F476486
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 706 | 361 | 706 | 91 |
Family's Representative Sequence
| Representative Sequence | 3300035724|Ga0373933_0215219|Ga0373933_0215219_490_837 |
| Length | 109 |
| Sequence | MRAETRRAGRGDLAVTYIITEPCIDVMDKSVDCIHESGRMLVIDPEECIDCGACEPECPVEAIFPEDALPDKWNAFVEINYAYDKGAAVVDELTQKYAVENNVQNEPIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 96 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 97 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 217 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 221 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 222 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 223 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 224 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 225 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 226 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 229 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 230 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 333 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 334 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 336 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 342 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.87 |
| Metatranscriptomes | 1.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 9.92 |
| Rhizosphere | 89.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10159499 | 3300001990 | Bacteria | 666 |
| 2 | JGI24742J22300_10087163 | 3300002244 | Bacteria | 595 |
| 3 | JGI24751J29686_10043076 | 3300002459 | Bacteria | 933 |
| 4 | JGI25407J50210_10009553 | 3300003373 | Bacteria | 2459 |
| 5 | JGI25407J50210_10105274 | 3300003373 | Bacteria | 697 |
| 6 | Ga0058859_11656751 | 3300004798 | Bacteria | 550 |
| 7 | Ga0070676_10149709 | 3300005328 | Bacteria | 1493 |
| 8 | Ga0070683_100278649 | 3300005329 | Bacteria | 1591 |
| 9 | Ga0070683_100484079 | 3300005329 | Bacteria | 1182 |
| 10 | Ga0070683_100498378 | 3300005329 | Bacteria | 1163 |
| 11 | Ga0070683_100524440 | 3300005329 | Bacteria | 1132 |
| 12 | Ga0070690_100015506 | 3300005330 | Bacteria | 4548 |
| 13 | Ga0070670_100036039 | 3300005331 | Bacteria | 4258 |
| 14 | Ga0070680_100808603 | 3300005336 | Bacteria | 808 |
| 15 | Ga0070680_101197889 | 3300005336 | Bacteria | 657 |
| 16 | Ga0070680_101364601 | 3300005336 | Bacteria | 614 |
| 17 | Ga0070682_100033554 | 3300005337 | Bacteria | 3120 |
| 18 | Ga0070682_100090423 | 3300005337 | Bacteria | 2002 |
| 19 | Ga0070689_100011400 | 3300005340 | Bacteria | 6367 |
| 20 | Ga0070689_100275630 | 3300005340 | Bacteria | 1394 |
| 21 | Ga0070691_10048903 | 3300005341 | Bacteria | 2014 |
| 22 | Ga0070687_100004900 | 3300005343 | Bacteria | 5372 |
| 23 | Ga0070661_100454121 | 3300005344 | Bacteria | 1020 |
| 24 | Ga0070692_10099297 | 3300005345 | Bacteria | 1594 |
| 25 | Ga0070692_10169102 | 3300005345 | Bacteria | 1259 |
| 26 | Ga0070668_100734602 | 3300005347 | Bacteria | 873 |
| 27 | Ga0070668_100900717 | 3300005347 | Bacteria | 791 |
| 28 | Ga0070669_100776964 | 3300005353 | Bacteria | 813 |
| 29 | Ga0070675_100137721 | 3300005354 | Bacteria | 2084 |
| 30 | Ga0070675_100413889 | 3300005354 | Bacteria | 1204 |
| 31 | Ga0070671_100320123 | 3300005355 | Bacteria | 1321 |
| 32 | Ga0070671_100565092 | 3300005355 | Bacteria | 981 |
| 33 | Ga0070671_101763731 | 3300005355 | Bacteria | 550 |
| 34 | Ga0070674_100208719 | 3300005356 | Bacteria | 1512 |
| 35 | Ga0070674_100672841 | 3300005356 | Bacteria | 882 |
| 36 | Ga0070673_100074774 | 3300005364 | Bacteria | 2731 |
| 37 | Ga0070673_102137321 | 3300005364 | Bacteria | 532 |
| 38 | Ga0070688_100003816 | 3300005365 | Bacteria | 7812 |
| 39 | Ga0070688_100276444 | 3300005365 | Bacteria | 1205 |
| 40 | Ga0070659_100006869 | 3300005366 | Bacteria | 8244 |
| 41 | Ga0070659_100579322 | 3300005366 | Bacteria | 963 |
| 42 | Ga0070659_100940073 | 3300005366 | Bacteria | 757 |
| 43 | Ga0070667_100481136 | 3300005367 | Bacteria | 1137 |
| 44 | Ga0070711_100263708 | 3300005439 | Bacteria | 1356 |
| 45 | Ga0070705_100063523 | 3300005440 | Bacteria | 2202 |
| 46 | Ga0070705_100145123 | 3300005440 | Bacteria | 1567 |
| 47 | Ga0070705_100225276 | 3300005440 | Bacteria | 1301 |
| 48 | Ga0070700_100006192 | 3300005441 | Bacteria | 6378 |
| 49 | Ga0070700_100206715 | 3300005441 | Bacteria | 1383 |
| 50 | Ga0070700_100311560 | 3300005441 | Bacteria | 1153 |
| 51 | Ga0070700_100549446 | 3300005441 | Bacteria | 897 |
| 52 | Ga0070694_100221425 | 3300005444 | Bacteria | 1419 |
| 53 | Ga0070694_100238167 | 3300005444 | Bacteria | 1372 |
| 54 | Ga0070694_100995817 | 3300005444 | Bacteria | 696 |
| 55 | Ga0070708_100490447 | 3300005445 | Bacteria | 1159 |
| 56 | Ga0070708_100873164 | 3300005445 | Bacteria | 845 |
| 57 | Ga0070663_100134303 | 3300005455 | Bacteria | 1882 |
| 58 | Ga0070678_100281709 | 3300005456 | Bacteria | 1406 |
| 59 | Ga0070662_100040018 | 3300005457 | Bacteria | 3336 |
| 60 | Ga0070681_10290798 | 3300005458 | Bacteria | 1544 |
| 61 | Ga0070681_10744552 | 3300005458 | Bacteria | 896 |
| 62 | Ga0068867_100018210 | 3300005459 | Bacteria | 4991 |
| 63 | Ga0068867_100500027 | 3300005459 | Bacteria | 1045 |
| 64 | Ga0068867_100781882 | 3300005459 | Bacteria | 850 |
| 65 | Ga0070685_10113869 | 3300005466 | Bacteria | 1671 |
| 66 | Ga0070706_100514454 | 3300005467 | Bacteria | 1113 |
| 67 | Ga0070707_102209755 | 3300005468 | Bacteria | 518 |
| 68 | Ga0070698_100022281 | 3300005471 | Bacteria | 6628 |
| 69 | Ga0070698_100082668 | 3300005471 | Bacteria | 3203 |
| 70 | Ga0070698_101420579 | 3300005471 | Bacteria | 645 |
| 71 | Ga0070699_100050352 | 3300005518 | Bacteria | 3606 |
| 72 | Ga0070699_100288580 | 3300005518 | Bacteria | 1471 |
| 73 | Ga0070699_100617848 | 3300005518 | Bacteria | 989 |
| 74 | Ga0070679_100357296 | 3300005530 | Bacteria | 1408 |
| 75 | Ga0070684_100027971 | 3300005535 | Bacteria | 4765 |
| 76 | Ga0070684_100138019 | 3300005535 | Bacteria | 2203 |
| 77 | Ga0070684_100220013 | 3300005535 | Bacteria | 1732 |
| 78 | Ga0070684_100344804 | 3300005535 | Bacteria | 1369 |
| 79 | Ga0070697_100077363 | 3300005536 | Bacteria | 2736 |
| 80 | Ga0070697_100234608 | 3300005536 | Bacteria | 1565 |
| 81 | Ga0070697_100849142 | 3300005536 | Bacteria | 809 |
| 82 | Ga0070697_101504292 | 3300005536 | Bacteria | 602 |
| 83 | Ga0068853_100639430 | 3300005539 | Bacteria | 1012 |
| 84 | Ga0070672_100098764 | 3300005543 | Bacteria | 2365 |
| 85 | Ga0070672_100524934 | 3300005543 | Bacteria | 1026 |
| 86 | Ga0070686_100004377 | 3300005544 | Bacteria | 7784 |
| 87 | Ga0070686_100284456 | 3300005544 | Bacteria | 1221 |
| 88 | Ga0070696_100006955 | 3300005546 | Bacteria | 7553 |
| 89 | Ga0070696_100071548 | 3300005546 | Bacteria | 2441 |
| 90 | Ga0070696_101011041 | 3300005546 | Bacteria | 695 |
| 91 | Ga0070693_100134308 | 3300005547 | Bacteria | 1550 |
| 92 | Ga0070693_101277033 | 3300005547 | Bacteria | 567 |
| 93 | Ga0070665_101450863 | 3300005548 | Bacteria | 695 |
| 94 | Ga0070664_100030578 | 3300005564 | Bacteria | 4493 |
| 95 | Ga0070664_100420174 | 3300005564 | Bacteria | 1224 |
| 96 | Ga0070664_100546479 | 3300005564 | Bacteria | 1071 |
| 97 | Ga0070664_100921101 | 3300005564 | Bacteria | 820 |
| 98 | Ga0068857_100027184 | 3300005577 | Bacteria | 5046 |
| 99 | Ga0068857_100030217 | 3300005577 | Bacteria | 4782 |
| 100 | Ga0068857_102158617 | 3300005577 | Bacteria | 547 |
| 101 | Ga0068857_102331831 | 3300005577 | Bacteria | 525 |
| 102 | Ga0068854_100103070 | 3300005578 | Bacteria | 2142 |
| 103 | Ga0068854_100754145 | 3300005578 | Bacteria | 845 |
| 104 | Ga0068856_100126000 | 3300005614 | Bacteria | 2564 |
| 105 | Ga0070702_100007071 | 3300005615 | Bacteria | 5354 |
| 106 | Ga0068852_100022059 | 3300005616 | Bacteria | 5097 |
| 107 | Ga0068852_100774253 | 3300005616 | Bacteria | 973 |
| 108 | Ga0068859_100137104 | 3300005617 | Bacteria | 2520 |
| 109 | Ga0068859_102765314 | 3300005617 | Bacteria | 539 |
| 110 | Ga0068864_100086000 | 3300005618 | Bacteria | 2765 |
| 111 | Ga0068864_100675894 | 3300005618 | Bacteria | 1007 |
| 112 | Ga0068864_102365372 | 3300005618 | Bacteria | 538 |
| 113 | Ga0068866_10098729 | 3300005718 | Bacteria | 1607 |
| 114 | Ga0068861_101046552 | 3300005719 | Bacteria | 782 |
| 115 | Ga0068861_102040050 | 3300005719 | Bacteria | 573 |
| 116 | Ga0068870_10003863 | 3300005840 | Bacteria | 6388 |
| 117 | Ga0068870_10208673 | 3300005840 | Bacteria | 1188 |
| 118 | Ga0068863_100723886 | 3300005841 | Bacteria | 990 |
| 119 | Ga0068858_100055220 | 3300005842 | Bacteria | 3671 |
| 120 | Ga0068858_100631815 | 3300005842 | Bacteria | 1040 |
| 121 | Ga0068860_100004060 | 3300005843 | Bacteria | 15025 |
| 122 | Ga0068860_102363218 | 3300005843 | Bacteria | 552 |
| 123 | Ga0068862_100186136 | 3300005844 | Bacteria | 1866 |
| 124 | Ga0081455_10004505 | 3300005937 | Bacteria | 15573 |
| 125 | Ga0081455_10007154 | 3300005937 | Bacteria | 11808 |
| 126 | Ga0081455_10091640 | 3300005937 | Bacteria | 2461 |
| 127 | Ga0081538_10000240 | 3300005981 | Bacteria | 62124 |
| 128 | Ga0081538_10002585 | 3300005981 | Bacteria | 17561 |
| 129 | Ga0081538_10036113 | 3300005981 | Bacteria | 3231 |
| 130 | Ga0081540_1093167 | 3300005983 | Bacteria | 1320 |
| 131 | Ga0070717_10887563 | 3300006028 | Bacteria | 812 |
| 132 | Ga0075365_10928082 | 3300006038 | Bacteria | 614 |
| 133 | Ga0075432_10326724 | 3300006058 | Bacteria | 644 |
| 134 | Ga0070716_100557134 | 3300006173 | Bacteria | 855 |
| 135 | Ga0070712_100070694 | 3300006175 | Bacteria | 2495 |
| 136 | Ga0070712_100363249 | 3300006175 | Bacteria | 1188 |
| 137 | Ga0070712_100434365 | 3300006175 | Bacteria | 1090 |
| 138 | Ga0075367_10511627 | 3300006178 | Bacteria | 762 |
| 139 | Ga0097621_100087269 | 3300006237 | Bacteria | 2605 |
| 140 | Ga0097621_101137549 | 3300006237 | Bacteria | 734 |
| 141 | Ga0075428_100204411 | 3300006844 | Bacteria | 2135 |
| 142 | Ga0075428_100469260 | 3300006844 | Bacteria | 1347 |
| 143 | Ga0075428_101623726 | 3300006844 | Bacteria | 676 |
| 144 | Ga0075428_101680577 | 3300006844 | Bacteria | 663 |
| 145 | Ga0075428_102000985 | 3300006844 | Bacteria | 600 |
| 146 | Ga0075431_100065436 | 3300006847 | Bacteria | 3754 |
| 147 | Ga0075433_10253621 | 3300006852 | Bacteria | 1561 |
| 148 | Ga0075433_10398127 | 3300006852 | Bacteria | 1215 |
| 149 | Ga0075433_10626417 | 3300006852 | Bacteria | 944 |
| 150 | Ga0075433_10739040 | 3300006852 | Bacteria | 861 |
| 151 | Ga0075434_100103255 | 3300006871 | Bacteria | 2859 |
| 152 | Ga0068865_100110705 | 3300006881 | Bacteria | 2026 |
| 153 | Ga0068865_100390119 | 3300006881 | Bacteria | 1138 |
| 154 | Ga0068865_101364949 | 3300006881 | Bacteria | 632 |
| 155 | Ga0097620_100137097 | 3300006931 | Bacteria | 2520 |
| 156 | Ga0097620_102765048 | 3300006931 | Bacteria | 539 |
| 157 | Ga0075435_100552860 | 3300007076 | Bacteria | 997 |
| 158 | Ga0111539_10002272 | 3300009094 | Bacteria | 25576 |
| 159 | Ga0111539_10040587 | 3300009094 | Bacteria | 5601 |
| 160 | Ga0111539_10451625 | 3300009094 | Bacteria | 1497 |
| 161 | Ga0111539_10994997 | 3300009094 | Bacteria | 975 |
| 162 | Ga0111539_12125552 | 3300009094 | Bacteria | 651 |
| 163 | Ga0111539_12929904 | 3300009094 | Bacteria | 552 |
| 164 | Ga0105245_10046707 | 3300009098 | Bacteria | 3869 |
| 165 | Ga0105245_10187661 | 3300009098 | Bacteria | 1979 |
| 166 | Ga0105245_10256949 | 3300009098 | Bacteria | 1699 |
| 167 | Ga0105245_10912698 | 3300009098 | Bacteria | 920 |
| 168 | Ga0105247_10050427 | 3300009101 | Bacteria | 2561 |
| 169 | Ga0114129_10019250 | 3300009147 | Bacteria | 9724 |
| 170 | Ga0114129_10083439 | 3300009147 | Bacteria | 4439 |
| 171 | Ga0114129_10742920 | 3300009147 | Bacteria | 1257 |
| 172 | Ga0114129_10979982 | 3300009147 | Bacteria | 1066 |
| 173 | Ga0114129_11858363 | 3300009147 | Bacteria | 731 |
