 2585164471
1111 2585229916
1112 2585334849
1113 2585394772
1114 2585846806
1115 2599415557
1116 2599603469
1117 2599718703
1118 2601608820
1119 2601745594
1120 2616552846
1121 2617372559
1122 2643773983
1123 2643802961
1124 2643856013
1125 2643909729
1126 2643918568
1127 2643949983
1128 2644051571
1129 2644063324
1130 2644107157
1131 2644121627
1132 2644131222
1133 2644150722
1134 2644192698
1135 2644200069
1136 2644207221
1137 2644308553
1138 2644335369
1139 2644374606
1140 2644413584
1141 2644414087
1142 2644447615
1143 2644480440
1144 2644498830
1145 2644518887
1146 2644539774
1147 2644614493
1148 2644650869
1149 2644675957
1150 2644690088
1151 2657681623
1152 2692315464
1153 2738804231
1154 2739310687
1155 2753462098
1156 2776916107
1157 2778174473
1158 2792585055
1159 2792620696
1160 2792626056
1161 2792638997
1162 2802716934
1163 2802725683
1164 2802730228
1165 2802737801
1166 2802742745
1167 2802750233
1168 2804752812
1169 2808986027
1170 2819556148
1171 2838035675
1172 2838076766
1173 2838665268
1174 2838676876
1175 2838715761
1176 2838720438
1177 2838726516
1178 2841847369
1179 2841860094
1180 2842126601
1181 2842131769
1182 2842153062
1183 2842172005
1184 2842176681
1185 2842188870
1186 2842213182
1187 2842225200
1188 2842485354
1189 2842516879
1190 2844164702
1191 2847419476
1192 2848994505
1193 2850081567
1194 2854916526
1195 2855826443
1196 2855841834
1197 2855872448
1198 2858804473
1199 2874170071
1200 2876369027
1201 2885366531
1202 2889037469
1203 2889795655
1204 2891373461
1205 2896392294
1206 2898798226
1207 2899792160
1208 2899846263
1209 2903449118
1210 2913299233
1211 2915983050
1212 2915992134
1213 2915997866
1214 2916006215
1215 2916013704
1216 2916018431
1217 2916023384
1218 2916033868
1219 2916039145
1220 2916047332
1221 2916053233
1222 2916060267
1223 2916064371
1224 2916070395
1225 2916082894
1226 2919115964
1227 2919167221
1228 2920761426
1229 2921208221
1230 2921213075
1231 2921241674
1232 2921246113
1233 2921253897
1234 2921262585
1235 2921269382
1236 2921288898
1237 2921300105
1238 2924147238
1239 2924157426
1240 2924161099
1241 2924171876
1242 2924178507
1243 2924185235
1244 2924192567
1245 2924196128
1246 2924207004
1247 2924207963
1248 2924221534
1249 2924221952
1250 2924231619
1251 2926756917
1252 2926761141
1253 2929139309
1254 2933007705
1255 2933012479
1256 2933594919
1257 2936998325
1258 2937005621
1259 2937011824
1260 2937021961
1261 2937027799
1262 2937031034
1263 2937037096
1264 2937044342
1265 2937053730
1266 2937057853
1267 2937069988
1268 2937076026
1269 2937081646
1270 2937085322
1271 2937094498
1272 2937101954
1273 2937112033
1274 2937118094
1275 2937122632
1276 2937129712
1277 2941502009
1278 2957378447
1279 2957388443
1280 2957393139
1281 2957400857
1282 2957408478
1283 2957414519
1284 2957415765
1285 2957428872
1286 2957432439
1287 2957438121
1288 2957449744
1289 2957454396
1290 2957462509
1291 2957468943
1292 2957475994
1293 2957483111
1294 2957488933
1295 2957497739
1296 2957504082
1297 2957512362
1298 2960585239
1299 2960594173
1300 2960603712
1301 2960607424
1302 2960615223
1303 2960620318
1304 2960624571
1305 2960633703
1306 2960644389
1307 2960652041
1308 2960659610
1309 2960666277
1310 2960671070
1311 2960678438
1312 2960680963
1313 2960693073
1314 2960700100
1315 2964609450
1316 2964621838
1317 2964626020
1318 2964631262
1319 2964642739
1320 2964643892
1321 2964652554
1322 2964661063
1323 2964665335
1324 2964673274
1325 2964678527
1326 2964687187
1327 2964694300
1328 2964699437
1329 2964707721
1330 2964713804
1331 2964723862
1332 2967669071
1333 2967674892
1334 2967682026
1335 2967692946
1336 2967695704
1337 2967704876
1338 2967714151
1339 2967716904
1340 2967725547
1341 2967730107
1342 2967735880
1343 2967747930
1344 2967752288
1345 2967760721
1346 2967767961
1347 2967775052
1348 2967778673
1349 2968086063
1350 2970024154
1351 2970031750
1352 2970039870
1353 2970046320
1354 2970053096
1355 2970060283
1356 2970063219
1357 2970070751
1358 2970078711
1359 2970086805
1360 2970091035
1361 2970098894
1362 2970107260
1363 2970115476
1364 2970119323
1365 2970124837
1366 2970132169
1367 2970137079
1368 2970145203
1369 2970152281
1370 2970164114
1371 2970164533
1372 2970172734
1373 2970184161
1374 2970188909
1375 2970198010
1376 2977522839
1377 2977524864
1378 2977531525
1379 2977540742
1380 2977551211
1381 2977555763
1382 2977560328
1383 2977566574
1384 2977575646
1385 2977582300
1386 2978973647
1387 2979093575
1388 2979099037
1389 2979105555
1390 2984512597
1391 2984521043
1392 2984540337
1393 2984591921
1394 2984602533
1395 2989349913
1396 3003934318
1397 3005448070
1398 637078645
1399 643826381
1400 648738070
1401 650739389
1402 8002290392
1403 8003015809
1404 8003570429
1405 8003994267
1406 8004001915
1407 8049295397
1408 8054461739
1409 8054564642
1410 8056685616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15420

Abhydrolase_9_N

Alpha/beta-hydrolase family N-terminus

100

307

1

PF10081

Abhydrolase_9

Alpha/beta-hydrolase family

324

611

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v41-assembly2.cif.gz_B crystal structure of mtb pks13 thioesterase domain in complex with inhibitor tam5 0.6523 282 393
7crn-assembly2.cif.gz_B-2 the functional characterization and crystal structure of the bifunctional thioesterase catalyzing epimerization and cyclization 0.6224 284 393
7r0x-assembly1.cif.gz_A structure of the branching thioesterase from oocydin biosynthesis 0.6113 281 397
3ed1-assembly8.cif.gz_A crystal structure of rice gid1 complexed with ga3 0.5929 281 397
2cb9-assembly1.cif.gz_A crystal structure of the thioesterase domain of the fengycin biosynthesis cluster 0.5919 282 393
ID Description Score Start End Superfamily
af_O53417_287_574_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.933 252 537 3.40.50.1820
af_O53417_287_574_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9236 252 537 3.40.50.1820
af_O53417_63_270_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8154 29 234 1.10.287.1490
af_O53417_63_270_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8048 29 234 1.10.287.1490
af_Q4D3Y4_276_531_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7166 333 397 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Z1BKW4-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9868 215 527
AF-W7Q1M1-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9825 284 545
AF-A0A520ZUR0-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9801 253 542
AF-A0A2G1CCI0-F1-model_v4 deleted 0.9778 231 544
AF-A0A4Z1BKW4-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9775 215 527

Map