| 174 | Ga0114129_12816128 | 3300009147 | Bacteria | 578 |
| 175 | Ga0105243_10015460 | 3300009148 | Bacteria | 5767 |
| 176 | Ga0105243_10438802 | 3300009148 | Bacteria | 1222 |
| 177 | Ga0105243_10508009 | 3300009148 | Bacteria | 1143 |
| 178 | Ga0105243_11626979 | 3300009148 | Bacteria | 673 |
| 179 | Ga0105241_10094162 | 3300009174 | Bacteria | 2368 |
| 180 | Ga0105242_10047340 | 3300009176 | Bacteria | 3491 |
| 181 | Ga0105248_10051124 | 3300009177 | Bacteria | 4638 |
| 182 | Ga0105248_11247964 | 3300009177 | Bacteria | 840 |
| 183 | Ga0105248_12061870 | 3300009177 | Bacteria | 648 |
| 184 | Ga0105237_11970621 | 3300009545 | Bacteria | 592 |
| 185 | Ga0105238_10712162 | 3300009551 | Bacteria | 1016 |
| 186 | Ga0105238_12674923 | 3300009551 | Bacteria | 535 |
| 187 | Ga0105249_10006756 | 3300009553 | Bacteria | 9996 |
| 188 | Ga0105249_10129149 | 3300009553 | Bacteria | 2411 |
| 189 | Ga0105249_10910758 | 3300009553 | Bacteria | 946 |
| 190 | Ga0105249_10991108 | 3300009553 | Bacteria | 909 |
| 191 | Ga0105239_10128806 | 3300010375 | Bacteria | 2813 |
| 192 | Ga0105239_13137395 | 3300010375 | Bacteria | 538 |
| 193 | Ga0105246_10344307 | 3300011119 | Bacteria | 1219 |
| 194 | Ga0105246_10599021 | 3300011119 | Bacteria | 952 |
| 195 | Ga0105246_10758086 | 3300011119 | Bacteria | 857 |
| 196 | Ga0157344_1025678 | 3300012476 | Bacteria | 536 |
| 197 | Ga0157337_1000969 | 3300012483 | Bacteria | 1390 |
| 198 | Ga0157315_1026828 | 3300012508 | Bacteria | 649 |
| 199 | Ga0157373_11253780 | 3300013100 | Bacteria | 560 |
| 200 | Ga0157373_11278433 | 3300013100 | Bacteria | 555 |
| 201 | Ga0157370_11296431 | 3300013104 | Bacteria | 656 |
| 202 | Ga0157370_12028227 | 3300013104 | Bacteria | 516 |
| 203 | Ga0157369_10035964 | 3300013105 | Bacteria | 5428 |
| 204 | Ga0157369_10583990 | 3300013105 | Bacteria | 1154 |
| 205 | Ga0157374_10529927 | 3300013296 | Bacteria | 1184 |
| 206 | Ga0157374_11084149 | 3300013296 | Bacteria | 821 |
| 207 | Ga0157378_10003446 | 3300013297 | Bacteria | 14024 |
| 208 | Ga0163162_10137854 | 3300013306 | Bacteria | 2551 |
| 209 | Ga0157372_11000944 | 3300013307 | Bacteria | 968 |
| 210 | Ga0157372_11303705 | 3300013307 | Bacteria | 838 |
| 211 | Ga0157372_11910317 | 3300013307 | Bacteria | 682 |
| 212 | Ga0157375_10013278 | 3300013308 | Bacteria | 7325 |
| 213 | Ga0157375_11516010 | 3300013308 | Bacteria | 791 |
| 214 | Ga0163163_10008650 | 3300014325 | Bacteria | 9054 |
| 215 | Ga0163163_10786814 | 3300014325 | Bacteria | 1015 |
| 216 | Ga0157380_10033356 | 3300014326 | Bacteria | 3964 |
| 217 | Ga0182008_10298628 | 3300014497 | Bacteria | 842 |
| 218 | Ga0157377_10007842 | 3300014745 | Bacteria | 5176 |
| 219 | Ga0157377_10219495 | 3300014745 | Bacteria | 1216 |
| 220 | Ga0157379_10084518 | 3300014968 | Bacteria | 2844 |
| 221 | Ga0157379_10973229 | 3300014968 | Bacteria | 808 |
| 222 | Ga0157376_10278680 | 3300014969 | Bacteria | 1574 |
| 223 | Ga0157376_10391186 | 3300014969 | Bacteria | 1342 |
| 224 | Ga0157376_10519221 | 3300014969 | Bacteria | 1174 |
| 225 | Ga0182006_1053905 | 3300015261 | Bacteria | 1540 |
| 226 | Ga0182006_1242283 | 3300015261 | Bacteria | 592 |
| 227 | Ga0163161_10064380 | 3300017792 | Bacteria | 2674 |
| 228 | Ga0206353_11559060 | 3300020082 | Bacteria | 2001 |
| 229 | Ga0213873_10007348 | 3300021358 | Bacteria | 2203 |
| 230 | Ga0213871_10002315 | 3300021441 | Bacteria | 3483 |
| 231 | Ga0207653_10028703 | 3300025885 | Bacteria | 1790 |
| 232 | Ga0207642_10032257 | 3300025899 | Bacteria | 2203 |
| 233 | Ga0207710_10118324 | 3300025900 | Bacteria | 1263 |
| 234 | Ga0207688_10126286 | 3300025901 | Bacteria | 1496 |
| 235 | Ga0207643_10001789 | 3300025908 | Bacteria | 11965 |
| 236 | Ga0207643_10688886 | 3300025908 | Bacteria | 660 |
| 237 | Ga0207705_10612733 | 3300025909 | Bacteria | 847 |
| 238 | Ga0207684_11147625 | 3300025910 | Bacteria | 645 |
| 239 | Ga0207707_10835692 | 3300025912 | Bacteria | 765 |
| 240 | Ga0207660_11030656 | 3300025917 | Bacteria | 671 |
| 241 | Ga0207660_11317392 | 3300025917 | Bacteria | 586 |
| 242 | Ga0207662_10000237 | 3300025918 | Bacteria | 25500 |
| 243 | Ga0207649_10087818 | 3300025920 | Bacteria | 2029 |
| 244 | Ga0207681_10642878 | 3300025923 | Bacteria | 879 |
| 245 | Ga0207681_10904150 | 3300025923 | Bacteria | 739 |
| 246 | Ga0207650_10356623 | 3300025925 | Bacteria | 1204 |
| 247 | Ga0207659_10010535 | 3300025926 | Bacteria | 5812 |
| 248 | Ga0207687_10027593 | 3300025927 | Bacteria | 3811 |
| 249 | Ga0207687_10751710 | 3300025927 | Bacteria | 830 |
| 250 | Ga0207700_10037748 | 3300025928 | Bacteria | 3501 |
| 251 | Ga0207700_10103004 | 3300025928 | Bacteria | 2281 |
| 252 | Ga0207664_10527829 | 3300025929 | Bacteria | 1058 |
| 253 | Ga0207644_10309324 | 3300025931 | Bacteria | 1275 |
| 254 | Ga0207644_10529163 | 3300025931 | Bacteria | 974 |
| 255 | Ga0207690_10466257 | 3300025932 | Bacteria | 1017 |
| 256 | Ga0207690_10517329 | 3300025932 | Bacteria | 967 |
| 257 | Ga0207706_10032167 | 3300025933 | Bacteria | 4671 |
| 258 | Ga0207686_10783383 | 3300025934 | Bacteria | 763 |
| 259 | Ga0207709_10027266 | 3300025935 | Bacteria | 3289 |
| 260 | Ga0207709_10865606 | 3300025935 | Bacteria | 733 |
| 261 | Ga0207670_10250582 | 3300025936 | Bacteria | 1368 |
| 262 | Ga0207670_10325848 | 3300025936 | Bacteria | 1210 |
| 263 | Ga0207670_10867188 | 3300025936 | Bacteria | 755 |
| 264 | Ga0207669_10171024 | 3300025937 | Bacteria | 1546 |
| 265 | Ga0207704_10456914 | 3300025938 | Bacteria | 1020 |
| 266 | Ga0207704_11669478 | 3300025938 | Bacteria | 548 |
| 267 | Ga0207665_10453012 | 3300025939 | Bacteria | 985 |
| 268 | Ga0207691_10012785 | 3300025940 | Bacteria | 8035 |
| 269 | Ga0207711_10226028 | 3300025941 | Bacteria | 1713 |
| 270 | Ga0207689_10512985 | 3300025942 | Bacteria | 1005 |
| 271 | Ga0207689_10792094 | 3300025942 | Bacteria | 800 |
| 272 | Ga0207661_10191482 | 3300025944 | Bacteria | 1793 |
| 273 | Ga0207661_10451894 | 3300025944 | Bacteria | 1170 |
| 274 | Ga0207661_12111172 | 3300025944 | Bacteria | 509 |
| 275 | Ga0207679_10364574 | 3300025945 | Bacteria | 1263 |
| 276 | Ga0207679_11277072 | 3300025945 | Bacteria | 674 |
| 277 | Ga0207667_10769222 | 3300025949 | Bacteria | 961 |
| 278 | Ga0207651_10127559 | 3300025960 | Bacteria | 1941 |
| 279 | Ga0207651_10599117 | 3300025960 | Bacteria | 963 |
| 280 | Ga0207712_10068519 | 3300025961 | Bacteria | 2543 |
| 281 | Ga0207712_10625568 | 3300025961 | Bacteria | 933 |
| 282 | Ga0207712_11051097 | 3300025961 | Bacteria | 724 |
| 283 | Ga0207668_10230153 | 3300025972 | Bacteria | 1494 |
| 284 | Ga0207640_10146008 | 3300025981 | Bacteria | 1731 |
| 285 | Ga0207640_10931003 | 3300025981 | Bacteria | 761 |
| 286 | Ga0207640_10963821 | 3300025981 | Bacteria | 748 |
| 287 | Ga0207658_10429120 | 3300025986 | Bacteria | 1167 |
| 288 | Ga0207703_10088091 | 3300026035 | Bacteria | 2604 |
| 289 | Ga0207703_10487315 | 3300026035 | Bacteria | 1156 |
| 290 | Ga0207703_11950554 | 3300026035 | Bacteria | 563 |
| 291 | Ga0207639_10092058 | 3300026041 | Bacteria | 2429 |
| 292 | Ga0207639_12263996 | 3300026041 | Bacteria | 505 |
| 293 | Ga0207678_10015566 | 3300026067 | Bacteria | 6688 |
| 294 | Ga0207708_10007304 | 3300026075 | Bacteria | 8171 |
| 295 | Ga0207708_10244044 | 3300026075 | Bacteria | 1445 |
| 296 | Ga0207708_10256758 | 3300026075 | Bacteria | 1410 |
| 297 | Ga0207702_10058200 | 3300026078 | Bacteria | 3288 |
| 298 | Ga0207641_10707988 | 3300026088 | Bacteria | 992 |
| 299 | Ga0207641_11650941 | 3300026088 | Bacteria | 643 |
| 300 | Ga0207648_10001684 | 3300026089 | Bacteria | 24233 |
| 301 | Ga0207648_10562546 | 3300026089 | Bacteria | 1048 |
| 302 | Ga0207648_11053909 | 3300026089 | Bacteria | 762 |
| 303 | Ga0207676_10854240 | 3300026095 | Bacteria | 890 |
| 304 | Ga0207674_10027111 | 3300026116 | Bacteria | 6069 |
| 305 | Ga0207674_10032996 | 3300026116 | Bacteria | 5425 |
| 306 | Ga0207675_100067548 | 3300026118 | Bacteria | 3342 |
| 307 | Ga0207675_100376852 | 3300026118 | Bacteria | 1395 |
| 308 | Ga0207675_100457238 | 3300026118 | Bacteria | 1266 |
| 309 | Ga0207683_10052641 | 3300026121 | Bacteria | 3567 |
| 310 | Ga0207698_10063639 | 3300026142 | Bacteria | 2888 |
| 311 | Ga0209999_1059138 | 3300027543 | Bacteria | 728 |
| 312 | Ga0210002_1106016 | 3300027617 | Bacteria | 510 |
| 313 | Ga0209971_1119350 | 3300027682 | Bacteria | 648 |
| 314 | Ga0209974_10037398 | 3300027876 | Bacteria | 1612 |
| 315 | Ga0207428_10006328 | 3300027907 | Bacteria | 10947 |
| 316 | Ga0207428_10218425 | 3300027907 | Bacteria | 1430 |
| 317 | Ga0207428_10396899 | 3300027907 | Bacteria | 1010 |
| 318 | Ga0268266_10256326 | 3300028379 | Bacteria | 1620 |
| 319 | Ga0268265_10196532 | 3300028380 | Bacteria | 1746 |
| 320 | Ga0268264_10068651 | 3300028381 | Bacteria | 2996 |
| 321 | Ga0268264_12304378 | 3300028381 | Bacteria | 545 |
| 322 | Ga0265338_10945442 | 3300028800 | Bacteria | 585 |
| 323 | Ga0265325_10359618 | 3300031241 | Bacteria | 642 |
| 324 | Ga0265327_10015346 | 3300031251 | Bacteria | 4949 |
| 325 | Ga0265316_10646096 | 3300031344 | Bacteria | 748 |
| 326 | Ga0307408_100060910 | 3300031548 | Bacteria | 2753 |
| 327 | Ga0307408_100085518 | 3300031548 | Bacteria | 2368 |
| 328 | Ga0307408_100117131 | 3300031548 | Bacteria | 2057 |
| 329 | Ga0307405_10109650 | 3300031731 | Bacteria | 1867 |
| 330 | Ga0307405_10143618 | 3300031731 | Bacteria | 1668 |
| 331 | Ga0307413_10019744 | 3300031824 | Bacteria | 3568 |
| 332 | Ga0307410_10004596 | 3300031852 | Bacteria | 7164 |
| 333 | Ga0307406_10030841 | 3300031901 | Bacteria | 3259 |
| 334 | Ga0307406_10404829 | 3300031901 | Bacteria | 1083 |
| 335 | Ga0307407_10001098 | 3300031903 | Bacteria | 9443 |
| 336 | Ga0307407_11469542 | 3300031903 | Bacteria | 538 |
| 337 | Ga0307412_10065059 | 3300031911 | Bacteria | 2466 |
| 338 | Ga0307412_10180365 | 3300031911 | Bacteria | 1588 |
| 339 | Ga0307412_11448172 | 3300031911 | Bacteria | 623 |
| 340 | Ga0307409_100013896 | 3300031995 | Bacteria | 5207 |
| 341 | Ga0307416_100000904 | 3300032002 | Bacteria | 15682 |
| 342 | Ga0307416_100041773 | 3300032002 | Bacteria | 3574 |
| 343 | Ga0307416_100206885 | 3300032002 | Bacteria | 1867 |
| 344 | Ga0307416_101027658 | 3300032002 | Bacteria | 928 |
| 345 | Ga0307416_101678467 | 3300032002 | Bacteria | 740 |
| 346 | Ga0307414_10039191 | 3300032004 | Bacteria | 3190 |
| 347 | Ga0307411_10246349 | 3300032005 | Bacteria | 1402 |
| 348 | Ga0307415_100004099 | 3300032126 | Bacteria | 7520 |
| 349 | Ga0307415_100103427 | 3300032126 | Bacteria | 2095 |
| 350 | Ga0373950_0164137 | 3300034818 | Bacteria | 515 |
| 351 | Ga0373934_0100557 | 3300035086 | Bacteria | 1169 |
| 352 | Ga0373952_0051874 | 3300035092 | Bacteria | 980 |
| 353 | Ga0373941_0192595 | 3300035115 | Bacteria | 771 |
| 354 | Ga0373953_0070354 | 3300035117 | Bacteria | 1443 |
| 355 | Ga0373954_0040886 | 3300035118 | Bacteria | 2161 |
| 356 | Ga0373960_0424203 | 3300035121 | Bacteria | 517 |
| 357 | Ga0373946_0413211 | 3300035171 | Bacteria | 683 |
| 358 | Ga0373955_0474584 | 3300035172 | Bacteria | 763 |
| 359 | Ga0373942_0079965 | 3300035207 | Bacteria | 969 |
| 360 | Ga0373961_0427376 | 3300035241 | Bacteria | 513 |
| 361 | Ga0373962_0245608 | 3300035242 | Bacteria | 620 |
| 362 | Ga0373924_0111660 | 3300035410 | Bacteria | 1182 |
| 363 | Ga0373931_0125146 | 3300035691 | Bacteria | 1473 |
| 364 | Ga0373935_0055212 | 3300035692 | Bacteria | 2531 |
| 365 | Ga0373933_0215219 | 3300035724 | Bacteria | 1232 |
| 366 | Ga0373937_0162707 | 3300036401 | Bacteria | 2092 |
| 367 | Ga0395899_0002898 | 3300037312 | Bacteria | 13785 |
| 368 | Ga0395899_0041850 | 3300037312 | Bacteria | 3421 |
| 369 | Ga0395899_0124192 | 3300037312 | Bacteria | 1846 |
| 370 | Ga0395899_0299025 | 3300037312 | Bacteria | 1090 |
| 371 | Ga0395899_0509680 | 3300037312 | Bacteria | 779 |
| 372 | Ga0395900_0038387 | 3300037418 | Bacteria | 4935 |
| 373 | Ga0395900_0080879 | 3300037418 | Bacteria | 3339 |
| 374 | Ga0395900_0082293 | 3300037418 | Bacteria | 3307 |
| 375 | Ga0395900_0125629 | 3300037418 | Bacteria | 2631 |
| 376 | Ga0395900_0126057 | 3300037418 | Bacteria | 2626 |
| 377 | Ga0395900_0651759 | 3300037418 | Bacteria | 989 |
| 378 | Ga0395900_0995387 | 3300037418 | Bacteria | 758 |
| 379 | Ga0395900_1266213 | 3300037418 | Bacteria | 652 |
| 380 | Ga0395898_0007360 | 3300037466 | Bacteria | 11686 |
| 381 | Ga0395898_0020580 | 3300037466 | Bacteria | 6701 |
| 382 | Ga0395898_0031910 | 3300037466 | Bacteria | 5260 |
| 383 | Ga0395898_0142255 | 3300037466 | Bacteria | 2297 |
| 384 | Ga0395898_0331309 | 3300037466 | Bacteria | 1451 |
| 385 | Ga0395898_0439711 | 3300037466 | Bacteria | 1242 |
| 386 | Ga0395898_0638129 | 3300037466 | Bacteria | 1007 |
| 387 | Ga0395898_1000409 | 3300037466 | Bacteria | 772 |
| 388 | Ga0395905_0039849 | 3300037471 | Bacteria | 4408 |
| 389 | Ga0395905_0073515 | 3300037471 | Bacteria | 3204 |
| 390 | Ga0395905_0077321 | 3300037471 | Bacteria | 3118 |
| 391 | Ga0395905_0109850 | 3300037471 | Bacteria | 2589 |
| 392 | Ga0395905_0152799 | 3300037471 | Bacteria | 2171 |
| 393 | Ga0395905_0187841 | 3300037471 | Bacteria | 1939 |
| 394 | Ga0395901_0021218 | 3300038443 | Bacteria | 6652 |
| 395 | Ga0395901_0021517 | 3300038443 | Bacteria | 6608 |
| 396 | Ga0395901_0060354 | 3300038443 | Bacteria | 3946 |
| 397 | Ga0395901_0086522 | 3300038443 | Bacteria | 3277 |
| 398 | Ga0395901_0111459 | 3300038443 | Bacteria | 2873 |
| 399 | Ga0395901_0153011 | 3300038443 | Bacteria | 2423 |
| 400 | Ga0395901_0410548 | 3300038443 | Bacteria | 1390 |
| 401 | Ga0395901_1233502 | 3300038443 | Bacteria | 712 |
| 402 | Ga0242420_000859 | 3300038996 | Bacteria | 3741 |
| 403 | Ga0436365_0473746 | 3300039437 | Bacteria | 749 |
| 404 | Ga0436365_0851166 | 3300039437 | Bacteria | 1412 |
| 405 | Ga0436360_0095646 | 3300039438 | Bacteria | 838 |
| 406 | Ga0436360_0901858 | 3300039438 | Bacteria | 4491 |
| 407 | Ga0436362_0026788 | 3300039453 | Bacteria | 1012 |
| 408 | Ga0436362_0141011 | 3300039453 | Bacteria | 3388 |
| 409 | Ga0439439_0085607 | 3300041406 | Bacteria | 856 |
| 410 | Ga0439461_0086530 | 3300041410 | Bacteria | 746 |
| 411 | Ga0439461_0145975 | 3300041410 | Bacteria | 608 |
| 412 | Ga0439466_0046192 | 3300041411 | Bacteria | 1439 |
| 413 | Ga0439465_0140677 | 3300041413 | Bacteria | 857 |
| 414 | Ga0451789_0214170 | 3300041443 | Bacteria | 923 |
| 415 | Ga0439451_071014 | 3300042009 | Bacteria | 697 |
| 416 | Ga0450914_001396 | 3300042118 | Bacteria | 1504 |
| 417 | Ga0450917_003298 | 3300042120 | Bacteria | 1166 |
| 418 | Ga0450922_022659 | 3300042124 | Bacteria | 655 |
| 419 | Ga0450910_017161 | 3300042147 | Bacteria | 1076 |
| 420 | Ga0439446_0033002 | 3300042156 | Bacteria | 1503 |
| 421 | Ga0439434_0069991 | 3300042435 | Bacteria | 1104 |
| 422 | Ga0439434_0365322 | 3300042435 | Bacteria | 505 |
| 423 | Ga0439435_0087305 | 3300042436 | Bacteria | 943 |
| 424 | Ga0439459_0024711 | 3300042438 | Bacteria | 1181 |
| 425 | Ga0439460_0322011 | 3300042461 | Bacteria | 542 |
| 426 | Ga0466966_0227600 | 3300044684 | Bacteria | 1125 |
| 427 | Ga0466961_0004522 | 3300044693 | Bacteria | 8722 |
| 428 | Ga0466961_0129919 | 3300044693 | Bacteria | 1579 |
| 429 | Ga0466963_0045086 | 3300044694 | Bacteria | 2903 |
| 430 | Ga0466963_0065430 | 3300044694 | Bacteria | 2437 |
| 431 | Ga0466963_0370864 | 3300044694 | Bacteria | 1008 |
| 432 | Ga0466964_0017025 | 3300044706 | Bacteria | 2780 |
| 433 | Ga0466964_0098342 | 3300044706 | Bacteria | 1285 |
| 434 | Ga0466971_0000971 | 3300044719 | Bacteria | 11773 |
| 435 | Ga0466970_0129549 | 3300044765 | Bacteria | 1385 |
| 436 | Ga0466957_0019150 | 3300044842 | Bacteria | 4025 |
| 437 | Ga0466957_0183257 | 3300044842 | Bacteria | 1368 |
| 438 | Ga0466959_0001767 | 3300045049 | Bacteria | 13474 |
| 439 | Ga0451576_0392396 | 3300045051 | Bacteria | 1455 |
| 440 | Ga0466958_0032583 | 3300045836 | Bacteria | 3101 |
| 441 | Ga0466958_0033308 | 3300045836 | Bacteria | 3069 |
| 442 | Ga0466967_0016795 | 3300045976 | Bacteria | 5785 |
| 443 | Ga0466967_0037497 | 3300045976 | Bacteria | 4149 |
| 444 | Ga0466967_0071417 | 3300045976 | Bacteria | 3108 |
| 445 | Ga0466967_0082853 | 3300045976 | Bacteria | 2900 |
| 446 | Ga0466967_0087550 | 3300045976 | Bacteria | 2824 |
| 447 | Ga0466967_0194051 | 3300045976 | Bacteria | 1920 |
| 448 | Ga0466967_0297675 | 3300045976 | Bacteria | 1551 |
| 449 | Ga0466967_0856629 | 3300045976 | Bacteria | 903 |
| 450 | Ga0466967_1616934 | 3300045976 | Bacteria | 645 |
| 451 | Ga0495627_118966 | 3300046453 | Bacteria | 747 |
| 452 | Ga0495590_0052256 | 3300046457 | Bacteria | 1428 |
| 453 | Ga0495641_0494497 | 3300046461 | Bacteria | 557 |
| 454 | Ga0495651_0129691 | 3300046462 | Bacteria | 1842 |
| 455 | Ga0495653_0089552 | 3300046463 | Bacteria | 2254 |
| 456 | Ga0495653_0400563 | 3300046463 | Bacteria | 872 |
| 457 | Ga0495605_0070692 | 3300046474 | Bacteria | 1650 |
| 458 | Ga0495605_0176084 | 3300046474 | Bacteria | 943 |
| 459 | Ga0495662_0625522 | 3300046476 | Bacteria | 526 |
| 460 | Ga0495584_0126171 | 3300046491 | Bacteria | 1297 |
| 461 | Ga0495585_0321824 | 3300046492 | Bacteria | 756 |
| 462 | Ga0495607_0282001 | 3300046501 | Bacteria | 788 |
| 463 | Ga0495583_0433555 | 3300046506 | Bacteria | 515 |
| 464 | Ga0495608_0108276 | 3300046511 | Bacteria | 1787 |
| 465 | Ga0495608_0483358 | 3300046511 | Bacteria | 751 |
| 466 | Ga0495618_0229320 | 3300046514 | Bacteria | 1170 |
| 467 | Ga0495628_0539716 | 3300046516 | Bacteria | 838 |
| 468 | Ga0495628_0809890 | 3300046516 | Bacteria | 655 |
| 469 | Ga0495630_0101819 | 3300046517 | Bacteria | 2173 |
| 470 | Ga0495630_0312628 | 3300046517 | Bacteria | 1201 |
| 471 | Ga0495630_0700242 | 3300046517 | Bacteria | 775 |
| 472 | Ga0495631_0104780 | 3300046518 | Bacteria | 1217 |
| 473 | Ga0495632_0163704 | 3300046519 | Bacteria | 1024 |
| 474 | Ga0495637_0103078 | 3300046520 | Bacteria | 1113 |
| 475 | Ga0495637_0283653 | 3300046520 | Bacteria | 590 |
| 476 | Ga0495644_0050527 | 3300046523 | Bacteria | 1561 |
| 477 | Ga0495644_0162987 | 3300046523 | Bacteria | 855 |
| 478 | Ga0495663_0038142 | 3300046525 | Bacteria | 1451 |
| 479 | Ga0495663_0340727 | 3300046525 | Bacteria | 545 |
| 480 | Ga0495642_0013358 | 3300046528 | Bacteria | 3175 |
| 481 | Ga0495642_0247190 | 3300046528 | Bacteria | 780 |
| 482 | Ga0495652_0159220 | 3300046529 | Bacteria | 1755 |
| 483 | Ga0495652_0466651 | 3300046529 | Bacteria | 881 |
| 484 | Ga0495652_0678530 | 3300046529 | Bacteria | 695 |
| 485 | Ga0495640_0333906 | 3300046533 | Bacteria | 937 |
| 486 | Ga0495586_0268516 | 3300046535 | Bacteria | 975 |
| 487 | Ga0495598_0039477 | 3300046537 | Bacteria | 1373 |
| 488 | Ga0495609_0058883 | 3300046538 | Bacteria | 1699 |
| 489 | Ga0495633_0137042 | 3300046558 | Bacteria | 1132 |
| 490 | Ga0495667_0016704 | 3300046559 | Bacteria | 4956 |
| 491 | Ga0495667_0090217 | 3300046559 | Bacteria | 1986 |
| 492 | Ga0495667_0294934 | 3300046559 | Bacteria | 1028 |
| 493 | Ga0495667_0356909 | 3300046559 | Bacteria | 923 |
| 494 | Ga0495667_0959836 | 3300046559 | Bacteria | 522 |
| 495 | Ga0495656_0018932 | 3300046615 | Bacteria | 2651 |
| 496 | Ga0495656_0139976 | 3300046615 | Bacteria | 1160 |
| 497 | Ga0495656_0166621 | 3300046615 | Bacteria | 1074 |
| 498 | Ga0495656_0322017 | 3300046615 | Bacteria | 796 |
| 499 | Ga0495634_0159299 | 3300046642 | Bacteria | 1424 |
| 500 | Ga0495634_0171225 | 3300046642 | Bacteria | 1364 |
| 501 | Ga0495634_0204807 | 3300046642 | Bacteria | 1224 |
| 502 | Ga0495611_0124386 | 3300046648 | Bacteria | 1203 |
| 503 | Ga0495635_0181983 | 3300046663 | Bacteria | 1428 |
| 504 | Ga0495635_0215938 | 3300046663 | Bacteria | 1298 |
| 505 | Ga0495659_0159306 | 3300046664 | Bacteria | 910 |
| 506 | Ga0495657_0040527 | 3300046675 | Bacteria | 3194 |
| 507 | Ga0495657_0155565 | 3300046675 | Bacteria | 1417 |
| 508 | Ga0495657_0267301 | 3300046675 | Bacteria | 1026 |
| 509 | Ga0495599_0869680 | 3300046678 | Bacteria | 512 |
| 510 | Ga0495623_0401753 | 3300046679 | Bacteria | 737 |
| 511 | Ga0495646_0152428 | 3300046680 | Bacteria | 1285 |
| 512 | Ga0495669_0131803 | 3300046684 | Bacteria | 1177 |
| 513 | Ga0495669_0259092 | 3300046684 | Bacteria | 836 |
| 514 | Ga0495669_0423644 | 3300046684 | Bacteria | 646 |
| 515 | Ga0495613_0300497 | 3300046689 | Bacteria | 1111 |
| 516 | Ga0495624_0142110 | 3300046690 | Bacteria | 1470 |
| 517 | Ga0495589_0306121 | 3300046794 | Bacteria | 736 |
| 518 | Ga0495600_0484756 | 3300046809 | Bacteria | 761 |
| 519 | Ga0495660_0531301 | 3300046810 | Bacteria | 500 |
| 520 | Ga0495604_0471009 | 3300047317 | Bacteria | 818 |
| 521 | Ga0495604_0697375 | 3300047317 | Bacteria | 645 |
| 522 | Ga0495604_0873870 | 3300047317 | Bacteria | 563 |
| 523 | Ga0495636_0123538 | 3300047318 | Bacteria | 1147 |
| 524 | Ga0495636_0131199 | 3300047318 | Bacteria | 1115 |
| 525 | Ga0495676_0159844 | 3300047321 | Bacteria | 1595 |
| 526 | Ga0495676_0772083 | 3300047321 | Bacteria | 620 |
| 527 | Ga0495680_0002837 | 3300047322 | Bacteria | 17416 |
| 528 | Ga0495680_0016214 | 3300047322 | Bacteria | 6407 |
| 529 | Ga0495680_0264285 | 3300047322 | Bacteria | 1216 |
| 530 | Ga0495683_0484471 | 3300047323 | Bacteria | 504 |
| 531 | Ga0495687_138806 | 3300047443 | Bacteria | 849 |
| 532 | Ga0495675_0296064 | 3300047444 | Bacteria | 962 |
| 533 | Ga0495684_0009748 | 3300047471 | Bacteria | 7411 |
| 534 | Ga0495684_0014916 | 3300047471 | Bacteria | 5985 |
| 535 | Ga0495684_0845089 | 3300047471 | Bacteria | 594 |
| 536 | Ga0495602_0929179 | 3300048088 | Bacteria | 577 |
| 537 | Ga0496100_0074729 | 3300048903 | Bacteria | 2271 |
| 538 | Ga0496100_0340760 | 3300048903 | Bacteria | 1130 |
| 539 | Ga0496100_0479709 | 3300048903 | Bacteria | 956 |
| 540 | Ga0496100_1329938 | 3300048903 | Bacteria | 567 |
| 541 | Ga0496100_1545140 | 3300048903 | Bacteria | 524 |
| 542 | Ga0496101_0104332 | 3300048904 | Bacteria | 2126 |
| 543 | Ga0496101_0355964 | 3300048904 | Bacteria | 1151 |
| 544 | Ga0496101_0470468 | 3300048904 | Bacteria | 992 |
| 545 | Ga0496101_0554154 | 3300048904 | Bacteria | 909 |
| 546 | Ga0496101_1234382 | 3300048904 | Bacteria | 585 |
| 547 | Ga0496102_0201073 | 3300048905 | Bacteria | 1878 |
| 548 | Ga0496104_0005098 | 3300048907 | Bacteria | 11464 |
| 549 | Ga0496104_0151334 | 3300048907 | Bacteria | 2227 |
| 550 | Ga0496104_0158667 | 3300048907 | Bacteria | 2170 |
| 551 | Ga0496104_0188293 | 3300048907 | Bacteria | 1975 |
| 552 | Ga0496104_0215908 | 3300048907 | Bacteria | 1830 |
| 553 | Ga0496104_0316236 | 3300048907 | Bacteria | 1474 |
| 554 | Ga0496104_0956680 | 3300048907 | Bacteria | 761 |
| 555 | Ga0496105_0002794 | 3300048908 | Bacteria | 12764 |
| 556 | Ga0496105_0038494 | 3300048908 | Bacteria | 3939 |
| 557 | Ga0496105_0091710 | 3300048908 | Bacteria | 2509 |
| 558 | Ga0496105_0307589 | 3300048908 | Bacteria | 1273 |
| 559 | Ga0496105_0474474 | 3300048908 | Bacteria | 985 |
| 560 | Ga0496105_0732390 | 3300048908 | Bacteria | 756 |
| 561 | Ga0496105_0876647 | 3300048908 | Bacteria | 678 |
| 562 | Ga0496105_1173908 | 3300048908 | Bacteria | 566 |
| 563 | Ga0496106_0172803 | 3300048909 | Bacteria | 1713 |
| 564 | Ga0496106_0197766 | 3300048909 | Bacteria | 1599 |
| 565 | Ga0496106_0287226 | 3300048909 | Bacteria | 1318 |
| 566 | Ga0496106_1148925 | 3300048909 | Bacteria | 607 |
| 567 | Ga0496107_0953777 | 3300048910 | Bacteria | 624 |
| 568 | Ga0496108_0020577 | 3300048911 | Bacteria | 5422 |
| 569 | Ga0496108_0038707 | 3300048911 | Bacteria | 3973 |
| 570 | Ga0496108_0099911 | 3300048911 | Bacteria | 2474 |
| 571 | Ga0496108_0189382 | 3300048911 | Bacteria | 1783 |
| 572 | Ga0496108_0244306 | 3300048911 | Bacteria | 1562 |
| 573 | Ga0496108_1260722 | 3300048911 | Bacteria | 623 |
| 574 | Ga0496109_0020613 | 3300048912 | Bacteria | 5823 |
| 575 | Ga0496109_0043729 | 3300048912 | Bacteria | 4060 |
| 576 | Ga0496109_0061457 | 3300048912 | Bacteria | 3434 |
| 577 | Ga0496109_0377775 | 3300048912 | Bacteria | 1339 |
| 578 | Ga0496109_0716441 | 3300048912 | Bacteria | 938 |
| 579 | Ga0496109_0776217 | 3300048912 | Bacteria | 896 |
| 580 | Ga0496109_2022606 | 3300048912 | Bacteria | 508 |
| 581 | Ga0496110_0008791 | 3300048913 | Bacteria | 8138 |
| 582 | Ga0496110_0013634 | 3300048913 | Bacteria | 6729 |
| 583 | Ga0496110_0063612 | 3300048913 | Bacteria | 3260 |
| 584 | Ga0496110_0438681 | 3300048913 | Bacteria | 1190 |
| 585 | Ga0496110_0647550 | 3300048913 | Bacteria | 956 |
| 586 | Ga0496110_0658909 | 3300048913 | Bacteria | 947 |
| 587 | Ga0496111_0009841 | 3300048914 | Bacteria | 6391 |
| 588 | Ga0496111_0012957 | 3300048914 | Bacteria | 5659 |
| 589 | Ga0496111_0799660 | 3300048914 | Bacteria | 683 |
| 590 | Ga0496111_1010368 | 3300048914 | Bacteria | 596 |
| 591 | Ga0496112_0012288 | 3300048915 | Bacteria | 7863 |
| 592 | Ga0496112_0361682 | 3300048915 | Bacteria | 1393 |
| 593 | Ga0496112_0513699 | 3300048915 | Bacteria | 1133 |
| 594 | Ga0496112_1035404 | 3300048915 | Bacteria | 740 |
| 595 | Ga0496112_1586333 | 3300048915 | Bacteria | 568 |
| 596 | Ga0496113_0101444 | 3300048916 | Bacteria | 2231 |
| 597 | Ga0496113_0627853 | 3300048916 | Bacteria | 860 |
| 598 | Ga0496114_0357020 | 3300048917 | Bacteria | 1293 |
| 599 | Ga0496114_0419537 | 3300048917 | Bacteria | 1185 |
| 600 | Ga0496114_1323514 | 3300048917 | Bacteria | 607 |
| 601 | Ga0496115_0020286 | 3300048918 | Bacteria | 5126 |
| 602 | Ga0496115_0398176 | 3300048918 | Bacteria | 1117 |
| 603 | Ga0496115_0854939 | 3300048918 | Bacteria | 704 |
| 604 | Ga0496115_0959933 | 3300048918 | Bacteria | 656 |
| 605 | Ga0496115_1033174 | 3300048918 | Bacteria | 626 |
| 606 | Ga0496126_0138835 | 3300048929 | Bacteria | 2094 |
| 607 | Ga0501292_075571 | 3300049515 | Bacteria | 633 |
| 608 | Ga0501293_033660 | 3300049516 | Bacteria | 558 |
| 609 | Ga0501031_0457693 | 3300049568 | Bacteria | 824 |
| 610 | Ga0501033_0013479 | 3300049570 | Bacteria | 6222 |
| 611 | Ga0501033_1041244 | 3300049570 | Bacteria | 546 |
| 612 | Ga0501036_0398146 | 3300049572 | Bacteria | 1149 |
| 613 | Ga0501037_0558792 | 3300049573 | Bacteria | 772 |
| 614 | Ga0501038_0127182 | 3300049574 | Bacteria | 2096 |
| 615 | Ga0501039_0168589 | 3300049575 | Bacteria | 1721 |
| 616 | Ga0501039_0171289 | 3300049575 | Bacteria | 1707 |
| 617 | Ga0501039_1231993 | 3300049575 | Bacteria | 578 |
| 618 | Ga0501040_0009322 | 3300049576 | Bacteria | 6394 |
| 619 | Ga0501041_0054198 | 3300049577 | Bacteria | 2446 |
| 620 | Ga0501041_0357219 | 3300049577 | Bacteria | 924 |
| 621 | Ga0501042_0131267 | 3300049578 | Bacteria | 1805 |
| 622 | Ga0501048_0107480 | 3300049582 | Bacteria | 1970 |
| 623 | Ga0501048_0173616 | 3300049582 | Bacteria | 1527 |
| 624 | Ga0501067_0000314 | 3300049583 | Bacteria | 26636 |
| 625 | Ga0501068_0000349 | 3300049584 | Bacteria | 23215 |
| 626 | Ga0501068_0085790 | 3300049584 | Bacteria | 1938 |
| 627 | Ga0501068_1071047 | 3300049584 | Bacteria | 533 |
| 628 | Ga0501069_0011099 | 3300049585 | Bacteria | 4779 |
| 629 | Ga0501069_0033204 | 3300049585 | Bacteria | 2842 |
| 630 | Ga0501069_0274073 | 3300049585 | Bacteria | 987 |
| 631 | Ga0501070_0093602 | 3300049586 | Bacteria | 2486 |
| 632 | Ga0501070_1390042 | 3300049586 | Bacteria | 534 |
| 633 | Ga0501071_0004326 | 3300049587 | Bacteria | 9002 |
| 634 | Ga0501071_0369168 | 3300049587 | Bacteria | 1093 |
| 635 | Ga0501071_0794534 | 3300049587 | Bacteria | 729 |
| 636 | Ga0501071_0979609 | 3300049587 | Bacteria | 653 |
| 637 | Ga0501072_0180960 | 3300049588 | Bacteria | 1681 |
| 638 | Ga0501072_0583689 | 3300049588 | Bacteria | 881 |
| 639 | Ga0501072_0823885 | 3300049588 | Bacteria | 726 |
| 640 | Ga0501074_0047242 | 3300049590 | Bacteria | 3112 |
| 641 | Ga0501074_0203523 | 3300049590 | Bacteria | 1411 |
| 642 | Ga0501075_0060033 | 3300049591 | Bacteria | 2865 |
| 643 | Ga0501076_0272278 | 3300049592 | Bacteria | 1387 |
| 644 | Ga0501076_1263065 | 3300049592 | Bacteria | 607 |
| 645 | Ga0501076_1281209 | 3300049592 | Bacteria | 603 |
| 646 | Ga0501077_0350241 | 3300049593 | Bacteria | 942 |
| 647 | Ga0501208_144839 | 3300049655 | Bacteria | 537 |
| 648 | Ga0501209_069816 | 3300049656 | Bacteria | 997 |
| 649 | Ga0501238_070635 | 3300049671 | Bacteria | 542 |
| 650 | Ga0501221_148890 | 3300049704 | Bacteria | 619 |
| 651 | Ga0501234_079181 | 3300049707 | Bacteria | 577 |
| 652 | Ga0501079_0073479 | 3300049741 | Bacteria | 2643 |
| 653 | Ga0501079_0349213 | 3300049741 | Bacteria | 1159 |
| 654 | Ga0501079_0465129 | 3300049741 | Bacteria | 993 |
| 655 | Ga0501079_0530085 | 3300049741 | Bacteria | 926 |
| 656 | Ga0501079_0879897 | 3300049741 | Bacteria | 705 |
| 657 | Ga0501079_1347081 | 3300049741 | Bacteria | 562 |
| 658 | Ga0501080_1834738 | 3300049742 | Bacteria | 509 |
| 659 | Ga0501081_0015047 | 3300049743 | Bacteria | 5105 |
| 660 | Ga0501271_021714 | 3300049768 | Bacteria | 748 |
| 661 | Ga0501275_094447 | 3300049772 | Bacteria | 501 |
| 662 | Ga0501035_0630813 | 3300049822 | Bacteria | 871 |
| 663 | Ga0501035_1087289 | 3300049822 | Bacteria | 625 |
| 664 | Ga0501045_1304043 | 3300049824 | Bacteria | 528 |
| 665 | nmdc:mga05p37_26949_c1 | 3300050507 | Bacteria | 6992 |
| 666 | nmdc:mga05p37_451163_c1 | 3300050507 | Bacteria | 1488 |
| 667 | nmdc:mga05p37_550876_c1 | 3300050507 | Bacteria | 1313 |
| 668 | nmdc:mga05p37_970578_c1 | 3300050507 | Bacteria | 907 |
| 669 | nmdc:mga08y16_1866217_c1 | 3300050511 | Bacteria | 553 |
| 670 | nmdc:mga08y16_413865_c1 | 3300050511 | Bacteria | 1378 |
| 671 | nmdc:mga08y16_58291_c1 | 3300050511 | Bacteria | 4035 |
| 672 | nmdc:mga08y16_619910_c1 | 3300050511 | Bacteria | 1089 |
| 673 | nmdc:mga08y16_78142_c1 | 3300050511 | Bacteria | 3450 |
| 674 | nmdc:mga0n895_153171_c1 | 3300050512 | Bacteria | 2336 |
| 675 | nmdc:mga0n895_1644697_c1 | 3300050512 | Bacteria | 606 |
| 676 | nmdc:mga0rr50_751231_c1 | 3300050513 | Bacteria | 832 |
| 677 | nmdc:mga0a205_173064_c1 | 3300050515 | Bacteria | 2055 |
| 678 | nmdc:mga0a205_400278_c1 | 3300050515 | Bacteria | 1237 |
| 679 | Ga0495601_0147141 | 3300053077 | Bacteria | 1538 |
| 680 | Ga0495601_0378310 | 3300053077 | Bacteria | 919 |
| 681 | Ga0495601_0764565 | 3300053077 | Bacteria | 614 |
| 682 | Ga0495601_0791411 | 3300053077 | Bacteria | 602 |
| 683 | Ga0495655_0208215 | 3300053083 | Bacteria | 642 |
| 684 | Ga0495595_0003079 | 3300053084 | Bacteria | 6595 |
| 685 | Ga0495595_0008224 | 3300053084 | Bacteria | 4283 |
| 686 | Ga0495619_0070819 | 3300053085 | Bacteria | 2332 |
| 687 | Ga0495619_0160628 | 3300053085 | Bacteria | 1552 |
| 688 | Ga0495619_0371901 | 3300053085 | Bacteria | 988 |
| 689 | Ga0495619_0878549 | 3300053085 | Bacteria | 604 |
| 690 | Ga0501084_0024306 | 3300054114 | Bacteria | 5053 |
| 691 | Ga0501084_0211544 | 3300054114 | Bacteria | 1636 |
| 692 | Ga0501084_1159531 | 3300054114 | Bacteria | 648 |
| 693 | Ga0587070_133554 | 3300059491 | Bacteria | 606 |
| 694 | Ga0587082_060835 | 3300059504 | Bacteria | 744 |
| 695 | Ga0587089_103707 | 3300059509 | Bacteria | 518 |
| 696 | Ga0587062_096861 | 3300059639 | Bacteria | 569 |
| 697 | Ga0587062_126594 | 3300059639 | Bacteria | 521 |
| 698 | Ga0587076_080924 | 3300059645 | Bacteria | 693 |
| 699 | Ga0501082_0533166 | 3300060353 | Bacteria | 1026 |
| 700 | Ga0501082_0833087 | 3300060353 | Bacteria | 807 |
| 701 | Ga0501082_1097232 | 3300060353 | Bacteria | 696 |
| 702 | Ga0466962_0001733 | 3300061719 | Bacteria | 10253 |
| 703 | Ga0530510_0034859 | 3300061734 | Bacteria | 3626 |
| 704 | Ga0530510_0111190 | 3300061734 | Bacteria | 2007 |
| 705 | Ga0530510_0190060 | 3300061734 | Bacteria | 1524 |
| 706 | Ga0530510_0191777 | 3300061734 | Bacteria | 1517 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0369168 | Ga0501071_0369168_13_258 | 63 |
| 2 | 3300049587 | Ga0501071_0004326 | Ga0501071_0004326_8711_8992 | 65 |
| 3 | 3300044765 | Ga0466970_0129549 | Ga0466970_0129549_1099_1368 | 67 |
| 4 | 3300037312 | Ga0395899_0299025 | Ga0395899_0299025_458_742 | 70 |
| 5 | 3300037418 | Ga0395900_0995387 | Ga0395900_0995387_291_575 | 70 |
| 6 | 3300037466 | Ga0395898_0142255 | Ga0395898_0142255_1478_1762 | 70 |
| 7 | 3300038443 | Ga0395901_0410548 | Ga0395901_0410548_674_958 | 70 |
| 8 | 3300005355 | Ga0070671_101763731 | Ga0070671_1017637312 | 71 |
| 9 | 3300005439 | Ga0070711_100263708 | Ga0070711_1002637082 | 71 |
| 10 | 3300005530 | Ga0070679_100357296 | Ga0070679_1003572962 | 71 |
| 11 | 3300005535 | Ga0070684_100220013 | Ga0070684_1002200134 | 71 |
| 12 | 3300005564 | Ga0070664_100546479 | Ga0070664_1005464792 | 71 |
| 13 | 3300005614 | Ga0068856_100126000 | Ga0068856_1001260003 | 71 |
| 14 | 3300005616 | Ga0068852_100774253 | Ga0068852_1007742532 | 71 |
| 15 | 3300006173 | Ga0070716_100557134 | Ga0070716_1005571342 | 71 |
| 16 | 3300006175 | Ga0070712_100070694 | Ga0070712_1000706944 | 71 |
| 17 | 3300006237 | Ga0097621_100087269 | Ga0097621_1000872692 | 71 |
| 18 | 3300009174 | Ga0105241_10094162 | Ga0105241_100941625 | 71 |
| 19 | 3300013307 | Ga0157372_11910317 | Ga0157372_119103171 | 71 |
| 20 | 3300014969 | Ga0157376_10519221 | Ga0157376_105192212 | 71 |
| 21 | 3300025929 | Ga0207664_10527829 | Ga0207664_105278293 | 71 |
| 22 | 3300025936 | Ga0207670_10867188 | Ga0207670_108671883 | 71 |
| 23 | 3300025939 | Ga0207665_10453012 | Ga0207665_104530122 | 71 |
| 24 | 3300026078 | Ga0207702_10058200 | Ga0207702_100582003 | 71 |
| 25 | 3300026121 | Ga0207683_10052641 | Ga0207683_100526414 | 71 |
| 26 | 3300048903 | Ga0496100_0479709 | Ga0496100_0479709_80_367 | 71 |
| 27 | 3300048903 | Ga0496100_1329938 | Ga0496100_1329938_196_474 | 71 |
| 28 | 3300048904 | Ga0496101_1234382 | Ga0496101_1234382_104_400 | 71 |
| 29 | 3300048909 | Ga0496106_0197766 | Ga0496106_0197766_683_970 | 71 |
| 30 | 3300048911 | Ga0496108_0189382 | Ga0496108_0189382_256_552 | 71 |
| 31 | 3300048912 | Ga0496109_0377775 | Ga0496109_0377775_465_761 | 71 |
| 32 | 3300048913 | Ga0496110_0013634 | Ga0496110_0013634_2208_2486 | 71 |
| 33 | 3300048914 | Ga0496111_1010368 | Ga0496111_1010368_234_530 | 71 |
| 34 | 3300048915 | Ga0496112_1035404 | Ga0496112_1035404_173_469 | 71 |
| 35 | 3300049583 | Ga0501067_0000314 | Ga0501067_0000314_23803_24090 | 71 |
| 36 | 3300049584 | Ga0501068_0000349 | Ga0501068_0000349_11245_11532 | 71 |
| 37 | 3300049585 | Ga0501069_0011099 | Ga0501069_0011099_2562_2849 | 71 |
| 38 | 3300049586 | Ga0501070_0093602 | Ga0501070_0093602_267_554 | 71 |
| 39 | 3300061734 | Ga0530510_0034859 | Ga0530510_0034859_2120_2407 | 71 |
| 40 | 3300005336 | Ga0070680_101197889 | Ga0070680_1011978892 | 72 |
| 41 | 3300020082 | Ga0206353_11559060 | Ga0206353_115590602 | 72 |
| 42 | 3300025917 | Ga0207660_11030656 | Ga0207660_110306562 | 72 |
| 43 | 3300026041 | Ga0207639_12263996 | Ga0207639_122639962 | 72 |
| 44 | 3300028800 | Ga0265338_10945442 | Ga0265338_109454421 | 72 |
| 45 | 3300031241 | Ga0265325_10359618 | Ga0265325_103596182 | 72 |
| 46 | 3300037312 | Ga0395899_0041850 | Ga0395899_0041850_1486_1794 | 72 |
| 47 | 3300037418 | Ga0395900_0038387 | Ga0395900_0038387_2616_2924 | 72 |
| 48 | 3300037466 | Ga0395898_0020580 | Ga0395898_0020580_3778_4086 | 72 |
| 49 | 3300037471 | Ga0395905_0039849 | Ga0395905_0039849_2837_3145 | 72 |
| 50 | 3300038443 | Ga0395901_0021218 | Ga0395901_0021218_2616_2924 | 72 |
| 51 | 3300039453 | Ga0436362_0026788 | Ga0436362_0026788_501_785 | 72 |
| 52 | 3300048918 | Ga0496115_1033174 | Ga0496115_1033174_264_566 | 72 |
| 53 | 3300048929 | Ga0496126_0138835 | Ga0496126_0138835_1550_1852 | 72 |
| 54 | 3300006058 | Ga0075432_10326724 | Ga0075432_103267242 | 73 |
| 55 | 3300006852 | Ga0075433_10398127 | Ga0075433_103981273 | 73 |
| 56 | 3300009094 | Ga0111539_10040587 | Ga0111539_100405873 | 73 |
| 57 | 3300009177 | Ga0105248_11247964 | Ga0105248_112479642 | 73 |
| 58 | 3300009551 | Ga0105238_10712162 | Ga0105238_107121621 | 73 |
| 59 | 3300032002 | Ga0307416_101027658 | Ga0307416_1010276582 | 73 |
| 60 | 3300048907 | Ga0496104_0188293 | Ga0496104_0188293_304_615 | 73 |
| 61 | 3300048908 | Ga0496105_0307589 | Ga0496105_0307589_437_748 | 73 |
| 62 | 3300048913 | Ga0496110_0658909 | Ga0496110_0658909_131_427 | 73 |
| 63 | 3300048917 | Ga0496114_0357020 | Ga0496114_0357020_947_1258 | 73 |
| 64 | 3300048918 | Ga0496115_0854939 | Ga0496115_0854939_78_389 | 73 |
| 65 | 3300050511 | nmdc:mga08y16_619910_c1 | nmdc:mga08y16_619910_c1_158_463 | 73 |
| 66 | 3300050515 | nmdc:mga0a205_400278_c1 | nmdc:mga0a205_400278_c1_515_820 | 73 |
| 67 | 3300003373 | JGI25407J50210_10009553 | JGI25407J50210_100095532 | 74 |
| 68 | 3300003373 | JGI25407J50210_10105274 | JGI25407J50210_101052742 | 74 |
| 69 | 3300005471 | Ga0070698_101420579 | Ga0070698_1014205791 | 74 |
| 70 | 3300005981 | Ga0081538_10000240 | Ga0081538_1000024061 | 74 |
| 71 | 3300005981 | Ga0081538_10002585 | Ga0081538_100025859 | 74 |
| 72 | 3300006852 | Ga0075433_10739040 | Ga0075433_107390402 | 74 |
| 73 | 3300007076 | Ga0075435_100552860 | Ga0075435_1005528602 | 74 |
| 74 | 3300009147 | Ga0114129_10979982 | Ga0114129_109799822 | 74 |
| 75 | 3300013104 | Ga0157370_12028227 | Ga0157370_120282271 | 74 |
| 76 | 3300021358 | Ga0213873_10007348 | Ga0213873_100073483 | 74 |
| 77 | 3300021441 | Ga0213871_10002315 | Ga0213871_100023155 | 74 |
| 78 | 3300025928 | Ga0207700_10103004 | Ga0207700_101030041 | 74 |
| 79 | 3300039438 | Ga0436360_0901858 | Ga0436360_0901858_2134_2439 | 74 |
| 80 | 3300039453 | Ga0436362_0141011 | Ga0436362_0141011_2982_3287 | 74 |
| 81 | 3300044694 | Ga0466963_0065430 | Ga0466963_0065430_824_1117 | 74 |
| 82 | 3300044706 | Ga0466964_0017025 | Ga0466964_0017025_1159_1452 | 74 |
| 83 | 3300044842 | Ga0466957_0019150 | Ga0466957_0019150_3297_3590 | 74 |
| 84 | 3300045836 | Ga0466958_0032583 | Ga0466958_0032583_536_829 | 74 |
| 85 | 3300045976 | Ga0466967_0037497 | Ga0466967_0037497_3416_3709 | 74 |
| 86 | 3300048915 | Ga0496112_0361682 | Ga0496112_0361682_800_1093 | 74 |
| 87 | 3300050513 | nmdc:mga0rr50_751231_c1 | nmdc:mga0rr50_751231_c1_341_643 | 74 |
| 88 | 3300005719 | Ga0068861_102040050 | Ga0068861_1020400501 | 75 |
| 89 | 3300005937 | Ga0081455_10004505 | Ga0081455_100045058 | 75 |
| 90 | 3300005981 | Ga0081538_10036113 | Ga0081538_100361136 | 75 |
| 91 | 3300009094 | Ga0111539_10002272 | Ga0111539_100022725 | 75 |
| 92 | 3300009094 | Ga0111539_12125552 | Ga0111539_121255522 | 75 |
| 93 | 3300009147 | Ga0114129_10742920 | Ga0114129_107429203 | 75 |
| 94 | 3300013100 | Ga0157373_11278433 | Ga0157373_112784332 | 75 |
| 95 | 3300013296 | Ga0157374_11084149 | Ga0157374_110841492 | 75 |
| 96 | 3300027907 | Ga0207428_10006328 | Ga0207428_100063286 | 75 |
| 97 | 3300031344 | Ga0265316_10646096 | Ga0265316_106460962 | 75 |
| 98 | 3300031548 | Ga0307408_100085518 | Ga0307408_1000855184 | 75 |
| 99 | 3300031548 | Ga0307408_100117131 | Ga0307408_1001171313 | 75 |
| 100 | 3300031731 | Ga0307405_10109650 | Ga0307405_101096503 | 75 |
| 101 | 3300031824 | Ga0307413_10019744 | Ga0307413_100197445 | 75 |
| 102 | 3300031852 | Ga0307410_10004596 | Ga0307410_100045967 | 75 |
| 103 | 3300031901 | Ga0307406_10030841 | Ga0307406_100308413 | 75 |
| 104 | 3300031903 | Ga0307407_10001098 | Ga0307407_100010984 | 75 |
| 105 | 3300031911 | Ga0307412_10065059 | Ga0307412_100650594 | 75 |
| 106 | 3300031995 | Ga0307409_100013896 | Ga0307409_1000138965 | 75 |
| 107 | 3300032002 | Ga0307416_100041773 | Ga0307416_1000417733 | 75 |
| 108 | 3300032002 | Ga0307416_100206885 | Ga0307416_1002068854 | 75 |
| 109 | 3300032002 | Ga0307416_101678467 | Ga0307416_1016784672 | 75 |
| 110 | 3300032004 | Ga0307414_10039191 | Ga0307414_100391915 | 75 |
| 111 | 3300032005 | Ga0307411_10246349 | Ga0307411_102463493 | 75 |
| 112 | 3300032126 | Ga0307415_100103427 | Ga0307415_1001034273 | 75 |
| 113 | 3300034818 | Ga0373950_0164137 | Ga0373950_0164137_130_441 | 75 |
| 114 | 3300039438 | Ga0436360_0095646 | Ga0436360_0095646_135_428 | 75 |
| 115 | 3300041406 | Ga0439439_0085607 | Ga0439439_0085607_148_459 | 75 |
| 116 | 3300041410 | Ga0439461_0086530 | Ga0439461_0086530_66_377 | 75 |
| 117 | 3300041413 | Ga0439465_0140677 | Ga0439465_0140677_429_740 | 75 |
| 118 | 3300042435 | Ga0439434_0069991 | Ga0439434_0069991_155_466 | 75 |
| 119 | 3300045976 | Ga0466967_0856629 | Ga0466967_0856629_41_334 | 75 |
| 120 | 3300046453 | Ga0495627_118966 | Ga0495627_118966_172_483 | 75 |
| 121 | 3300046457 | Ga0495590_0052256 | Ga0495590_0052256_819_1130 | 75 |
| 122 | 3300046474 | Ga0495605_0070692 | Ga0495605_0070692_275_586 | 75 |
| 123 | 3300046491 | Ga0495584_0126171 | Ga0495584_0126171_378_689 | 75 |
| 124 | 3300046492 | Ga0495585_0321824 | Ga0495585_0321824_338_649 | 75 |
| 125 | 3300046506 | Ga0495583_0433555 | Ga0495583_0433555_118_429 | 75 |
| 126 | 3300046518 | Ga0495631_0104780 | Ga0495631_0104780_316_627 | 75 |
| 127 | 3300046519 | Ga0495632_0163704 | Ga0495632_0163704_173_484 | 75 |
| 128 | 3300046520 | Ga0495637_0283653 | Ga0495637_0283653_55_366 | 75 |
| 129 | 3300046528 | Ga0495642_0013358 | Ga0495642_0013358_44_355 | 75 |
| 130 | 3300046537 | Ga0495598_0039477 | Ga0495598_0039477_236_547 | 75 |
| 131 | 3300046538 | Ga0495609_0058883 | Ga0495609_0058883_129_440 | 75 |
| 132 | 3300046558 | Ga0495633_0137042 | Ga0495633_0137042_343_654 | 75 |
| 133 | 3300046615 | Ga0495656_0322017 | Ga0495656_0322017_193_504 | 75 |
| 134 | 3300046664 | Ga0495659_0159306 | Ga0495659_0159306_401_712 | 75 |
| 135 | 3300046684 | Ga0495669_0131803 | Ga0495669_0131803_103_414 | 75 |
| 136 | 3300046810 | Ga0495660_0531301 | Ga0495660_0531301_144_455 | 75 |
| 137 | 3300047318 | Ga0495636_0131199 | Ga0495636_0131199_214_525 | 75 |
| 138 | 3300049515 | Ga0501292_075571 | Ga0501292_075571_212_523 | 75 |
| 139 | 3300049516 | Ga0501293_033660 | Ga0501293_033660_61_372 | 75 |
| 140 | 3300049574 | Ga0501038_0127182 | Ga0501038_0127182_1602_1913 | 75 |
| 141 | 3300049575 | Ga0501039_0168589 | Ga0501039_0168589_1253_1564 | 75 |
| 142 | 3300049576 | Ga0501040_0009322 | Ga0501040_0009322_1894_2205 | 75 |
| 143 | 3300049577 | Ga0501041_0054198 | Ga0501041_0054198_257_568 | 75 |
| 144 | 3300049578 | Ga0501042_0131267 | Ga0501042_0131267_236_547 | 75 |
| 145 | 3300049582 | Ga0501048_0173616 | Ga0501048_0173616_955_1266 | 75 |
| 146 | 3300049588 | Ga0501072_0180960 | Ga0501072_0180960_1324_1635 | 75 |
| 147 | 3300049590 | Ga0501074_0047242 | Ga0501074_0047242_218_529 | 75 |
| 148 | 3300049590 | Ga0501074_0203523 | Ga0501074_0203523_381_692 | 75 |
| 149 | 3300049591 | Ga0501075_0060033 | Ga0501075_0060033_1454_1765 | 75 |
| 150 | 3300049592 | Ga0501076_0272278 | Ga0501076_0272278_851_1153 | 75 |
| 151 | 3300049592 | Ga0501076_1263065 | Ga0501076_1263065_15_317 | 75 |
| 152 | 3300049592 | Ga0501076_1281209 | Ga0501076_1281209_139_450 | 75 |
| 153 | 3300049655 | Ga0501208_144839 | Ga0501208_144839_109_420 | 75 |
| 154 | 3300049656 | Ga0501209_069816 | Ga0501209_069816_551_862 | 75 |
| 155 | 3300049671 | Ga0501238_070635 | Ga0501238_070635_42_353 | 75 |
| 156 | 3300049704 | Ga0501221_148890 | Ga0501221_148890_58_369 | 75 |
| 157 | 3300049707 | Ga0501234_079181 | Ga0501234_079181_210_521 | 75 |
| 158 | 3300049741 | Ga0501079_0465129 | Ga0501079_0465129_80_391 | 75 |
| 159 | 3300049743 | Ga0501081_0015047 | Ga0501081_0015047_1777_2088 | 75 |
| 160 | 3300050507 | nmdc:mga05p37_970578_c1 | nmdc:mga05p37_970578_c1_347_658 | 75 |
| 161 | 3300050511 | nmdc:mga08y16_58291_c1 | nmdc:mga08y16_58291_c1_2803_3114 | 75 |
| 162 | 3300053083 | Ga0495655_0208215 | Ga0495655_0208215_169_480 | 75 |
| 163 | 3300054114 | Ga0501084_0024306 | Ga0501084_0024306_2828_3139 | 75 |
| 164 | 3300054114 | Ga0501084_1159531 | Ga0501084_1159531_30_332 | 75 |
| 165 | 3300060353 | Ga0501082_0533166 | Ga0501082_0533166_103_414 | 75 |
| 166 | 3300005337 | Ga0070682_100090423 | Ga0070682_1000904231 | 76 |
| 167 | 3300005535 | Ga0070684_100344804 | Ga0070684_1003448043 | 76 |
| 168 | 3300005841 | Ga0068863_100723886 | Ga0068863_1007238862 | 76 |
| 169 | 3300006237 | Ga0097621_101137549 | Ga0097621_1011375492 | 76 |
| 170 | 3300009098 | Ga0105245_10912698 | Ga0105245_109126982 | 76 |
| 171 | 3300009177 | Ga0105248_12061870 | Ga0105248_120618702 | 76 |
| 172 | 3300013104 | Ga0157370_11296431 | Ga0157370_112964312 | 76 |
| 173 | 3300013105 | Ga0157369_10035964 | Ga0157369_100359644 | 76 |
| 174 | 3300013307 | Ga0157372_11000944 | Ga0157372_110009443 | 76 |
| 175 | 3300014969 | Ga0157376_10278680 | Ga0157376_102786802 | 76 |
| 176 | 3300025927 | Ga0207687_10751710 | Ga0207687_107517102 | 76 |
| 177 | 3300026035 | Ga0207703_11950554 | Ga0207703_119505542 | 76 |
| 178 | 3300026088 | Ga0207641_10707988 | Ga0207641_107079882 | 76 |
| 179 | 3300028381 | Ga0268264_12304378 | Ga0268264_123043782 | 76 |
| 180 | 3300035172 | Ga0373955_0474584 | Ga0373955_0474584_261_566 | 76 |
| 181 | 3300042124 | Ga0450922_022659 | Ga0450922_022659_80_385 | 76 |
| 182 | 3300046461 | Ga0495641_0494497 | Ga0495641_0494497_230_535 | 76 |
| 183 | 3300046535 | Ga0495586_0268516 | Ga0495586_0268516_106_411 | 76 |
| 184 | 3300046559 | Ga0495667_0959836 | Ga0495667_0959836_35_340 | 76 |
| 185 | 3300047321 | Ga0495676_0159844 | Ga0495676_0159844_689_994 | 76 |
| 186 | 3300048903 | Ga0496100_1545140 | Ga0496100_1545140_200_505 | 76 |
| 187 | 3300048904 | Ga0496101_0554154 | Ga0496101_0554154_223_528 | 76 |
| 188 | 3300048909 | Ga0496106_1148925 | Ga0496106_1148925_185_490 | 76 |
| 189 | 3300048917 | Ga0496114_1323514 | Ga0496114_1323514_10_315 | 76 |
| 190 | 3300031903 | Ga0307407_11469542 | Ga0307407_114695422 | 77 |
| 191 | 3300031911 | Ga0307412_11448172 | Ga0307412_114481722 | 77 |
| 192 | 3300042461 | Ga0439460_0322011 | Ga0439460_0322011_181_486 | 77 |
| 193 | 3300044706 | Ga0466964_0098342 | Ga0466964_0098342_607_912 | 77 |
| 194 | 3300045976 | Ga0466967_0297675 | Ga0466967_0297675_502_807 | 77 |
| 195 | 3300049585 | Ga0501069_0274073 | Ga0501069_0274073_469_780 | 77 |
| 196 | 3300005366 | Ga0070659_100579322 | Ga0070659_1005793221 | 78 |
| 197 | 3300005536 | Ga0070697_101504292 | Ga0070697_1015042922 | 78 |
| 198 | 3300005546 | Ga0070696_100071548 | Ga0070696_1000715483 | 78 |
| 199 | 3300006175 | Ga0070712_100434365 | Ga0070712_1004343652 | 78 |
| 200 | 3300006178 | Ga0075367_10511627 | Ga0075367_105116272 | 78 |
| 201 | 3300009148 | Ga0105243_11626979 | Ga0105243_116269792 | 78 |
| 202 | 3300009545 | Ga0105237_11970621 | Ga0105237_119706211 | 78 |
| 203 | 3300014497 | Ga0182008_10298628 | Ga0182008_102986282 | 78 |
| 204 | 3300015261 | Ga0182006_1242283 | Ga0182006_12422832 | 78 |
| 205 | 3300025928 | Ga0207700_10037748 | Ga0207700_100377483 | 78 |
| 206 | 3300025932 | Ga0207690_10517329 | Ga0207690_105173291 | 78 |
| 207 | 3300035692 | Ga0373935_0055212 | Ga0373935_0055212_113_418 | 78 |
| 208 | 3300037466 | Ga0395898_1000409 | Ga0395898_1000409_353_658 | 78 |
| 209 | 3300038443 | Ga0395901_1233502 | Ga0395901_1233502_90_395 | 78 |
| 210 | 3300044693 | Ga0466961_0129919 | Ga0466961_0129919_805_1110 | 78 |
| 211 | 3300044694 | Ga0466963_0045086 | Ga0466963_0045086_1561_1866 | 78 |
| 212 | 3300044694 | Ga0466963_0370864 | Ga0466963_0370864_160_465 | 78 |
| 213 | 3300044719 | Ga0466971_0000971 | Ga0466971_0000971_462_767 | 78 |
| 214 | 3300044842 | Ga0466957_0183257 | Ga0466957_0183257_860_1165 | 78 |
| 215 | 3300045836 | Ga0466958_0033308 | Ga0466958_0033308_1691_1996 | 78 |
| 216 | 3300045976 | Ga0466967_0016795 | Ga0466967_0016795_4945_5250 | 78 |
| 217 | 3300045976 | Ga0466967_0071417 | Ga0466967_0071417_1863_2168 | 78 |
| 218 | 3300045976 | Ga0466967_0087550 | Ga0466967_0087550_1154_1459 | 78 |
| 219 | 3300045976 | Ga0466967_0194051 | Ga0466967_0194051_1190_1495 | 78 |
| 220 | 3300045976 | Ga0466967_1616934 | Ga0466967_1616934_328_633 | 78 |
| 221 | 3300046463 | Ga0495653_0089552 | Ga0495653_0089552_52_357 | 78 |
| 222 | 3300046511 | Ga0495608_0108276 | Ga0495608_0108276_852_1157 | 78 |
| 223 | 3300046517 | Ga0495630_0312628 | Ga0495630_0312628_628_933 | 78 |
| 224 | 3300046525 | Ga0495663_0038142 | Ga0495663_0038142_738_1043 | 78 |
| 225 | 3300046559 | Ga0495667_0090217 | Ga0495667_0090217_1403_1708 | 78 |
| 226 | 3300046642 | Ga0495634_0159299 | Ga0495634_0159299_960_1265 | 78 |
| 227 | 3300046663 | Ga0495635_0215938 | Ga0495635_0215938_198_503 | 78 |
| 228 | 3300046675 | Ga0495657_0040527 | Ga0495657_0040527_2834_3139 | 78 |
| 229 | 3300046809 | Ga0495600_0484756 | Ga0495600_0484756_445_750 | 78 |
| 230 | 3300047322 | Ga0495680_0264285 | Ga0495680_0264285_887_1192 | 78 |
| 231 | 3300047471 | Ga0495684_0009748 | Ga0495684_0009748_1230_1535 | 78 |
| 232 | 3300048907 | Ga0496104_0005098 | Ga0496104_0005098_10919_11224 | 78 |
| 233 | 3300048907 | Ga0496104_0316236 | Ga0496104_0316236_258_563 | 78 |
| 234 | 3300048907 | Ga0496104_0956680 | Ga0496104_0956680_18_323 | 78 |
| 235 | 3300048908 | Ga0496105_0002794 | Ga0496105_0002794_2307_2612 | 78 |
| 236 | 3300048908 | Ga0496105_0732390 | Ga0496105_0732390_330_635 | 78 |
| 237 | 3300048911 | Ga0496108_0244306 | Ga0496108_0244306_1206_1511 | 78 |
| 238 | 3300048912 | Ga0496109_0061457 | Ga0496109_0061457_1369_1674 | 78 |
| 239 | 3300048913 | Ga0496110_0647550 | Ga0496110_0647550_424_729 | 78 |
| 240 | 3300048918 | Ga0496115_0020286 | Ga0496115_0020286_3039_3344 | 78 |
| 241 | 3300048918 | Ga0496115_0398176 | Ga0496115_0398176_116_421 | 78 |
| 242 | 3300049824 | Ga0501045_1304043 | Ga0501045_1304043_101_406 | 78 |
| 243 | 3300053077 | Ga0495601_0791411 | Ga0495601_0791411_121_426 | 78 |
| 244 | 3300053084 | Ga0495595_0003079 | Ga0495595_0003079_684_989 | 78 |
| 245 | 3300053085 | Ga0495619_0070819 | Ga0495619_0070819_432_737 | 78 |
| 246 | 3300059491 | Ga0587070_133554 | Ga0587070_133554_133_438 | 78 |
| 247 | 3300059639 | Ga0587062_096861 | Ga0587062_096861_194_499 | 78 |
| 248 | 3300061719 | Ga0466962_0001733 | Ga0466962_0001733_1688_1993 | 78 |
| 249 | 3300061734 | Ga0530510_0111190 | Ga0530510_0111190_216_521 | 78 |
| 250 | 3300005329 | Ga0070683_100278649 | Ga0070683_1002786493 | 79 |
| 251 | 3300005329 | Ga0070683_100484079 | Ga0070683_1004840792 | 79 |
| 252 | 3300005347 | Ga0070668_100734602 | Ga0070668_1007346023 | 79 |
| 253 | 3300005355 | Ga0070671_100565092 | Ga0070671_1005650923 | 79 |
| 254 | 3300005459 | Ga0068867_100500027 | Ga0068867_1005000272 | 79 |
| 255 | 3300005459 | Ga0068867_100781882 | Ga0068867_1007818823 | 79 |
| 256 | 3300005468 | Ga0070707_102209755 | Ga0070707_1022097552 | 79 |
| 257 | 3300005471 | Ga0070698_100082668 | Ga0070698_1000826684 | 79 |
| 258 | 3300005518 | Ga0070699_100050352 | Ga0070699_1000503526 | 79 |
| 259 | 3300005535 | Ga0070684_100027971 | Ga0070684_1000279714 | 79 |
| 260 | 3300005564 | Ga0070664_100420174 | Ga0070664_1004201743 | 79 |
| 261 | 3300005577 | Ga0068857_100030217 | Ga0068857_1000302174 | 79 |
| 262 | 3300005577 | Ga0068857_102158617 | Ga0068857_1021586172 | 79 |
| 263 | 3300005937 | Ga0081455_10007154 | Ga0081455_1000715414 | 79 |
| 264 | 3300005937 | Ga0081455_10091640 | Ga0081455_100916404 | 79 |
| 265 | 3300005983 | Ga0081540_1093167 | Ga0081540_10931671 | 79 |
| 266 | 3300006028 | Ga0070717_10887563 | Ga0070717_108875632 | 79 |
| 267 | 3300006175 | Ga0070712_100363249 | Ga0070712_1003632492 | 79 |
| 268 | 3300006852 | Ga0075433_10253621 | Ga0075433_102536212 | 79 |
| 269 | 3300006871 | Ga0075434_100103255 | Ga0075434_1001032555 | 79 |
| 270 | 3300006881 | Ga0068865_101364949 | Ga0068865_1013649491 | 79 |
| 271 | 3300009094 | Ga0111539_10994997 | Ga0111539_109949972 | 79 |
| 272 | 3300009094 | Ga0111539_12929904 | Ga0111539_129299041 | 79 |
| 273 | 3300009098 | Ga0105245_10187661 | Ga0105245_101876612 | 79 |
| 274 | 3300009147 | Ga0114129_10019250 | Ga0114129_100192505 | 79 |
| 275 | 3300009147 | Ga0114129_12816128 | Ga0114129_128161282 | 79 |
| 276 | 3300009148 | Ga0105243_10438802 | Ga0105243_104388023 | 79 |
| 277 | 3300009148 | Ga0105243_10508009 | Ga0105243_105080092 | 79 |
| 278 | 3300009553 | Ga0105249_10129149 | Ga0105249_101291495 | 79 |
| 279 | 3300011119 | Ga0105246_10758086 | Ga0105246_107580862 | 79 |
| 280 | 3300012476 | Ga0157344_1025678 | Ga0157344_10256782 | 79 |
| 281 | 3300012483 | Ga0157337_1000969 | Ga0157337_10009693 | 79 |
| 282 | 3300012508 | Ga0157315_1026828 | Ga0157315_10268281 | 79 |
| 283 | 3300013105 | Ga0157369_10583990 | Ga0157369_105839903 | 79 |
| 284 | 3300013296 | Ga0157374_10529927 | Ga0157374_105299274 | 79 |
| 285 | 3300014969 | Ga0157376_10391186 | Ga0157376_103911863 | 79 |
| 286 | 3300015261 | Ga0182006_1053905 | Ga0182006_10539054 | 79 |
| 287 | 3300025931 | Ga0207644_10309324 | Ga0207644_103093241 | 79 |
| 288 | 3300025935 | Ga0207709_10865606 | Ga0207709_108656062 | 79 |
| 289 | 3300025941 | Ga0207711_10226028 | Ga0207711_102260283 | 79 |
| 290 | 3300025942 | Ga0207689_10792094 | Ga0207689_107920941 | 79 |
| 291 | 3300025944 | Ga0207661_10191482 | Ga0207661_101914823 | 79 |
| 292 | 3300025944 | Ga0207661_12111172 | Ga0207661_121111721 | 79 |
| 293 | 3300025945 | Ga0207679_10364574 | Ga0207679_103645742 | 79 |
| 294 | 3300025949 | Ga0207667_10769222 | Ga0207667_107692221 | 79 |
| 295 | 3300025960 | Ga0207651_10599117 | Ga0207651_105991172 | 79 |
| 296 | 3300025981 | Ga0207640_10931003 | Ga0207640_109310032 | 79 |
| 297 | 3300025981 | Ga0207640_10963821 | Ga0207640_109638212 | 79 |
| 298 | 3300026089 | Ga0207648_10562546 | Ga0207648_105625463 | 79 |
| 299 | 3300026116 | Ga0207674_10032996 | Ga0207674_100329962 | 79 |
| 300 | 3300027907 | Ga0207428_10396899 | Ga0207428_103968993 | 79 |
| 301 | 3300031251 | Ga0265327_10015346 | Ga0265327_100153464 | 79 |
| 302 | 3300035086 | Ga0373934_0100557 | Ga0373934_0100557_582_887 | 79 |
| 303 | 3300035117 | Ga0373953_0070354 | Ga0373953_0070354_313_618 | 79 |
| 304 | 3300035118 | Ga0373954_0040886 | Ga0373954_0040886_703_1008 | 79 |
| 305 | 3300035410 | Ga0373924_0111660 | Ga0373924_0111660_429_734 | 79 |
| 306 | 3300035724 | Ga0373933_0215219 | Ga0373933_0215219_490_837 | 79 |
| 307 | 3300036401 | Ga0373937_0162707 | Ga0373937_0162707_1625_1930 | 79 |
| 308 | 3300037312 | Ga0395899_0002898 | Ga0395899_0002898_2149_2454 | 79 |
| 309 | 3300037312 | Ga0395899_0124192 | Ga0395899_0124192_1329_1634 | 79 |
| 310 | 3300037312 | Ga0395899_0509680 | Ga0395899_0509680_377_682 | 79 |
| 311 | 3300037418 | Ga0395900_0080879 | Ga0395900_0080879_1054_1359 | 79 |
| 312 | 3300037418 | Ga0395900_0082293 | Ga0395900_0082293_2556_2861 | 79 |
| 313 | 3300037418 | Ga0395900_0125629 | Ga0395900_0125629_1503_1808 | 79 |
| 314 | 3300037418 | Ga0395900_0126057 | Ga0395900_0126057_2005_2310 | 79 |
| 315 | 3300037418 | Ga0395900_0651759 | Ga0395900_0651759_24_329 | 79 |
| 316 | 3300037466 | Ga0395898_0007360 | Ga0395898_0007360_629_934 | 79 |
| 317 | 3300037466 | Ga0395898_0031910 | Ga0395898_0031910_685_990 | 79 |
| 318 | 3300037466 | Ga0395898_0331309 | Ga0395898_0331309_1079_1384 | 79 |
| 319 | 3300037466 | Ga0395898_0439711 | Ga0395898_0439711_810_1115 | 79 |
| 320 | 3300037466 | Ga0395898_0638129 | Ga0395898_0638129_128_433 | 79 |
| 321 | 3300037471 | Ga0395905_0073515 | Ga0395905_0073515_565_870 | 79 |
| 322 | 3300037471 | Ga0395905_0077321 | Ga0395905_0077321_552_857 | 79 |
| 323 | 3300037471 | Ga0395905_0109850 | Ga0395905_0109850_2262_2567 | 79 |
| 324 | 3300037471 | Ga0395905_0152799 | Ga0395905_0152799_706_1011 | 79 |
| 325 | 3300037471 | Ga0395905_0187841 | Ga0395905_0187841_1481_1786 | 79 |
| 326 | 3300038443 | Ga0395901_0021517 | Ga0395901_0021517_565_870 | 79 |
| 327 | 3300038443 | Ga0395901_0060354 | Ga0395901_0060354_954_1259 | 79 |
| 328 | 3300038443 | Ga0395901_0086522 | Ga0395901_0086522_1722_2027 | 79 |
| 329 | 3300038443 | Ga0395901_0111459 | Ga0395901_0111459_911_1216 | 79 |
| 330 | 3300038443 | Ga0395901_0153011 | Ga0395901_0153011_1030_1335 | 79 |
| 331 | 3300038996 | Ga0242420_000859 | Ga0242420_000859_2075_2380 | 79 |
| 332 | 3300039437 | Ga0436365_0473746 | Ga0436365_0473746_323_628 | 79 |
| 333 | 3300039437 | Ga0436365_0851166 | Ga0436365_0851166_847_1152 | 79 |
| 334 | 3300041410 | Ga0439461_0145975 | Ga0439461_0145975_72_383 | 79 |
| 335 | 3300041411 | Ga0439466_0046192 | Ga0439466_0046192_964_1275 | 79 |
| 336 | 3300041443 | Ga0451789_0214170 | Ga0451789_0214170_320_625 | 79 |
| 337 | 3300042009 | Ga0439451_071014 | Ga0439451_071014_129_440 | 79 |
| 338 | 3300042118 | Ga0450914_001396 | Ga0450914_001396_71_382 | 79 |
| 339 | 3300042120 | Ga0450917_003298 | Ga0450917_003298_375_686 | 79 |
| 340 | 3300042147 | Ga0450910_017161 | Ga0450910_017161_613_924 | 79 |
| 341 | 3300042156 | Ga0439446_0033002 | Ga0439446_0033002_402_713 | 79 |
| 342 | 3300042436 | Ga0439435_0087305 | Ga0439435_0087305_51_362 | 79 |
| 343 | 3300042438 | Ga0439459_0024711 | Ga0439459_0024711_544_855 | 79 |
| 344 | 3300044684 | Ga0466966_0227600 | Ga0466966_0227600_289_594 | 79 |
| 345 | 3300044693 | Ga0466961_0004522 | Ga0466961_0004522_756_1061 | 79 |
| 346 | 3300045049 | Ga0466959_0001767 | Ga0466959_0001767_12290_12595 | 79 |
| 347 | 3300045051 | Ga0451576_0392396 | Ga0451576_0392396_955_1260 | 79 |
| 348 | 3300045976 | Ga0466967_0082853 | Ga0466967_0082853_2285_2590 | 79 |
| 349 | 3300046462 | Ga0495651_0129691 | Ga0495651_0129691_46_351 | 79 |
| 350 | 3300046463 | Ga0495653_0400563 | Ga0495653_0400563_63_368 | 79 |
| 351 | 3300046474 | Ga0495605_0176084 | Ga0495605_0176084_251_556 | 79 |
| 352 | 3300046501 | Ga0495607_0282001 | Ga0495607_0282001_84_398 | 79 |
| 353 | 3300046511 | Ga0495608_0483358 | Ga0495608_0483358_299_604 | 79 |
| 354 | 3300046514 | Ga0495618_0229320 | Ga0495618_0229320_591_896 | 79 |
| 355 | 3300046516 | Ga0495628_0539716 | Ga0495628_0539716_72_377 | 79 |
| 356 | 3300046516 | Ga0495628_0809890 | Ga0495628_0809890_263_568 | 79 |
| 357 | 3300046517 | Ga0495630_0101819 | Ga0495630_0101819_1528_1833 | 79 |
| 358 | 3300046520 | Ga0495637_0103078 | Ga0495637_0103078_559_867 | 79 |
| 359 | 3300046523 | Ga0495644_0050527 | Ga0495644_0050527_673_981 | 79 |
| 360 | 3300046523 | Ga0495644_0162987 | Ga0495644_0162987_170_484 | 79 |
| 361 | 3300046525 | Ga0495663_0340727 | Ga0495663_0340727_180_488 | 79 |
| 362 | 3300046528 | Ga0495642_0247190 | Ga0495642_0247190_317_625 | 79 |
| 363 | 3300046529 | Ga0495652_0159220 | Ga0495652_0159220_1203_1508 | 79 |
| 364 | 3300046529 | Ga0495652_0466651 | Ga0495652_0466651_565_870 | 79 |
| 365 | 3300046529 | Ga0495652_0678530 | Ga0495652_0678530_301_606 | 79 |
| 366 | 3300046533 | Ga0495640_0333906 | Ga0495640_0333906_259_564 | 79 |
| 367 | 3300046559 | Ga0495667_0016704 | Ga0495667_0016704_1942_2247 | 79 |
| 368 | 3300046559 | Ga0495667_0294934 | Ga0495667_0294934_431_742 | 79 |
| 369 | 3300046559 | Ga0495667_0356909 | Ga0495667_0356909_539_844 | 79 |
| 370 | 3300046615 | Ga0495656_0018932 | Ga0495656_0018932_461_769 | 79 |
| 371 | 3300046615 | Ga0495656_0139976 | Ga0495656_0139976_534_839 | 79 |
| 372 | 3300046615 | Ga0495656_0166621 | Ga0495656_0166621_263_568 | 79 |
| 373 | 3300046642 | Ga0495634_0171225 | Ga0495634_0171225_1008_1313 | 79 |
| 374 | 3300046642 | Ga0495634_0204807 | Ga0495634_0204807_526_831 | 79 |
| 375 | 3300046648 | Ga0495611_0124386 | Ga0495611_0124386_468_776 | 79 |
| 376 | 3300046663 | Ga0495635_0181983 | Ga0495635_0181983_453_758 | 79 |
| 377 | 3300046675 | Ga0495657_0155565 | Ga0495657_0155565_136_441 | 79 |
| 378 | 3300046675 | Ga0495657_0267301 | Ga0495657_0267301_521_826 | 79 |
| 379 | 3300046678 | Ga0495599_0869680 | Ga0495599_0869680_104_409 | 79 |
| 380 | 3300046679 | Ga0495623_0401753 | Ga0495623_0401753_45_350 | 79 |
| 381 | 3300046680 | Ga0495646_0152428 | Ga0495646_0152428_754_1059 | 79 |
| 382 | 3300046684 | Ga0495669_0259092 | Ga0495669_0259092_62_367 | 79 |
| 383 | 3300046689 | Ga0495613_0300497 | Ga0495613_0300497_410_715 | 79 |
| 384 | 3300046690 | Ga0495624_0142110 | Ga0495624_0142110_981_1286 | 79 |
| 385 | 3300046794 | Ga0495589_0306121 | Ga0495589_0306121_367_675 | 79 |
| 386 | 3300047317 | Ga0495604_0471009 | Ga0495604_0471009_425_730 | 79 |
| 387 | 3300047317 | Ga0495604_0697375 | Ga0495604_0697375_28_333 | 79 |
| 388 | 3300047317 | Ga0495604_0873870 | Ga0495604_0873870_191_502 | 79 |
| 389 | 3300047318 | Ga0495636_0123538 | Ga0495636_0123538_615_923 | 79 |
| 390 | 3300047322 | Ga0495680_0002837 | Ga0495680_0002837_12787_13092 | 79 |
| 391 | 3300047322 | Ga0495680_0016214 | Ga0495680_0016214_4168_4473 | 79 |
| 392 | 3300047323 | Ga0495683_0484471 | Ga0495683_0484471_160_468 | 79 |
| 393 | 3300047443 | Ga0495687_138806 | Ga0495687_138806_125_436 | 79 |
| 394 | 3300047444 | Ga0495675_0296064 | Ga0495675_0296064_157_462 | 79 |
| 395 | 3300047471 | Ga0495684_0014916 | Ga0495684_0014916_3244_3549 | 79 |
| 396 | 3300047471 | Ga0495684_0845089 | Ga0495684_0845089_258_563 | 79 |
| 397 | 3300048088 | Ga0495602_0929179 | Ga0495602_0929179_140_445 | 79 |
| 398 | 3300048903 | Ga0496100_0074729 | Ga0496100_0074729_1184_1489 | 79 |
| 399 | 3300048904 | Ga0496101_0355964 | Ga0496101_0355964_68_373 | 79 |
| 400 | 3300048904 | Ga0496101_0470468 | Ga0496101_0470468_207_512 | 79 |
| 401 | 3300048907 | Ga0496104_0151334 | Ga0496104_0151334_218_523 | 79 |
| 402 | 3300048907 | Ga0496104_0158667 | Ga0496104_0158667_211_516 | 79 |
| 403 | 3300048908 | Ga0496105_0038494 | Ga0496105_0038494_1134_1439 | 79 |
| 404 | 3300048908 | Ga0496105_0474474 | Ga0496105_0474474_390_695 | 79 |
| 405 | 3300048908 | Ga0496105_0876647 | Ga0496105_0876647_259_564 | 79 |
| 406 | 3300048908 | Ga0496105_1173908 | Ga0496105_1173908_238_543 | 79 |
| 407 | 3300048909 | Ga0496106_0287226 | Ga0496106_0287226_10_315 | 79 |
| 408 | 3300048911 | Ga0496108_0020577 | Ga0496108_0020577_4127_4432 | 79 |
| 409 | 3300048911 | Ga0496108_0099911 | Ga0496108_0099911_2122_2427 | 79 |
| 410 | 3300048911 | Ga0496108_1260722 | Ga0496108_1260722_299_604 | 79 |
| 411 | 3300048912 | Ga0496109_0020613 | Ga0496109_0020613_1763_2068 | 79 |
| 412 | 3300048912 | Ga0496109_0776217 | Ga0496109_0776217_453_758 | 79 |
| 413 | 3300048912 | Ga0496109_2022606 | Ga0496109_2022606_101_406 | 79 |
| 414 | 3300048913 | Ga0496110_0008791 | Ga0496110_0008791_6644_6949 | 79 |
| 415 | 3300048913 | Ga0496110_0438681 | Ga0496110_0438681_262_567 | 79 |
| 416 | 3300048914 | Ga0496111_0012957 | Ga0496111_0012957_221_526 | 79 |
| 417 | 3300048914 | Ga0496111_0799660 | Ga0496111_0799660_190_495 | 79 |
| 418 | 3300048915 | Ga0496112_0012288 | Ga0496112_0012288_1607_1912 | 79 |
| 419 | 3300048915 | Ga0496112_0513699 | Ga0496112_0513699_174_479 | 79 |
| 420 | 3300048917 | Ga0496114_0419537 | Ga0496114_0419537_686_991 | 79 |
| 421 | 3300048918 | Ga0496115_0959933 | Ga0496115_0959933_130_435 | 79 |
| 422 | 3300049570 | Ga0501033_0013479 | Ga0501033_0013479_5799_6101 | 79 |
| 423 | 3300050507 | nmdc:mga05p37_26949_c1 | nmdc:mga05p37_26949_c1_2895_3200 | 79 |
| 424 | 3300050512 | nmdc:mga0n895_153171_c1 | nmdc:mga0n895_153171_c1_769_1074 | 79 |
| 425 | 3300050512 | nmdc:mga0n895_1644697_c1 | nmdc:mga0n895_1644697_c1_52_357 | 79 |
| 426 | 3300050515 | nmdc:mga0a205_173064_c1 | nmdc:mga0a205_173064_c1_581_886 | 79 |
| 427 | 3300053077 | Ga0495601_0147141 | Ga0495601_0147141_620_925 | 79 |
| 428 | 3300053077 | Ga0495601_0764565 | Ga0495601_0764565_60_365 | 79 |
| 429 | 3300053084 | Ga0495595_0008224 | Ga0495595_0008224_3771_4076 | 79 |
| 430 | 3300053085 | Ga0495619_0160628 | Ga0495619_0160628_652_957 | 79 |
| 431 | 3300053085 | Ga0495619_0878549 | Ga0495619_0878549_239_544 | 79 |
| 432 | 3300059504 | Ga0587082_060835 | Ga0587082_060835_102_407 | 79 |
| 433 | 3300059509 | Ga0587089_103707 | Ga0587089_103707_75_380 | 79 |
| 434 | 3300059639 | Ga0587062_126594 | Ga0587062_126594_169_474 | 79 |
| 435 | 3300059645 | Ga0587076_080924 | Ga0587076_080924_23_328 | 79 |
| 436 | 3300005340 | Ga0070689_100275630 | Ga0070689_1002756302 | 80 |
| 437 | 3300005354 | Ga0070675_100413889 | Ga0070675_1004138892 | 80 |
| 438 | 3300005356 | Ga0070674_100672841 | Ga0070674_1006728412 | 80 |
| 439 | 3300005364 | Ga0070673_102137321 | Ga0070673_1021373212 | 80 |
| 440 | 3300005365 | Ga0070688_100276444 | Ga0070688_1002764442 | 80 |
| 441 | 3300005366 | Ga0070659_100940073 | Ga0070659_1009400731 | 80 |
| 442 | 3300005440 | Ga0070705_100145123 | Ga0070705_1001451232 | 80 |
| 443 | 3300005441 | Ga0070700_100311560 | Ga0070700_1003115602 | 80 |
| 444 | 3300005441 | Ga0070700_100549446 | Ga0070700_1005494462 | 80 |
| 445 | 3300005457 | Ga0070662_100040018 | Ga0070662_1000400182 | 80 |
| 446 | 3300005518 | Ga0070699_100288580 | Ga0070699_1002885803 | 80 |
| 447 | 3300005543 | Ga0070672_100524934 | Ga0070672_1005249341 | 80 |
| 448 | 3300005617 | Ga0068859_102765314 | Ga0068859_1027653141 | 80 |
| 449 | 3300005618 | Ga0068864_102365372 | Ga0068864_1023653721 | 80 |
| 450 | 3300005840 | Ga0068870_10208673 | Ga0068870_102086732 | 80 |
| 451 | 3300005843 | Ga0068860_102363218 | Ga0068860_1023632182 | 80 |
| 452 | 3300005844 | Ga0068862_100186136 | Ga0068862_1001861362 | 80 |
| 453 | 3300006844 | Ga0075428_100469260 | Ga0075428_1004692602 | 80 |
| 454 | 3300006844 | Ga0075428_101623726 | Ga0075428_1016237262 | 80 |
| 455 | 3300006844 | Ga0075428_102000985 | Ga0075428_1020009851 | 80 |
| 456 | 3300006852 | Ga0075433_10626417 | Ga0075433_106264171 | 80 |
| 457 | 3300006881 | Ga0068865_100390119 | Ga0068865_1003901192 | 80 |
| 458 | 3300006931 | Ga0097620_102765048 | Ga0097620_1027650482 | 80 |
| 459 | 3300009094 | Ga0111539_10451625 | Ga0111539_104516253 | 80 |
| 460 | 3300009098 | Ga0105245_10256949 | Ga0105245_102569491 | 80 |
| 461 | 3300009147 | Ga0114129_10083439 | Ga0114129_100834392 | 80 |
| 462 | 3300009147 | Ga0114129_11858363 | Ga0114129_118583632 | 80 |
| 463 | 3300009553 | Ga0105249_10910758 | Ga0105249_109107582 | 80 |
| 464 | 3300009553 | Ga0105249_10991108 | Ga0105249_109911082 | 80 |
| 465 | 3300010375 | Ga0105239_13137395 | Ga0105239_131373952 | 80 |
| 466 | 3300011119 | Ga0105246_10344307 | Ga0105246_103443073 | 80 |
| 467 | 3300013308 | Ga0157375_11516010 | Ga0157375_115160102 | 80 |
| 468 | 3300014745 | Ga0157377_10219495 | Ga0157377_102194951 | 80 |
| 469 | 3300025885 | Ga0207653_10028703 | Ga0207653_100287033 | 80 |
| 470 | 3300025908 | Ga0207643_10688886 | Ga0207643_106888862 | 80 |
| 471 | 3300025923 | Ga0207681_10642878 | Ga0207681_106428782 | 80 |
| 472 | 3300025933 | Ga0207706_10032167 | Ga0207706_100321674 | 80 |
| 473 | 3300025936 | Ga0207670_10325848 | Ga0207670_103258482 | 80 |
| 474 | 3300025938 | Ga0207704_11669478 | Ga0207704_116694781 | 80 |
| 475 | 3300025942 | Ga0207689_10512985 | Ga0207689_105129852 | 80 |
| 476 | 3300025961 | Ga0207712_11051097 | Ga0207712_110510972 | 80 |
| 477 | 3300026075 | Ga0207708_10244044 | Ga0207708_102440442 | 80 |
| 478 | 3300026075 | Ga0207708_10256758 | Ga0207708_102567582 | 80 |
| 479 | 3300026088 | Ga0207641_11650941 | Ga0207641_116509412 | 80 |
| 480 | 3300026118 | Ga0207675_100067548 | Ga0207675_1000675482 | 80 |
| 481 | 3300026118 | Ga0207675_100457238 | Ga0207675_1004572383 | 80 |
| 482 | 3300027876 | Ga0209974_10037398 | Ga0209974_100373982 | 80 |
| 483 | 3300027907 | Ga0207428_10218425 | Ga0207428_102184252 | 80 |
| 484 | 3300028380 | Ga0268265_10196532 | Ga0268265_101965322 | 80 |
| 485 | 3300035241 | Ga0373961_0427376 | Ga0373961_0427376_154_444 | 80 |
| 486 | 3300048912 | Ga0496109_0716441 | Ga0496109_0716441_258_548 | 80 |
| 487 | 3300048916 | Ga0496113_0627853 | Ga0496113_0627853_22_312 | 80 |
| 488 | 3300050507 | nmdc:mga05p37_451163_c1 | nmdc:mga05p37_451163_c1_21_311 | 80 |
| 489 | 3300050511 | nmdc:mga08y16_413865_c1 | nmdc:mga08y16_413865_c1_863_1156 | 80 |
| 490 | 3300050511 | nmdc:mga08y16_78142_c1 | nmdc:mga08y16_78142_c1_2581_2871 | 80 |
| 491 | 3300027682 | Ga0209971_1119350 | Ga0209971_11193501 | 81 |
| 492 | 3300005329 | Ga0070683_100524440 | Ga0070683_1005244402 | 82 |
| 493 | 3300005345 | Ga0070692_10169102 | Ga0070692_101691021 | 82 |
| 494 | 3300005445 | Ga0070708_100490447 | Ga0070708_1004904472 | 82 |
| 495 | 3300005445 | Ga0070708_100873164 | Ga0070708_1008731641 | 82 |
| 496 | 3300005458 | Ga0070681_10290798 | Ga0070681_102907983 | 82 |
| 497 | 3300005518 | Ga0070699_100617848 | Ga0070699_1006178482 | 82 |
| 498 | 3300005536 | Ga0070697_100234608 | Ga0070697_1002346082 | 82 |
| 499 | 3300005544 | Ga0070686_100284456 | Ga0070686_1002844562 | 82 |
| 500 | 3300005546 | Ga0070696_101011041 | Ga0070696_1010110411 | 82 |
| 501 | 3300005564 | Ga0070664_100921101 | Ga0070664_1009211012 | 82 |
| 502 | 3300005618 | Ga0068864_100675894 | Ga0068864_1006758942 | 82 |
| 503 | 3300005842 | Ga0068858_100631815 | Ga0068858_1006318152 | 82 |
| 504 | 3300013307 | Ga0157372_11303705 | Ga0157372_113037052 | 82 |
| 505 | 3300014325 | Ga0163163_10786814 | Ga0163163_107868142 | 82 |
| 506 | 3300014968 | Ga0157379_10973229 | Ga0157379_109732291 | 82 |
| 507 | 3300025944 | Ga0207661_10451894 | Ga0207661_104518942 | 82 |
| 508 | 3300025945 | Ga0207679_11277072 | Ga0207679_112770721 | 82 |
| 509 | 3300026035 | Ga0207703_10487315 | Ga0207703_104873151 | 82 |
| 510 | 3300026095 | Ga0207676_10854240 | Ga0207676_108542401 | 82 |
| 511 | 3300035115 | Ga0373941_0192595 | Ga0373941_0192595_147_434 | 82 |
| 512 | 3300035207 | Ga0373942_0079965 | Ga0373942_0079965_93_380 | 82 |
| 513 | 3300046476 | Ga0495662_0625522 | Ga0495662_0625522_128_415 | 82 |
| 514 | 3300046517 | Ga0495630_0700242 | Ga0495630_0700242_250_537 | 82 |
| 515 | 3300046684 | Ga0495669_0423644 | Ga0495669_0423644_27_314 | 82 |
| 516 | 3300047321 | Ga0495676_0772083 | Ga0495676_0772083_220_507 | 82 |
| 517 | 3300049584 | Ga0501068_0085790 | Ga0501068_0085790_984_1271 | 82 |
| 518 | 3300049585 | Ga0501069_0033204 | Ga0501069_0033204_1396_1683 | 82 |
| 519 | 3300049586 | Ga0501070_1390042 | Ga0501070_1390042_44_331 | 82 |
| 520 | 3300049587 | Ga0501071_0979609 | Ga0501071_0979609_304_591 | 82 |
| 521 | 3300049741 | Ga0501079_0879897 | Ga0501079_0879897_70_357 | 82 |
| 522 | 3300049741 | Ga0501079_1347081 | Ga0501079_1347081_109_396 | 82 |
| 523 | 3300049742 | Ga0501080_1834738 | Ga0501080_1834738_102_389 | 82 |
| 524 | 3300053077 | Ga0495601_0378310 | Ga0495601_0378310_32_319 | 82 |
| 525 | 3300053085 | Ga0495619_0371901 | Ga0495619_0371901_536_823 | 82 |
| 526 | 3300001990 | JGI24737J22298_10159499 | JGI24737J22298_101594992 | 83 |
| 527 | 3300002244 | JGI24742J22300_10087163 | JGI24742J22300_100871632 | 83 |
| 528 | 3300002459 | JGI24751J29686_10043076 | JGI24751J29686_100430761 | 83 |
| 529 | 3300004798 | Ga0058859_11656751 | Ga0058859_116567512 | 83 |
| 530 | 3300005328 | Ga0070676_10149709 | Ga0070676_101497092 | 83 |
| 531 | 3300005329 | Ga0070683_100498378 | Ga0070683_1004983782 | 83 |
| 532 | 3300005330 | Ga0070690_100015506 | Ga0070690_1000155062 | 83 |
| 533 | 3300005331 | Ga0070670_100036039 | Ga0070670_1000360394 | 83 |
| 534 | 3300005336 | Ga0070680_100808603 | Ga0070680_1008086032 | 83 |
| 535 | 3300005336 | Ga0070680_101364601 | Ga0070680_1013646012 | 83 |
| 536 | 3300005337 | Ga0070682_100033554 | Ga0070682_1000335544 | 83 |
| 537 | 3300005340 | Ga0070689_100011400 | Ga0070689_1000114006 | 83 |
| 538 | 3300005341 | Ga0070691_10048903 | Ga0070691_100489031 | 83 |
| 539 | 3300005343 | Ga0070687_100004900 | Ga0070687_1000049002 | 83 |
| 540 | 3300005344 | Ga0070661_100454121 | Ga0070661_1004541211 | 83 |
| 541 | 3300005345 | Ga0070692_10099297 | Ga0070692_100992972 | 83 |
| 542 | 3300005347 | Ga0070668_100900717 | Ga0070668_1009007171 | 83 |
| 543 | 3300005353 | Ga0070669_100776964 | Ga0070669_1007769642 | 83 |
| 544 | 3300005354 | Ga0070675_100137721 | Ga0070675_1001377212 | 83 |
| 545 | 3300005355 | Ga0070671_100320123 | Ga0070671_1003201232 | 83 |
| 546 | 3300005356 | Ga0070674_100208719 | Ga0070674_1002087192 | 83 |
| 547 | 3300005364 | Ga0070673_100074774 | Ga0070673_1000747743 | 83 |
| 548 | 3300005365 | Ga0070688_100003816 | Ga0070688_1000038167 | 83 |
| 549 | 3300005366 | Ga0070659_100006869 | Ga0070659_1000068697 | 83 |
| 550 | 3300005367 | Ga0070667_100481136 | Ga0070667_1004811361 | 83 |
| 551 | 3300005440 | Ga0070705_100063523 | Ga0070705_1000635233 | 83 |
| 552 | 3300005440 | Ga0070705_100225276 | Ga0070705_1002252762 | 83 |
| 553 | 3300005441 | Ga0070700_100006192 | Ga0070700_1000061926 | 83 |
| 554 | 3300005441 | Ga0070700_100206715 | Ga0070700_1002067152 | 83 |
| 555 | 3300005444 | Ga0070694_100221425 | Ga0070694_1002214252 | 83 |
| 556 | 3300005444 | Ga0070694_100238167 | Ga0070694_1002381672 | 83 |
| 557 | 3300005444 | Ga0070694_100995817 | Ga0070694_1009958172 | 83 |
| 558 | 3300005455 | Ga0070663_100134303 | Ga0070663_1001343031 | 83 |
| 559 | 3300005456 | Ga0070678_100281709 | Ga0070678_1002817092 | 83 |
| 560 | 3300005458 | Ga0070681_10744552 | Ga0070681_107445522 | 83 |
| 561 | 3300005459 | Ga0068867_100018210 | Ga0068867_1000182103 | 83 |
| 562 | 3300005466 | Ga0070685_10113869 | Ga0070685_101138692 | 83 |
| 563 | 3300005467 | Ga0070706_100514454 | Ga0070706_1005144542 | 83 |
| 564 | 3300005471 | Ga0070698_100022281 | Ga0070698_1000222816 | 83 |
| 565 | 3300005535 | Ga0070684_100138019 | Ga0070684_1001380192 | 83 |
| 566 | 3300005536 | Ga0070697_100077363 | Ga0070697_1000773633 | 83 |
| 567 | 3300005536 | Ga0070697_100849142 | Ga0070697_1008491421 | 83 |
| 568 | 3300005539 | Ga0068853_100639430 | Ga0068853_1006394301 | 83 |
| 569 | 3300005543 | Ga0070672_100098764 | Ga0070672_1000987643 | 83 |
| 570 | 3300005544 | Ga0070686_100004377 | Ga0070686_1000043774 | 83 |
| 571 | 3300005546 | Ga0070696_100006955 | Ga0070696_1000069555 | 83 |
| 572 | 3300005547 | Ga0070693_100134308 | Ga0070693_1001343082 | 83 |
| 573 | 3300005547 | Ga0070693_101277033 | Ga0070693_1012770331 | 83 |
| 574 | 3300005548 | Ga0070665_101450863 | Ga0070665_1014508631 | 83 |
| 575 | 3300005564 | Ga0070664_100030578 | Ga0070664_1000305782 | 83 |
| 576 | 3300005577 | Ga0068857_100027184 | Ga0068857_1000271845 | 83 |
| 577 | 3300005577 | Ga0068857_102331831 | Ga0068857_1023318311 | 83 |
| 578 | 3300005578 | Ga0068854_100103070 | Ga0068854_1001030702 | 83 |
| 579 | 3300005578 | Ga0068854_100754145 | Ga0068854_1007541451 | 83 |
| 580 | 3300005615 | Ga0070702_100007071 | Ga0070702_1000070712 | 83 |
| 581 | 3300005616 | Ga0068852_100022059 | Ga0068852_1000220593 | 83 |
| 582 | 3300005617 | Ga0068859_100137104 | Ga0068859_1001371042 | 83 |
| 583 | 3300005618 | Ga0068864_100086000 | Ga0068864_1000860002 | 83 |
| 584 | 3300005718 | Ga0068866_10098729 | Ga0068866_100987292 | 83 |
| 585 | 3300005719 | Ga0068861_101046552 | Ga0068861_1010465521 | 83 |
| 586 | 3300005840 | Ga0068870_10003863 | Ga0068870_100038634 | 83 |
| 587 | 3300005842 | Ga0068858_100055220 | Ga0068858_1000552203 | 83 |
| 588 | 3300005843 | Ga0068860_100004060 | Ga0068860_1000040605 | 83 |
| 589 | 3300006038 | Ga0075365_10928082 | Ga0075365_109280821 | 83 |
| 590 | 3300006844 | Ga0075428_100204411 | Ga0075428_1002044113 | 83 |
| 591 | 3300006844 | Ga0075428_101680577 | Ga0075428_1016805772 | 83 |
| 592 | 3300006847 | Ga0075431_100065436 | Ga0075431_1000654363 | 83 |
| 593 | 3300006881 | Ga0068865_100110705 | Ga0068865_1001107051 | 83 |
| 594 | 3300006931 | Ga0097620_100137097 | Ga0097620_1001370972 | 83 |
| 595 | 3300009098 | Ga0105245_10046707 | Ga0105245_100467074 | 83 |
| 596 | 3300009101 | Ga0105247_10050427 | Ga0105247_100504273 | 83 |
| 597 | 3300009148 | Ga0105243_10015460 | Ga0105243_100154606 | 83 |
| 598 | 3300009176 | Ga0105242_10047340 | Ga0105242_100473404 | 83 |
| 599 | 3300009177 | Ga0105248_10051124 | Ga0105248_100511242 | 83 |
| 600 | 3300009551 | Ga0105238_12674923 | Ga0105238_126749231 | 83 |
| 601 | 3300009553 | Ga0105249_10006756 | Ga0105249_100067565 | 83 |
| 602 | 3300010375 | Ga0105239_10128806 | Ga0105239_101288061 | 83 |
| 603 | 3300011119 | Ga0105246_10599021 | Ga0105246_105990212 | 83 |
| 604 | 3300013100 | Ga0157373_11253780 | Ga0157373_112537801 | 83 |
| 605 | 3300013297 | Ga0157378_10003446 | Ga0157378_1000344612 | 83 |
| 606 | 3300013306 | Ga0163162_10137854 | Ga0163162_101378542 | 83 |
| 607 | 3300013308 | Ga0157375_10013278 | Ga0157375_100132786 | 83 |
| 608 | 3300014325 | Ga0163163_10008650 | Ga0163163_100086508 | 83 |
| 609 | 3300014326 | Ga0157380_10033356 | Ga0157380_100333564 | 83 |
| 610 | 3300014745 | Ga0157377_10007842 | Ga0157377_100078423 | 83 |
| 611 | 3300014968 | Ga0157379_10084518 | Ga0157379_100845181 | 83 |
| 612 | 3300017792 | Ga0163161_10064380 | Ga0163161_100643801 | 83 |
| 613 | 3300025899 | Ga0207642_10032257 | Ga0207642_100322572 | 83 |
| 614 | 3300025900 | Ga0207710_10118324 | Ga0207710_101183242 | 83 |
| 615 | 3300025901 | Ga0207688_10126286 | Ga0207688_101262862 | 83 |
| 616 | 3300025908 | Ga0207643_10001789 | Ga0207643_100017893 | 83 |
| 617 | 3300025909 | Ga0207705_10612733 | Ga0207705_106127332 | 83 |
| 618 | 3300025910 | Ga0207684_11147625 | Ga0207684_111476251 | 83 |
| 619 | 3300025912 | Ga0207707_10835692 | Ga0207707_108356922 | 83 |
| 620 | 3300025917 | Ga0207660_11317392 | Ga0207660_113173922 | 83 |
| 621 | 3300025918 | Ga0207662_10000237 | Ga0207662_1000023715 | 83 |
| 622 | 3300025920 | Ga0207649_10087818 | Ga0207649_100878181 | 83 |
| 623 | 3300025923 | Ga0207681_10904150 | Ga0207681_109041501 | 83 |
| 624 | 3300025925 | Ga0207650_10356623 | Ga0207650_103566231 | 83 |
| 625 | 3300025926 | Ga0207659_10010535 | Ga0207659_100105354 | 83 |
| 626 | 3300025927 | Ga0207687_10027593 | Ga0207687_100275933 | 83 |
| 627 | 3300025931 | Ga0207644_10529163 | Ga0207644_105291632 | 83 |
| 628 | 3300025932 | Ga0207690_10466257 | Ga0207690_104662572 | 83 |
| 629 | 3300025934 | Ga0207686_10783383 | Ga0207686_107833832 | 83 |
| 630 | 3300025935 | Ga0207709_10027266 | Ga0207709_100272661 | 83 |
| 631 | 3300025936 | Ga0207670_10250582 | Ga0207670_102505821 | 83 |
| 632 | 3300025937 | Ga0207669_10171024 | Ga0207669_101710242 | 83 |
| 633 | 3300025938 | Ga0207704_10456914 | Ga0207704_104569142 | 83 |
| 634 | 3300025940 | Ga0207691_10012785 | Ga0207691_100127858 | 83 |
| 635 | 3300025960 | Ga0207651_10127559 | Ga0207651_101275592 | 83 |
| 636 | 3300025961 | Ga0207712_10068519 | Ga0207712_100685193 | 83 |
| 637 | 3300025961 | Ga0207712_10625568 | Ga0207712_106255682 | 83 |
| 638 | 3300025972 | Ga0207668_10230153 | Ga0207668_102301532 | 83 |
| 639 | 3300025981 | Ga0207640_10146008 | Ga0207640_101460082 | 83 |
| 640 | 3300025986 | Ga0207658_10429120 | Ga0207658_104291202 | 83 |
| 641 | 3300026035 | Ga0207703_10088091 | Ga0207703_100880913 | 83 |
| 642 | 3300026041 | Ga0207639_10092058 | Ga0207639_100920582 | 83 |
| 643 | 3300026067 | Ga0207678_10015566 | Ga0207678_100155665 | 83 |
| 644 | 3300026075 | Ga0207708_10007304 | Ga0207708_100073048 | 83 |
| 645 | 3300026089 | Ga0207648_10001684 | Ga0207648_1000168412 | 83 |
| 646 | 3300026089 | Ga0207648_11053909 | Ga0207648_110539092 | 83 |
| 647 | 3300026116 | Ga0207674_10027111 | Ga0207674_100271116 | 83 |
| 648 | 3300026118 | Ga0207675_100376852 | Ga0207675_1003768522 | 83 |
| 649 | 3300026142 | Ga0207698_10063639 | Ga0207698_100636393 | 83 |
| 650 | 3300027543 | Ga0209999_1059138 | Ga0209999_10591382 | 83 |
| 651 | 3300027617 | Ga0210002_1106016 | Ga0210002_11060161 | 83 |
| 652 | 3300028379 | Ga0268266_10256326 | Ga0268266_102563262 | 83 |
| 653 | 3300028381 | Ga0268264_10068651 | Ga0268264_100686511 | 83 |
| 654 | 3300031548 | Ga0307408_100060910 | Ga0307408_1000609102 | 83 |
| 655 | 3300031731 | Ga0307405_10143618 | Ga0307405_101436183 | 83 |
| 656 | 3300031901 | Ga0307406_10404829 | Ga0307406_104048291 | 83 |
| 657 | 3300031911 | Ga0307412_10180365 | Ga0307412_101803652 | 83 |
| 658 | 3300032002 | Ga0307416_100000904 | Ga0307416_10000090410 | 83 |
| 659 | 3300032126 | Ga0307415_100004099 | Ga0307415_1000040998 | 83 |
| 660 | 3300035092 | Ga0373952_0051874 | Ga0373952_0051874_376_666 | 83 |
| 661 | 3300035121 | Ga0373960_0424203 | Ga0373960_0424203_116_406 | 83 |
| 662 | 3300035171 | Ga0373946_0413211 | Ga0373946_0413211_326_616 | 83 |
| 663 | 3300035242 | Ga0373962_0245608 | Ga0373962_0245608_19_309 | 83 |
| 664 | 3300035691 | Ga0373931_0125146 | Ga0373931_0125146_481_771 | 83 |
| 665 | 3300037418 | Ga0395900_1266213 | Ga0395900_1266213_90_380 | 83 |
| 666 | 3300042435 | Ga0439434_0365322 | Ga0439434_0365322_26_316 | 83 |
| 667 | 3300048903 | Ga0496100_0340760 | Ga0496100_0340760_643_933 | 83 |
| 668 | 3300048904 | Ga0496101_0104332 | Ga0496101_0104332_72_362 | 83 |
| 669 | 3300048905 | Ga0496102_0201073 | Ga0496102_0201073_1277_1567 | 83 |
| 670 | 3300048907 | Ga0496104_0215908 | Ga0496104_0215908_631_921 | 83 |
| 671 | 3300048908 | Ga0496105_0091710 | Ga0496105_0091710_32_322 | 83 |
| 672 | 3300048909 | Ga0496106_0172803 | Ga0496106_0172803_937_1227 | 83 |
| 673 | 3300048910 | Ga0496107_0953777 | Ga0496107_0953777_240_530 | 83 |
| 674 | 3300048911 | Ga0496108_0038707 | Ga0496108_0038707_2128_2418 | 83 |
| 675 | 3300048912 | Ga0496109_0043729 | Ga0496109_0043729_2770_3060 | 83 |
| 676 | 3300048913 | Ga0496110_0063612 | Ga0496110_0063612_1349_1639 | 83 |
| 677 | 3300048914 | Ga0496111_0009841 | Ga0496111_0009841_4616_4906 | 83 |
| 678 | 3300048915 | Ga0496112_1586333 | Ga0496112_1586333_223_513 | 83 |
| 679 | 3300048916 | Ga0496113_0101444 | Ga0496113_0101444_190_480 | 83 |
| 680 | 3300049568 | Ga0501031_0457693 | Ga0501031_0457693_497_787 | 83 |
| 681 | 3300049570 | Ga0501033_1041244 | Ga0501033_1041244_211_501 | 83 |
| 682 | 3300049572 | Ga0501036_0398146 | Ga0501036_0398146_376_669 | 83 |
| 683 | 3300049573 | Ga0501037_0558792 | Ga0501037_0558792_31_321 | 83 |
| 684 | 3300049575 | Ga0501039_0171289 | Ga0501039_0171289_1023_1313 | 83 |
| 685 | 3300049575 | Ga0501039_1231993 | Ga0501039_1231993_268_558 | 83 |
| 686 | 3300049577 | Ga0501041_0357219 | Ga0501041_0357219_589_879 | 83 |
| 687 | 3300049582 | Ga0501048_0107480 | Ga0501048_0107480_77_367 | 83 |
| 688 | 3300049584 | Ga0501068_1071047 | Ga0501068_1071047_55_345 | 83 |
| 689 | 3300049587 | Ga0501071_0794534 | Ga0501071_0794534_327_617 | 83 |
| 690 | 3300049588 | Ga0501072_0583689 | Ga0501072_0583689_284_574 | 83 |
| 691 | 3300049588 | Ga0501072_0823885 | Ga0501072_0823885_56_346 | 83 |
| 692 | 3300049593 | Ga0501077_0350241 | Ga0501077_0350241_73_363 | 83 |
| 693 | 3300049741 | Ga0501079_0073479 | Ga0501079_0073479_717_1007 | 83 |
| 694 | 3300049741 | Ga0501079_0349213 | Ga0501079_0349213_87_377 | 83 |
| 695 | 3300049741 | Ga0501079_0530085 | Ga0501079_0530085_417_710 | 83 |
| 696 | 3300049768 | Ga0501271_021714 | Ga0501271_021714_412_702 | 83 |
| 697 | 3300049772 | Ga0501275_094447 | Ga0501275_094447_131_421 | 83 |
| 698 | 3300049822 | Ga0501035_0630813 | Ga0501035_0630813_359_649 | 83 |
| 699 | 3300049822 | Ga0501035_1087289 | Ga0501035_1087289_291_581 | 83 |
| 700 | 3300050507 | nmdc:mga05p37_550876_c1 | nmdc:mga05p37_550876_c1_245_535 | 83 |
| 701 | 3300050511 | nmdc:mga08y16_1866217_c1 | nmdc:mga08y16_1866217_c1_215_505 | 83 |
| 702 | 3300054114 | Ga0501084_0211544 | Ga0501084_0211544_1280_1570 | 83 |
| 703 | 3300060353 | Ga0501082_0833087 | Ga0501082_0833087_305_595 | 83 |
| 704 | 3300060353 | Ga0501082_1097232 | Ga0501082_1097232_259_549 | 83 |
| 705 | 3300061734 | Ga0530510_0190060 | Ga0530510_0190060_1209_1502 | 83 |
| 706 | 3300061734 | Ga0530510_0191777 | Ga0530510_0191777_673_963 | 83 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar