F476486

General Info

Members Datasets Scaffolds Average Seq Length
706 361 706 91

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0215219|Ga0373933_0215219_490_837
Length 109
Sequence MRAETRRAGRGDLAVTYIITEPCIDVMDKSVDCIHESGRMLVIDPEECIDCGACEPECPVEAIFPEDALPDKWNAFVEINYAYDKGAAVVDELTQKYAVENNVQNEPIE

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
96 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
97 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
222 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
223 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
224 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
225 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
229 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
311 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
333 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
334 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
335 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
336 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
341 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 9.92
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10159499 3300001990 Bacteria 666
2 JGI24742J22300_10087163 3300002244 Bacteria 595
3 JGI24751J29686_10043076 3300002459 Bacteria 933
4 JGI25407J50210_10009553 3300003373 Bacteria 2459
5 JGI25407J50210_10105274 3300003373 Bacteria 697
6 Ga0058859_11656751 3300004798 Bacteria 550
7 Ga0070676_10149709 3300005328 Bacteria 1493
8 Ga0070683_100278649 3300005329 Bacteria 1591
9 Ga0070683_100484079 3300005329 Bacteria 1182
10 Ga0070683_100498378 3300005329 Bacteria 1163
11 Ga0070683_100524440 3300005329 Bacteria 1132
12 Ga0070690_100015506 3300005330 Bacteria 4548
13 Ga0070670_100036039 3300005331 Bacteria 4258
14 Ga0070680_100808603 3300005336 Bacteria 808
15 Ga0070680_101197889 3300005336 Bacteria 657
16 Ga0070680_101364601 3300005336 Bacteria 614
17 Ga0070682_100033554 3300005337 Bacteria 3120
18 Ga0070682_100090423 3300005337 Bacteria 2002
19 Ga0070689_100011400 3300005340 Bacteria 6367
20 Ga0070689_100275630 3300005340 Bacteria 1394
21 Ga0070691_10048903 3300005341 Bacteria 2014
22 Ga0070687_100004900 3300005343 Bacteria 5372
23 Ga0070661_100454121 3300005344 Bacteria 1020
24 Ga0070692_10099297 3300005345 Bacteria 1594
25 Ga0070692_10169102 3300005345 Bacteria 1259
26 Ga0070668_100734602 3300005347 Bacteria 873
27 Ga0070668_100900717 3300005347 Bacteria 791
28 Ga0070669_100776964 3300005353 Bacteria 813
29 Ga0070675_100137721 3300005354 Bacteria 2084
30 Ga0070675_100413889 3300005354 Bacteria 1204
31 Ga0070671_100320123 3300005355 Bacteria 1321
32 Ga0070671_100565092 3300005355 Bacteria 981
33 Ga0070671_101763731 3300005355 Bacteria 550
34 Ga0070674_100208719 3300005356 Bacteria 1512
35 Ga0070674_100672841 3300005356 Bacteria 882
36 Ga0070673_100074774 3300005364 Bacteria 2731
37 Ga0070673_102137321 3300005364 Bacteria 532
38 Ga0070688_100003816 3300005365 Bacteria 7812
39 Ga0070688_100276444 3300005365 Bacteria 1205
40 Ga0070659_100006869 3300005366 Bacteria 8244
41 Ga0070659_100579322 3300005366 Bacteria 963
42 Ga0070659_100940073 3300005366 Bacteria 757
43 Ga0070667_100481136 3300005367 Bacteria 1137
44 Ga0070711_100263708 3300005439 Bacteria 1356
45 Ga0070705_100063523 3300005440 Bacteria 2202
46 Ga0070705_100145123 3300005440 Bacteria 1567
47 Ga0070705_100225276 3300005440 Bacteria 1301
48 Ga0070700_100006192 3300005441 Bacteria 6378
49 Ga0070700_100206715 3300005441 Bacteria 1383
50 Ga0070700_100311560 3300005441 Bacteria 1153
51 Ga0070700_100549446 3300005441 Bacteria 897
52 Ga0070694_100221425 3300005444 Bacteria 1419
53 Ga0070694_100238167 3300005444 Bacteria 1372
54 Ga0070694_100995817 3300005444 Bacteria 696
55 Ga0070708_100490447 3300005445 Bacteria 1159
56 Ga0070708_100873164 3300005445 Bacteria 845
57 Ga0070663_100134303 3300005455 Bacteria 1882
58 Ga0070678_100281709 3300005456 Bacteria 1406
59 Ga0070662_100040018 3300005457 Bacteria 3336
60 Ga0070681_10290798 3300005458 Bacteria 1544
61 Ga0070681_10744552 3300005458 Bacteria 896
62 Ga0068867_100018210 3300005459 Bacteria 4991
63 Ga0068867_100500027 3300005459 Bacteria 1045
64 Ga0068867_100781882 3300005459 Bacteria 850
65 Ga0070685_10113869 3300005466 Bacteria 1671
66 Ga0070706_100514454 3300005467 Bacteria 1113
67 Ga0070707_102209755 3300005468 Bacteria 518
68 Ga0070698_100022281 3300005471 Bacteria 6628
69 Ga0070698_100082668 3300005471 Bacteria 3203
70 Ga0070698_101420579 3300005471 Bacteria 645
71 Ga0070699_100050352 3300005518 Bacteria 3606
72 Ga0070699_100288580 3300005518 Bacteria 1471
73 Ga0070699_100617848 3300005518 Bacteria 989
74 Ga0070679_100357296 3300005530 Bacteria 1408
75 Ga0070684_100027971 3300005535 Bacteria 4765
76 Ga0070684_100138019 3300005535 Bacteria 2203
77 Ga0070684_100220013 3300005535 Bacteria 1732
78 Ga0070684_100344804 3300005535 Bacteria 1369
79 Ga0070697_100077363 3300005536 Bacteria 2736
80 Ga0070697_100234608 3300005536 Bacteria 1565
81 Ga0070697_100849142 3300005536 Bacteria 809
82 Ga0070697_101504292 3300005536 Bacteria 602
83 Ga0068853_100639430 3300005539 Bacteria 1012
84 Ga0070672_100098764 3300005543 Bacteria 2365
85 Ga0070672_100524934 3300005543 Bacteria 1026
86 Ga0070686_100004377 3300005544 Bacteria 7784
87 Ga0070686_100284456 3300005544 Bacteria 1221
88 Ga0070696_100006955 3300005546 Bacteria 7553
89 Ga0070696_100071548 3300005546 Bacteria 2441
90 Ga0070696_101011041 3300005546 Bacteria 695
91 Ga0070693_100134308 3300005547 Bacteria 1550
92 Ga0070693_101277033 3300005547 Bacteria 567
93 Ga0070665_101450863 3300005548 Bacteria 695
94 Ga0070664_100030578 3300005564 Bacteria 4493
95 Ga0070664_100420174 3300005564 Bacteria 1224
96 Ga0070664_100546479 3300005564 Bacteria 1071
97 Ga0070664_100921101 3300005564 Bacteria 820
98 Ga0068857_100027184 3300005577 Bacteria 5046
99 Ga0068857_100030217 3300005577 Bacteria 4782
100 Ga0068857_102158617 3300005577 Bacteria 547
101 Ga0068857_102331831 3300005577 Bacteria 525
102 Ga0068854_100103070 3300005578 Bacteria 2142
103 Ga0068854_100754145 3300005578 Bacteria 845
104 Ga0068856_100126000 3300005614 Bacteria 2564
105 Ga0070702_100007071 3300005615 Bacteria 5354
106 Ga0068852_100022059 3300005616 Bacteria 5097
107 Ga0068852_100774253 3300005616 Bacteria 973
108 Ga0068859_100137104 3300005617 Bacteria 2520
109 Ga0068859_102765314 3300005617 Bacteria 539
110 Ga0068864_100086000 3300005618 Bacteria 2765
111 Ga0068864_100675894 3300005618 Bacteria 1007
112 Ga0068864_102365372 3300005618 Bacteria 538
113 Ga0068866_10098729 3300005718 Bacteria 1607
114 Ga0068861_101046552 3300005719 Bacteria 782
115 Ga0068861_102040050 3300005719 Bacteria 573
116 Ga0068870_10003863 3300005840 Bacteria 6388
117 Ga0068870_10208673 3300005840 Bacteria 1188
118 Ga0068863_100723886 3300005841 Bacteria 990
119 Ga0068858_100055220 3300005842 Bacteria 3671
120 Ga0068858_100631815 3300005842 Bacteria 1040
121 Ga0068860_100004060 3300005843 Bacteria 15025
122 Ga0068860_102363218 3300005843 Bacteria 552
123 Ga0068862_100186136 3300005844 Bacteria 1866
124 Ga0081455_10004505 3300005937 Bacteria 15573
125 Ga0081455_10007154 3300005937 Bacteria 11808
126 Ga0081455_10091640 3300005937 Bacteria 2461
127 Ga0081538_10000240 3300005981 Bacteria 62124
128 Ga0081538_10002585 3300005981 Bacteria 17561
129 Ga0081538_10036113 3300005981 Bacteria 3231
130 Ga0081540_1093167 3300005983 Bacteria 1320
131 Ga0070717_10887563 3300006028 Bacteria 812
132 Ga0075365_10928082 3300006038 Bacteria 614
133 Ga0075432_10326724 3300006058 Bacteria 644
134 Ga0070716_100557134 3300006173 Bacteria 855
135 Ga0070712_100070694 3300006175 Bacteria 2495
136 Ga0070712_100363249 3300006175 Bacteria 1188
137 Ga0070712_100434365 3300006175 Bacteria 1090
138 Ga0075367_10511627 3300006178 Bacteria 762
139 Ga0097621_100087269 3300006237 Bacteria 2605
140 Ga0097621_101137549 3300006237 Bacteria 734
141 Ga0075428_100204411 3300006844 Bacteria 2135
142 Ga0075428_100469260 3300006844 Bacteria 1347
143 Ga0075428_101623726 3300006844 Bacteria 676
144 Ga0075428_101680577 3300006844 Bacteria 663
145 Ga0075428_102000985 3300006844 Bacteria 600
146 Ga0075431_100065436 3300006847 Bacteria 3754
147 Ga0075433_10253621 3300006852 Bacteria 1561
148 Ga0075433_10398127 3300006852 Bacteria 1215
149 Ga0075433_10626417 3300006852 Bacteria 944
150 Ga0075433_10739040 3300006852 Bacteria 861
151 Ga0075434_100103255 3300006871 Bacteria 2859
152 Ga0068865_100110705 3300006881 Bacteria 2026
153 Ga0068865_100390119 3300006881 Bacteria 1138
154 Ga0068865_101364949 3300006881 Bacteria 632
155 Ga0097620_100137097 3300006931 Bacteria 2520
156 Ga0097620_102765048 3300006931 Bacteria 539
157 Ga0075435_100552860 3300007076 Bacteria 997
158 Ga0111539_10002272 3300009094 Bacteria 25576
159 Ga0111539_10040587 3300009094 Bacteria 5601
160 Ga0111539_10451625 3300009094 Bacteria 1497
161 Ga0111539_10994997 3300009094 Bacteria 975
162 Ga0111539_12125552 3300009094 Bacteria 651
163 Ga0111539_12929904 3300009094 Bacteria 552
164 Ga0105245_10046707 3300009098 Bacteria 3869
165 Ga0105245_10187661 3300009098 Bacteria 1979
166 Ga0105245_10256949 3300009098 Bacteria 1699
167 Ga0105245_10912698 3300009098 Bacteria 920
168 Ga0105247_10050427 3300009101 Bacteria 2561
169 Ga0114129_10019250 3300009147 Bacteria 9724
170 Ga0114129_10083439 3300009147 Bacteria 4439
171 Ga0114129_10742920 3300009147 Bacteria 1257
172 Ga0114129_10979982 3300009147 Bacteria 1066
173 Ga0114129_11858363 3300009147 Bacteria 731
174 Ga0114129_12816128 3300009147 Bacteria 578
175 Ga0105243_10015460 3300009148 Bacteria 5767
176 Ga0105243_10438802 3300009148 Bacteria 1222
177 Ga0105243_10508009 3300009148 Bacteria 1143
178 Ga0105243_11626979 3300009148 Bacteria 673
179 Ga0105241_10094162 3300009174 Bacteria 2368
180 Ga0105242_10047340 3300009176 Bacteria 3491
181 Ga0105248_10051124 3300009177 Bacteria 4638
182 Ga0105248_11247964 3300009177 Bacteria 840
183 Ga0105248_12061870 3300009177 Bacteria 648
184 Ga0105237_11970621 3300009545 Bacteria 592
185 Ga0105238_10712162 3300009551 Bacteria 1016
186 Ga0105238_12674923 3300009551 Bacteria 535
187 Ga0105249_10006756 3300009553 Bacteria 9996
188 Ga0105249_10129149 3300009553 Bacteria 2411
189 Ga0105249_10910758 3300009553 Bacteria 946
190 Ga0105249_10991108 3300009553 Bacteria 909
191 Ga0105239_10128806 3300010375 Bacteria 2813
192 Ga0105239_13137395 3300010375 Bacteria 538
193 Ga0105246_10344307 3300011119 Bacteria 1219
194 Ga0105246_10599021 3300011119 Bacteria 952
195 Ga0105246_10758086 3300011119 Bacteria 857
196 Ga0157344_1025678 3300012476 Bacteria 536
197 Ga0157337_1000969 3300012483 Bacteria 1390
198 Ga0157315_1026828 3300012508 Bacteria 649
199 Ga0157373_11253780 3300013100 Bacteria 560
200 Ga0157373_11278433 3300013100 Bacteria 555
201 Ga0157370_11296431 3300013104 Bacteria 656
202 Ga0157370_12028227 3300013104 Bacteria 516
203 Ga0157369_10035964 3300013105 Bacteria 5428
204 Ga0157369_10583990 3300013105 Bacteria 1154
205 Ga0157374_10529927 3300013296 Bacteria 1184
206 Ga0157374_11084149 3300013296 Bacteria 821
207 Ga0157378_10003446 3300013297 Bacteria 14024
208 Ga0163162_10137854 3300013306 Bacteria 2551
209 Ga0157372_11000944 3300013307 Bacteria 968
210 Ga0157372_11303705 3300013307 Bacteria 838
211 Ga0157372_11910317 3300013307 Bacteria 682
212 Ga0157375_10013278 3300013308 Bacteria 7325
213 Ga0157375_11516010 3300013308 Bacteria 791
214 Ga0163163_10008650 3300014325 Bacteria 9054
215 Ga0163163_10786814 3300014325 Bacteria 1015
216 Ga0157380_10033356 3300014326 Bacteria 3964
217 Ga0182008_10298628 3300014497 Bacteria 842
218 Ga0157377_10007842 3300014745 Bacteria 5176
219 Ga0157377_10219495 3300014745 Bacteria 1216
220 Ga0157379_10084518 3300014968 Bacteria 2844
221 Ga0157379_10973229 3300014968 Bacteria 808
222 Ga0157376_10278680 3300014969 Bacteria 1574
223 Ga0157376_10391186 3300014969 Bacteria 1342
224 Ga0157376_10519221 3300014969 Bacteria 1174
225 Ga0182006_1053905 3300015261 Bacteria 1540
226 Ga0182006_1242283 3300015261 Bacteria 592
227 Ga0163161_10064380 3300017792 Bacteria 2674
228 Ga0206353_11559060 3300020082 Bacteria 2001
229 Ga0213873_10007348 3300021358 Bacteria 2203
230 Ga0213871_10002315 3300021441 Bacteria 3483
231 Ga0207653_10028703 3300025885 Bacteria 1790
232 Ga0207642_10032257 3300025899 Bacteria 2203
233 Ga0207710_10118324 3300025900 Bacteria 1263
234 Ga0207688_10126286 3300025901 Bacteria 1496
235 Ga0207643_10001789 3300025908 Bacteria 11965
236 Ga0207643_10688886 3300025908 Bacteria 660
237 Ga0207705_10612733 3300025909 Bacteria 847
238 Ga0207684_11147625 3300025910 Bacteria 645
239 Ga0207707_10835692 3300025912 Bacteria 765
240 Ga0207660_11030656 3300025917 Bacteria 671
241 Ga0207660_11317392 3300025917 Bacteria 586
242 Ga0207662_10000237 3300025918 Bacteria 25500
243 Ga0207649_10087818 3300025920 Bacteria 2029
244 Ga0207681_10642878 3300025923 Bacteria 879
245 Ga0207681_10904150 3300025923 Bacteria 739
246 Ga0207650_10356623 3300025925 Bacteria 1204
247 Ga0207659_10010535 3300025926 Bacteria 5812
248 Ga0207687_10027593 3300025927 Bacteria 3811
249 Ga0207687_10751710 3300025927 Bacteria 830
250 Ga0207700_10037748 3300025928 Bacteria 3501
251 Ga0207700_10103004 3300025928 Bacteria 2281
252 Ga0207664_10527829 3300025929 Bacteria 1058
253 Ga0207644_10309324 3300025931 Bacteria 1275
254 Ga0207644_10529163 3300025931 Bacteria 974
255 Ga0207690_10466257 3300025932 Bacteria 1017
256 Ga0207690_10517329 3300025932 Bacteria 967
257 Ga0207706_10032167 3300025933 Bacteria 4671
258 Ga0207686_10783383 3300025934 Bacteria 763
259 Ga0207709_10027266 3300025935 Bacteria 3289
260 Ga0207709_10865606 3300025935 Bacteria 733
261 Ga0207670_10250582 3300025936 Bacteria 1368
262 Ga0207670_10325848 3300025936 Bacteria 1210
263 Ga0207670_10867188 3300025936 Bacteria 755
264 Ga0207669_10171024 3300025937 Bacteria 1546
265 Ga0207704_10456914 3300025938 Bacteria 1020
266 Ga0207704_11669478 3300025938 Bacteria 548
267 Ga0207665_10453012 3300025939 Bacteria 985
268 Ga0207691_10012785 3300025940 Bacteria 8035
269 Ga0207711_10226028 3300025941 Bacteria 1713
270 Ga0207689_10512985 3300025942 Bacteria 1005
271 Ga0207689_10792094 3300025942 Bacteria 800
272 Ga0207661_10191482 3300025944 Bacteria 1793
273 Ga0207661_10451894 3300025944 Bacteria 1170
274 Ga0207661_12111172 3300025944 Bacteria 509
275 Ga0207679_10364574 3300025945 Bacteria 1263
276 Ga0207679_11277072 3300025945 Bacteria 674
277 Ga0207667_10769222 3300025949 Bacteria 961
278 Ga0207651_10127559 3300025960 Bacteria 1941
279 Ga0207651_10599117 3300025960 Bacteria 963
280 Ga0207712_10068519 3300025961 Bacteria 2543
281 Ga0207712_10625568 3300025961 Bacteria 933
282 Ga0207712_11051097 3300025961 Bacteria 724
283 Ga0207668_10230153 3300025972 Bacteria 1494
284 Ga0207640_10146008 3300025981 Bacteria 1731
285 Ga0207640_10931003 3300025981 Bacteria 761
286 Ga0207640_10963821 3300025981 Bacteria 748
287 Ga0207658_10429120 3300025986 Bacteria 1167
288 Ga0207703_10088091 3300026035 Bacteria 2604
289 Ga0207703_10487315 3300026035 Bacteria 1156
290 Ga0207703_11950554 3300026035 Bacteria 563
291 Ga0207639_10092058 3300026041 Bacteria 2429
292 Ga0207639_12263996 3300026041 Bacteria 505
293 Ga0207678_10015566 3300026067 Bacteria 6688
294 Ga0207708_10007304 3300026075 Bacteria 8171
295 Ga0207708_10244044 3300026075 Bacteria 1445
296 Ga0207708_10256758 3300026075 Bacteria 1410
297 Ga0207702_10058200 3300026078 Bacteria 3288
298 Ga0207641_10707988 3300026088 Bacteria 992
299 Ga0207641_11650941 3300026088 Bacteria 643
300 Ga0207648_10001684 3300026089 Bacteria 24233
301 Ga0207648_10562546 3300026089 Bacteria 1048
302 Ga0207648_11053909 3300026089 Bacteria 762
303 Ga0207676_10854240 3300026095 Bacteria 890
304 Ga0207674_10027111 3300026116 Bacteria 6069
305 Ga0207674_10032996 3300026116 Bacteria 5425
306 Ga0207675_100067548 3300026118 Bacteria 3342
307 Ga0207675_100376852 3300026118 Bacteria 1395
308 Ga0207675_100457238 3300026118 Bacteria 1266
309 Ga0207683_10052641 3300026121 Bacteria 3567
310 Ga0207698_10063639 3300026142 Bacteria 2888
311 Ga0209999_1059138 3300027543 Bacteria 728
312 Ga0210002_1106016 3300027617 Bacteria 510
313 Ga0209971_1119350 3300027682 Bacteria 648
314 Ga0209974_10037398 3300027876 Bacteria 1612
315 Ga0207428_10006328 3300027907 Bacteria 10947
316 Ga0207428_10218425 3300027907 Bacteria 1430
317 Ga0207428_10396899 3300027907 Bacteria 1010
318 Ga0268266_10256326 3300028379 Bacteria 1620
319 Ga0268265_10196532 3300028380 Bacteria 1746
320 Ga0268264_10068651 3300028381 Bacteria 2996
321 Ga0268264_12304378 3300028381 Bacteria 545
322 Ga0265338_10945442 3300028800 Bacteria 585
323 Ga0265325_10359618 3300031241 Bacteria 642
324 Ga0265327_10015346 3300031251 Bacteria 4949
325 Ga0265316_10646096 3300031344 Bacteria 748
326 Ga0307408_100060910 3300031548 Bacteria 2753
327 Ga0307408_100085518 3300031548 Bacteria 2368
328 Ga0307408_100117131 3300031548 Bacteria 2057
329 Ga0307405_10109650 3300031731 Bacteria 1867
330 Ga0307405_10143618 3300031731 Bacteria 1668
331 Ga0307413_10019744 3300031824 Bacteria 3568
332 Ga0307410_10004596 3300031852 Bacteria 7164
333 Ga0307406_10030841 3300031901 Bacteria 3259
334 Ga0307406_10404829 3300031901 Bacteria 1083
335 Ga0307407_10001098 3300031903 Bacteria 9443
336 Ga0307407_11469542 3300031903 Bacteria 538
337 Ga0307412_10065059 3300031911 Bacteria 2466
338 Ga0307412_10180365 3300031911 Bacteria 1588
339 Ga0307412_11448172 3300031911 Bacteria 623
340 Ga0307409_100013896 3300031995 Bacteria 5207
341 Ga0307416_100000904 3300032002 Bacteria 15682
342 Ga0307416_100041773 3300032002 Bacteria 3574
343 Ga0307416_100206885 3300032002 Bacteria 1867
344 Ga0307416_101027658 3300032002 Bacteria 928
345 Ga0307416_101678467 3300032002 Bacteria 740
346 Ga0307414_10039191 3300032004 Bacteria 3190
347 Ga0307411_10246349 3300032005 Bacteria 1402
348 Ga0307415_100004099 3300032126 Bacteria 7520
349 Ga0307415_100103427 3300032126 Bacteria 2095
350 Ga0373950_0164137 3300034818 Bacteria 515
351 Ga0373934_0100557 3300035086 Bacteria 1169
352 Ga0373952_0051874 3300035092 Bacteria 980
353 Ga0373941_0192595 3300035115 Bacteria 771
354 Ga0373953_0070354 3300035117 Bacteria 1443
355 Ga0373954_0040886 3300035118 Bacteria 2161
356 Ga0373960_0424203 3300035121 Bacteria 517
357 Ga0373946_0413211 3300035171 Bacteria 683
358 Ga0373955_0474584 3300035172 Bacteria 763
359 Ga0373942_0079965 3300035207 Bacteria 969
360 Ga0373961_0427376 3300035241 Bacteria 513
361 Ga0373962_0245608 3300035242 Bacteria 620
362 Ga0373924_0111660 3300035410 Bacteria 1182
363 Ga0373931_0125146 3300035691 Bacteria 1473
364 Ga0373935_0055212 3300035692 Bacteria 2531
365 Ga0373933_0215219 3300035724 Bacteria 1232
366 Ga0373937_0162707 3300036401 Bacteria 2092
367 Ga0395899_0002898 3300037312 Bacteria 13785
368 Ga0395899_0041850 3300037312 Bacteria 3421
369 Ga0395899_0124192 3300037312 Bacteria 1846
370 Ga0395899_0299025 3300037312 Bacteria 1090
371 Ga0395899_0509680 3300037312 Bacteria 779
372 Ga0395900_0038387 3300037418 Bacteria 4935
373 Ga0395900_0080879 3300037418 Bacteria 3339
374 Ga0395900_0082293 3300037418 Bacteria 3307
375 Ga0395900_0125629 3300037418 Bacteria 2631
376 Ga0395900_0126057 3300037418 Bacteria 2626
377 Ga0395900_0651759 3300037418 Bacteria 989
378 Ga0395900_0995387 3300037418 Bacteria 758
379 Ga0395900_1266213 3300037418 Bacteria 652
380 Ga0395898_0007360 3300037466 Bacteria 11686
381 Ga0395898_0020580 3300037466 Bacteria 6701
382 Ga0395898_0031910 3300037466 Bacteria 5260
383 Ga0395898_0142255 3300037466 Bacteria 2297
384 Ga0395898_0331309 3300037466 Bacteria 1451
385 Ga0395898_0439711 3300037466 Bacteria 1242
386 Ga0395898_0638129 3300037466 Bacteria 1007
387 Ga0395898_1000409 3300037466 Bacteria 772
388 Ga0395905_0039849 3300037471 Bacteria 4408
389 Ga0395905_0073515 3300037471 Bacteria 3204
390 Ga0395905_0077321 3300037471 Bacteria 3118
391 Ga0395905_0109850 3300037471 Bacteria 2589
392 Ga0395905_0152799 3300037471 Bacteria 2171
393 Ga0395905_0187841 3300037471 Bacteria 1939
394 Ga0395901_0021218 3300038443 Bacteria 6652
395 Ga0395901_0021517 3300038443 Bacteria 6608
396 Ga0395901_0060354 3300038443 Bacteria 3946
397 Ga0395901_0086522 3300038443 Bacteria 3277
398 Ga0395901_0111459 3300038443 Bacteria 2873
399 Ga0395901_0153011 3300038443 Bacteria 2423
400 Ga0395901_0410548 3300038443 Bacteria 1390
401 Ga0395901_1233502 3300038443 Bacteria 712
402 Ga0242420_000859 3300038996 Bacteria 3741
403 Ga0436365_0473746 3300039437 Bacteria 749
404 Ga0436365_0851166 3300039437 Bacteria 1412
405 Ga0436360_0095646 3300039438 Bacteria 838
406 Ga0436360_0901858 3300039438 Bacteria 4491
407 Ga0436362_0026788 3300039453 Bacteria 1012
408 Ga0436362_0141011 3300039453 Bacteria 3388
409 Ga0439439_0085607 3300041406 Bacteria 856
410 Ga0439461_0086530 3300041410 Bacteria 746
411 Ga0439461_0145975 3300041410 Bacteria 608
412 Ga0439466_0046192 3300041411 Bacteria 1439
413 Ga0439465_0140677 3300041413 Bacteria 857
414 Ga0451789_0214170 3300041443 Bacteria 923
415 Ga0439451_071014 3300042009 Bacteria 697
416 Ga0450914_001396 3300042118 Bacteria 1504
417 Ga0450917_003298 3300042120 Bacteria 1166
418 Ga0450922_022659 3300042124 Bacteria 655
419 Ga0450910_017161 3300042147 Bacteria 1076
420 Ga0439446_0033002 3300042156 Bacteria 1503
421 Ga0439434_0069991 3300042435 Bacteria 1104
422 Ga0439434_0365322 3300042435 Bacteria 505
423 Ga0439435_0087305 3300042436 Bacteria 943
424 Ga0439459_0024711 3300042438 Bacteria 1181
425 Ga0439460_0322011 3300042461 Bacteria 542
426 Ga0466966_0227600 3300044684 Bacteria 1125
427 Ga0466961_0004522 3300044693 Bacteria 8722
428 Ga0466961_0129919 3300044693 Bacteria 1579
429 Ga0466963_0045086 3300044694 Bacteria 2903
430 Ga0466963_0065430 3300044694 Bacteria 2437
431 Ga0466963_0370864 3300044694 Bacteria 1008
432 Ga0466964_0017025 3300044706 Bacteria 2780
433 Ga0466964_0098342 3300044706 Bacteria 1285
434 Ga0466971_0000971 3300044719 Bacteria 11773
435 Ga0466970_0129549 3300044765 Bacteria 1385
436 Ga0466957_0019150 3300044842 Bacteria 4025
437 Ga0466957_0183257 3300044842 Bacteria 1368
438 Ga0466959_0001767 3300045049 Bacteria 13474
439 Ga0451576_0392396 3300045051 Bacteria 1455
440 Ga0466958_0032583 3300045836 Bacteria 3101
441 Ga0466958_0033308 3300045836 Bacteria 3069
442 Ga0466967_0016795 3300045976 Bacteria 5785
443 Ga0466967_0037497 3300045976 Bacteria 4149
444 Ga0466967_0071417 3300045976 Bacteria 3108
445 Ga0466967_0082853 3300045976 Bacteria 2900
446 Ga0466967_0087550 3300045976 Bacteria 2824
447 Ga0466967_0194051 3300045976 Bacteria 1920
448 Ga0466967_0297675 3300045976 Bacteria 1551
449 Ga0466967_0856629 3300045976 Bacteria 903
450 Ga0466967_1616934 3300045976 Bacteria 645
451 Ga0495627_118966 3300046453 Bacteria 747
452 Ga0495590_0052256 3300046457 Bacteria 1428
453 Ga0495641_0494497 3300046461 Bacteria 557
454 Ga0495651_0129691 3300046462 Bacteria 1842
455 Ga0495653_0089552 3300046463 Bacteria 2254
456 Ga0495653_0400563 3300046463 Bacteria 872
457 Ga0495605_0070692 3300046474 Bacteria 1650
458 Ga0495605_0176084 3300046474 Bacteria 943
459 Ga0495662_0625522 3300046476 Bacteria 526
460 Ga0495584_0126171 3300046491 Bacteria 1297
461 Ga0495585_0321824 3300046492 Bacteria 756
462 Ga0495607_0282001 3300046501 Bacteria 788
463 Ga0495583_0433555 3300046506 Bacteria 515
464 Ga0495608_0108276 3300046511 Bacteria 1787
465 Ga0495608_0483358 3300046511 Bacteria 751
466 Ga0495618_0229320 3300046514 Bacteria 1170
467 Ga0495628_0539716 3300046516 Bacteria 838
468 Ga0495628_0809890 3300046516 Bacteria 655
469 Ga0495630_0101819 3300046517 Bacteria 2173
470 Ga0495630_0312628 3300046517 Bacteria 1201
471 Ga0495630_0700242 3300046517 Bacteria 775
472 Ga0495631_0104780 3300046518 Bacteria 1217
473 Ga0495632_0163704 3300046519 Bacteria 1024
474 Ga0495637_0103078 3300046520 Bacteria 1113
475 Ga0495637_0283653 3300046520 Bacteria 590
476 Ga0495644_0050527 3300046523 Bacteria 1561
477 Ga0495644_0162987 3300046523 Bacteria 855
478 Ga0495663_0038142 3300046525 Bacteria 1451
479 Ga0495663_0340727 3300046525 Bacteria 545
480 Ga0495642_0013358 3300046528 Bacteria 3175
481 Ga0495642_0247190 3300046528 Bacteria 780
482 Ga0495652_0159220 3300046529 Bacteria 1755
483 Ga0495652_0466651 3300046529 Bacteria 881
484 Ga0495652_0678530 3300046529 Bacteria 695
485 Ga0495640_0333906 3300046533 Bacteria 937
486 Ga0495586_0268516 3300046535 Bacteria 975
487 Ga0495598_0039477 3300046537 Bacteria 1373
488 Ga0495609_0058883 3300046538 Bacteria 1699
489 Ga0495633_0137042 3300046558 Bacteria 1132
490 Ga0495667_0016704 3300046559 Bacteria 4956
491 Ga0495667_0090217 3300046559 Bacteria 1986
492 Ga0495667_0294934 3300046559 Bacteria 1028
493 Ga0495667_0356909 3300046559 Bacteria 923
494 Ga0495667_0959836 3300046559 Bacteria 522
495 Ga0495656_0018932 3300046615 Bacteria 2651
496 Ga0495656_0139976 3300046615 Bacteria 1160
497 Ga0495656_0166621 3300046615 Bacteria 1074
498 Ga0495656_0322017 3300046615 Bacteria 796
499 Ga0495634_0159299 3300046642 Bacteria 1424
500 Ga0495634_0171225 3300046642 Bacteria 1364
501 Ga0495634_0204807 3300046642 Bacteria 1224
502 Ga0495611_0124386 3300046648 Bacteria 1203
503 Ga0495635_0181983 3300046663 Bacteria 1428
504 Ga0495635_0215938 3300046663 Bacteria 1298
505 Ga0495659_0159306 3300046664 Bacteria 910
506 Ga0495657_0040527 3300046675 Bacteria 3194
507 Ga0495657_0155565 3300046675 Bacteria 1417
508 Ga0495657_0267301 3300046675 Bacteria 1026
509 Ga0495599_0869680 3300046678 Bacteria 512
510 Ga0495623_0401753 3300046679 Bacteria 737
511 Ga0495646_0152428 3300046680 Bacteria 1285
512 Ga0495669_0131803 3300046684 Bacteria 1177
513 Ga0495669_0259092 3300046684 Bacteria 836
514 Ga0495669_0423644 3300046684 Bacteria 646
515 Ga0495613_0300497 3300046689 Bacteria 1111
516 Ga0495624_0142110 3300046690 Bacteria 1470
517 Ga0495589_0306121 3300046794 Bacteria 736
518 Ga0495600_0484756 3300046809 Bacteria 761
519 Ga0495660_0531301 3300046810 Bacteria 500
520 Ga0495604_0471009 3300047317 Bacteria 818
521 Ga0495604_0697375 3300047317 Bacteria 645
522 Ga0495604_0873870 3300047317 Bacteria 563
523 Ga0495636_0123538 3300047318 Bacteria 1147
524 Ga0495636_0131199 3300047318 Bacteria 1115
525 Ga0495676_0159844 3300047321 Bacteria 1595
526 Ga0495676_0772083 3300047321 Bacteria 620
527 Ga0495680_0002837 3300047322 Bacteria 17416
528 Ga0495680_0016214 3300047322 Bacteria 6407
529 Ga0495680_0264285 3300047322 Bacteria 1216
530 Ga0495683_0484471 3300047323 Bacteria 504
531 Ga0495687_138806 3300047443 Bacteria 849
532 Ga0495675_0296064 3300047444 Bacteria 962
533 Ga0495684_0009748 3300047471 Bacteria 7411
534 Ga0495684_0014916 3300047471 Bacteria 5985
535 Ga0495684_0845089 3300047471 Bacteria 594
536 Ga0495602_0929179 3300048088 Bacteria 577
537 Ga0496100_0074729 3300048903 Bacteria 2271
538 Ga0496100_0340760 3300048903 Bacteria 1130
539 Ga0496100_0479709 3300048903 Bacteria 956
540 Ga0496100_1329938 3300048903 Bacteria 567
541 Ga0496100_1545140 3300048903 Bacteria 524
542 Ga0496101_0104332 3300048904 Bacteria 2126
543 Ga0496101_0355964 3300048904 Bacteria 1151
544 Ga0496101_0470468 3300048904 Bacteria 992
545 Ga0496101_0554154 3300048904 Bacteria 909
546 Ga0496101_1234382 3300048904 Bacteria 585
547 Ga0496102_0201073 3300048905 Bacteria 1878
548 Ga0496104_0005098 3300048907 Bacteria 11464
549 Ga0496104_0151334 3300048907 Bacteria 2227
550 Ga0496104_0158667 3300048907 Bacteria 2170
551 Ga0496104_0188293 3300048907 Bacteria 1975
552 Ga0496104_0215908 3300048907 Bacteria 1830
553 Ga0496104_0316236 3300048907 Bacteria 1474
554 Ga0496104_0956680 3300048907 Bacteria 761
555 Ga0496105_0002794 3300048908 Bacteria 12764
556 Ga0496105_0038494 3300048908 Bacteria 3939
557 Ga0496105_0091710 3300048908 Bacteria 2509
558 Ga0496105_0307589 3300048908 Bacteria 1273
559 Ga0496105_0474474 3300048908 Bacteria 985
560 Ga0496105_0732390 3300048908 Bacteria 756
561 Ga0496105_0876647 3300048908 Bacteria 678
562 Ga0496105_1173908 3300048908 Bacteria 566
563 Ga0496106_0172803 3300048909 Bacteria 1713
564 Ga0496106_0197766 3300048909 Bacteria 1599
565 Ga0496106_0287226 3300048909 Bacteria 1318
566 Ga0496106_1148925 3300048909 Bacteria 607
567 Ga0496107_0953777 3300048910 Bacteria 624
568 Ga0496108_0020577 3300048911 Bacteria 5422
569 Ga0496108_0038707 3300048911 Bacteria 3973
570 Ga0496108_0099911 3300048911 Bacteria 2474
571 Ga0496108_0189382 3300048911 Bacteria 1783
572 Ga0496108_0244306 3300048911 Bacteria 1562
573 Ga0496108_1260722 3300048911 Bacteria 623
574 Ga0496109_0020613 3300048912 Bacteria 5823
575 Ga0496109_0043729 3300048912 Bacteria 4060
576 Ga0496109_0061457 3300048912 Bacteria 3434
577 Ga0496109_0377775 3300048912 Bacteria 1339
578 Ga0496109_0716441 3300048912 Bacteria 938
579 Ga0496109_0776217 3300048912 Bacteria 896
580 Ga0496109_2022606 3300048912 Bacteria 508
581 Ga0496110_0008791 3300048913 Bacteria 8138
582 Ga0496110_0013634 3300048913 Bacteria 6729
583 Ga0496110_0063612 3300048913 Bacteria 3260
584 Ga0496110_0438681 3300048913 Bacteria 1190
585 Ga0496110_0647550 3300048913 Bacteria 956
586 Ga0496110_0658909 3300048913 Bacteria 947
587 Ga0496111_0009841 3300048914 Bacteria 6391
588 Ga0496111_0012957 3300048914 Bacteria 5659
589 Ga0496111_0799660 3300048914 Bacteria 683
590 Ga0496111_1010368 3300048914 Bacteria 596
591 Ga0496112_0012288 3300048915 Bacteria 7863
592 Ga0496112_0361682 3300048915 Bacteria 1393
593 Ga0496112_0513699 3300048915 Bacteria 1133
594 Ga0496112_1035404 3300048915 Bacteria 740
595 Ga0496112_1586333 3300048915 Bacteria 568
596 Ga0496113_0101444 3300048916 Bacteria 2231
597 Ga0496113_0627853 3300048916 Bacteria 860
598 Ga0496114_0357020 3300048917 Bacteria 1293
599 Ga0496114_0419537 3300048917 Bacteria 1185
600 Ga0496114_1323514 3300048917 Bacteria 607
601 Ga0496115_0020286 3300048918 Bacteria 5126
602 Ga0496115_0398176 3300048918 Bacteria 1117
603 Ga0496115_0854939 3300048918 Bacteria 704
604 Ga0496115_0959933 3300048918 Bacteria 656
605 Ga0496115_1033174 3300048918 Bacteria 626
606 Ga0496126_0138835 3300048929 Bacteria 2094
607 Ga0501292_075571 3300049515 Bacteria 633
608 Ga0501293_033660 3300049516 Bacteria 558
609 Ga0501031_0457693 3300049568 Bacteria 824
610 Ga0501033_0013479 3300049570 Bacteria 6222
611 Ga0501033_1041244 3300049570 Bacteria 546
612 Ga0501036_0398146 3300049572 Bacteria 1149
613 Ga0501037_0558792 3300049573 Bacteria 772
614 Ga0501038_0127182 3300049574 Bacteria 2096
615 Ga0501039_0168589 3300049575 Bacteria 1721
616 Ga0501039_0171289 3300049575 Bacteria 1707
617 Ga0501039_1231993 3300049575 Bacteria 578
618 Ga0501040_0009322 3300049576 Bacteria 6394
619 Ga0501041_0054198 3300049577 Bacteria 2446
620 Ga0501041_0357219 3300049577 Bacteria 924
621 Ga0501042_0131267 3300049578 Bacteria 1805
622 Ga0501048_0107480 3300049582 Bacteria 1970
623 Ga0501048_0173616 3300049582 Bacteria 1527
624 Ga0501067_0000314 3300049583 Bacteria 26636
625 Ga0501068_0000349 3300049584 Bacteria 23215
626 Ga0501068_0085790 3300049584 Bacteria 1938
627 Ga0501068_1071047 3300049584 Bacteria 533
628 Ga0501069_0011099 3300049585 Bacteria 4779
629 Ga0501069_0033204 3300049585 Bacteria 2842
630 Ga0501069_0274073 3300049585 Bacteria 987
631 Ga0501070_0093602 3300049586 Bacteria 2486
632 Ga0501070_1390042 3300049586 Bacteria 534
633 Ga0501071_0004326 3300049587 Bacteria 9002
634 Ga0501071_0369168 3300049587 Bacteria 1093
635 Ga0501071_0794534 3300049587 Bacteria 729
636 Ga0501071_0979609 3300049587 Bacteria 653
637 Ga0501072_0180960 3300049588 Bacteria 1681
638 Ga0501072_0583689 3300049588 Bacteria 881
639 Ga0501072_0823885 3300049588 Bacteria 726
640 Ga0501074_0047242 3300049590 Bacteria 3112
641 Ga0501074_0203523 3300049590 Bacteria 1411
642 Ga0501075_0060033 3300049591 Bacteria 2865
643 Ga0501076_0272278 3300049592 Bacteria 1387
644 Ga0501076_1263065 3300049592 Bacteria 607
645 Ga0501076_1281209 3300049592 Bacteria 603
646 Ga0501077_0350241 3300049593 Bacteria 942
647 Ga0501208_144839 3300049655 Bacteria 537
648 Ga0501209_069816 3300049656 Bacteria 997
649 Ga0501238_070635 3300049671 Bacteria 542
650 Ga0501221_148890 3300049704 Bacteria 619
651 Ga0501234_079181 3300049707 Bacteria 577
652 Ga0501079_0073479 3300049741 Bacteria 2643
653 Ga0501079_0349213 3300049741 Bacteria 1159
654 Ga0501079_0465129 3300049741 Bacteria 993
655 Ga0501079_0530085 3300049741 Bacteria 926
656 Ga0501079_0879897 3300049741 Bacteria 705
657 Ga0501079_1347081 3300049741 Bacteria 562
658 Ga0501080_1834738 3300049742 Bacteria 509
659 Ga0501081_0015047 3300049743 Bacteria 5105
660 Ga0501271_021714 3300049768 Bacteria 748
661 Ga0501275_094447 3300049772 Bacteria 501
662 Ga0501035_0630813 3300049822 Bacteria 871
663 Ga0501035_1087289 3300049822 Bacteria 625
664 Ga0501045_1304043 3300049824 Bacteria 528
665 nmdc:mga05p37_26949_c1 3300050507 Bacteria 6992
666 nmdc:mga05p37_451163_c1 3300050507 Bacteria 1488
667 nmdc:mga05p37_550876_c1 3300050507 Bacteria 1313
668 nmdc:mga05p37_970578_c1 3300050507 Bacteria 907
669 nmdc:mga08y16_1866217_c1 3300050511 Bacteria 553
670 nmdc:mga08y16_413865_c1 3300050511 Bacteria 1378
671 nmdc:mga08y16_58291_c1 3300050511 Bacteria 4035
672 nmdc:mga08y16_619910_c1 3300050511 Bacteria 1089
673 nmdc:mga08y16_78142_c1 3300050511 Bacteria 3450
674 nmdc:mga0n895_153171_c1 3300050512 Bacteria 2336
675 nmdc:mga0n895_1644697_c1 3300050512 Bacteria 606
676 nmdc:mga0rr50_751231_c1 3300050513 Bacteria 832
677 nmdc:mga0a205_173064_c1 3300050515 Bacteria 2055
678 nmdc:mga0a205_400278_c1 3300050515 Bacteria 1237
679 Ga0495601_0147141 3300053077 Bacteria 1538
680 Ga0495601_0378310 3300053077 Bacteria 919
681 Ga0495601_0764565 3300053077 Bacteria 614
682 Ga0495601_0791411 3300053077 Bacteria 602
683 Ga0495655_0208215 3300053083 Bacteria 642
684 Ga0495595_0003079 3300053084 Bacteria 6595
685 Ga0495595_0008224 3300053084 Bacteria 4283
686 Ga0495619_0070819 3300053085 Bacteria 2332
687 Ga0495619_0160628 3300053085 Bacteria 1552
688 Ga0495619_0371901 3300053085 Bacteria 988
689 Ga0495619_0878549 3300053085 Bacteria 604
690 Ga0501084_0024306 3300054114 Bacteria 5053
691 Ga0501084_0211544 3300054114 Bacteria 1636
692 Ga0501084_1159531 3300054114 Bacteria 648
693 Ga0587070_133554 3300059491 Bacteria 606
694 Ga0587082_060835 3300059504 Bacteria 744
695 Ga0587089_103707 3300059509 Bacteria 518
696 Ga0587062_096861 3300059639 Bacteria 569
697 Ga0587062_126594 3300059639 Bacteria 521
698 Ga0587076_080924 3300059645 Bacteria 693
699 Ga0501082_0533166 3300060353 Bacteria 1026
700 Ga0501082_0833087 3300060353 Bacteria 807
701 Ga0501082_1097232 3300060353 Bacteria 696
702 Ga0466962_0001733 3300061719 Bacteria 10253
703 Ga0530510_0034859 3300061734 Bacteria 3626
704 Ga0530510_0111190 3300061734 Bacteria 2007
705 Ga0530510_0190060 3300061734 Bacteria 1524
706 Ga0530510_0191777 3300061734 Bacteria 1517

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0369168 Ga0501071_0369168_13_258 63
2 3300049587 Ga0501071_0004326 Ga0501071_0004326_8711_8992 65
3 3300044765 Ga0466970_0129549 Ga0466970_0129549_1099_1368 67
4 3300037312 Ga0395899_0299025 Ga0395899_0299025_458_742 70
5 3300037418 Ga0395900_0995387 Ga0395900_0995387_291_575 70
6 3300037466 Ga0395898_0142255 Ga0395898_0142255_1478_1762 70
7 3300038443 Ga0395901_0410548 Ga0395901_0410548_674_958 70
8 3300005355 Ga0070671_101763731 Ga0070671_1017637312 71
9 3300005439 Ga0070711_100263708 Ga0070711_1002637082 71
10 3300005530 Ga0070679_100357296 Ga0070679_1003572962 71
11 3300005535 Ga0070684_100220013 Ga0070684_1002200134 71
12 3300005564 Ga0070664_100546479 Ga0070664_1005464792 71
13 3300005614 Ga0068856_100126000 Ga0068856_1001260003 71
14 3300005616 Ga0068852_100774253 Ga0068852_1007742532 71
15 3300006173 Ga0070716_100557134 Ga0070716_1005571342 71
16 3300006175 Ga0070712_100070694 Ga0070712_1000706944 71
17 3300006237 Ga0097621_100087269 Ga0097621_1000872692 71
18 3300009174 Ga0105241_10094162 Ga0105241_100941625 71
19 3300013307 Ga0157372_11910317 Ga0157372_119103171 71
20 3300014969 Ga0157376_10519221 Ga0157376_105192212 71
21 3300025929 Ga0207664_10527829 Ga0207664_105278293 71
22 3300025936 Ga0207670_10867188 Ga0207670_108671883 71
23 3300025939 Ga0207665_10453012 Ga0207665_104530122 71
24 3300026078 Ga0207702_10058200 Ga0207702_100582003 71
25 3300026121 Ga0207683_10052641 Ga0207683_100526414 71
26 3300048903 Ga0496100_0479709 Ga0496100_0479709_80_367 71
27 3300048903 Ga0496100_1329938 Ga0496100_1329938_196_474 71
28 3300048904 Ga0496101_1234382 Ga0496101_1234382_104_400 71
29 3300048909 Ga0496106_0197766 Ga0496106_0197766_683_970 71
30 3300048911 Ga0496108_0189382 Ga0496108_0189382_256_552 71
31 3300048912 Ga0496109_0377775 Ga0496109_0377775_465_761 71
32 3300048913 Ga0496110_0013634 Ga0496110_0013634_2208_2486 71
33 3300048914 Ga0496111_1010368 Ga0496111_1010368_234_530 71
34 3300048915 Ga0496112_1035404 Ga0496112_1035404_173_469 71
35 3300049583 Ga0501067_0000314 Ga0501067_0000314_23803_24090 71
36 3300049584 Ga0501068_0000349 Ga0501068_0000349_11245_11532 71
37 3300049585 Ga0501069_0011099 Ga0501069_0011099_2562_2849 71
38 3300049586 Ga0501070_0093602 Ga0501070_0093602_267_554 71
39 3300061734 Ga0530510_0034859 Ga0530510_0034859_2120_2407 71
40 3300005336 Ga0070680_101197889 Ga0070680_1011978892 72
41 3300020082 Ga0206353_11559060 Ga0206353_115590602 72
42 3300025917 Ga0207660_11030656 Ga0207660_110306562 72
43 3300026041 Ga0207639_12263996 Ga0207639_122639962 72
44 3300028800 Ga0265338_10945442 Ga0265338_109454421 72
45 3300031241 Ga0265325_10359618 Ga0265325_103596182 72
46 3300037312 Ga0395899_0041850 Ga0395899_0041850_1486_1794 72
47 3300037418 Ga0395900_0038387 Ga0395900_0038387_2616_2924 72
48 3300037466 Ga0395898_0020580 Ga0395898_0020580_3778_4086 72
49 3300037471 Ga0395905_0039849 Ga0395905_0039849_2837_3145 72
50 3300038443 Ga0395901_0021218 Ga0395901_0021218_2616_2924 72
51 3300039453 Ga0436362_0026788 Ga0436362_0026788_501_785 72
52 3300048918 Ga0496115_1033174 Ga0496115_1033174_264_566 72
53 3300048929 Ga0496126_0138835 Ga0496126_0138835_1550_1852 72
54 3300006058 Ga0075432_10326724 Ga0075432_103267242 73
55 3300006852 Ga0075433_10398127 Ga0075433_103981273 73
56 3300009094 Ga0111539_10040587 Ga0111539_100405873 73
57 3300009177 Ga0105248_11247964 Ga0105248_112479642 73
58 3300009551 Ga0105238_10712162 Ga0105238_107121621 73
59 3300032002 Ga0307416_101027658 Ga0307416_1010276582 73
60 3300048907 Ga0496104_0188293 Ga0496104_0188293_304_615 73
61 3300048908 Ga0496105_0307589 Ga0496105_0307589_437_748 73
62 3300048913 Ga0496110_0658909 Ga0496110_0658909_131_427 73
63 3300048917 Ga0496114_0357020 Ga0496114_0357020_947_1258 73
64 3300048918 Ga0496115_0854939 Ga0496115_0854939_78_389 73
65 3300050511 nmdc:mga08y16_619910_c1 nmdc:mga08y16_619910_c1_158_463 73
66 3300050515 nmdc:mga0a205_400278_c1 nmdc:mga0a205_400278_c1_515_820 73
67 3300003373 JGI25407J50210_10009553 JGI25407J50210_100095532 74
68 3300003373 JGI25407J50210_10105274 JGI25407J50210_101052742 74
69 3300005471 Ga0070698_101420579 Ga0070698_1014205791 74
70 3300005981 Ga0081538_10000240 Ga0081538_1000024061 74
71 3300005981 Ga0081538_10002585 Ga0081538_100025859 74
72 3300006852 Ga0075433_10739040 Ga0075433_107390402 74
73 3300007076 Ga0075435_100552860 Ga0075435_1005528602 74
74 3300009147 Ga0114129_10979982 Ga0114129_109799822 74
75 3300013104 Ga0157370_12028227 Ga0157370_120282271 74
76 3300021358 Ga0213873_10007348 Ga0213873_100073483 74
77 3300021441 Ga0213871_10002315 Ga0213871_100023155 74
78 3300025928 Ga0207700_10103004 Ga0207700_101030041 74
79 3300039438 Ga0436360_0901858 Ga0436360_0901858_2134_2439 74
80 3300039453 Ga0436362_0141011 Ga0436362_0141011_2982_3287 74
81 3300044694 Ga0466963_0065430 Ga0466963_0065430_824_1117 74
82 3300044706 Ga0466964_0017025 Ga0466964_0017025_1159_1452 74
83 3300044842 Ga0466957_0019150 Ga0466957_0019150_3297_3590 74
84 3300045836 Ga0466958_0032583 Ga0466958_0032583_536_829 74
85 3300045976 Ga0466967_0037497 Ga0466967_0037497_3416_3709 74
86 3300048915 Ga0496112_0361682 Ga0496112_0361682_800_1093 74
87 3300050513 nmdc:mga0rr50_751231_c1 nmdc:mga0rr50_751231_c1_341_643 74
88 3300005719 Ga0068861_102040050 Ga0068861_1020400501 75
89 3300005937 Ga0081455_10004505 Ga0081455_100045058 75
90 3300005981 Ga0081538_10036113 Ga0081538_100361136 75
91 3300009094 Ga0111539_10002272 Ga0111539_100022725 75
92 3300009094 Ga0111539_12125552 Ga0111539_121255522 75
93 3300009147 Ga0114129_10742920 Ga0114129_107429203 75
94 3300013100 Ga0157373_11278433 Ga0157373_112784332 75
95 3300013296 Ga0157374_11084149 Ga0157374_110841492 75
96 3300027907 Ga0207428_10006328 Ga0207428_100063286 75
97 3300031344 Ga0265316_10646096 Ga0265316_106460962 75
98 3300031548 Ga0307408_100085518 Ga0307408_1000855184 75
99 3300031548 Ga0307408_100117131 Ga0307408_1001171313 75
100 3300031731 Ga0307405_10109650 Ga0307405_101096503 75
101 3300031824 Ga0307413_10019744 Ga0307413_100197445 75
102 3300031852 Ga0307410_10004596 Ga0307410_100045967 75
103 3300031901 Ga0307406_10030841 Ga0307406_100308413 75
104 3300031903 Ga0307407_10001098 Ga0307407_100010984 75
105 3300031911 Ga0307412_10065059 Ga0307412_100650594 75
106 3300031995 Ga0307409_100013896 Ga0307409_1000138965 75
107 3300032002 Ga0307416_100041773 Ga0307416_1000417733 75
108 3300032002 Ga0307416_100206885 Ga0307416_1002068854 75
109 3300032002 Ga0307416_101678467 Ga0307416_1016784672 75
110 3300032004 Ga0307414_10039191 Ga0307414_100391915 75
111 3300032005 Ga0307411_10246349 Ga0307411_102463493 75
112 3300032126 Ga0307415_100103427 Ga0307415_1001034273 75
113 3300034818 Ga0373950_0164137 Ga0373950_0164137_130_441 75
114 3300039438 Ga0436360_0095646 Ga0436360_0095646_135_428 75
115 3300041406 Ga0439439_0085607 Ga0439439_0085607_148_459 75
116 3300041410 Ga0439461_0086530 Ga0439461_0086530_66_377 75
117 3300041413 Ga0439465_0140677 Ga0439465_0140677_429_740 75
118 3300042435 Ga0439434_0069991 Ga0439434_0069991_155_466 75
119 3300045976 Ga0466967_0856629 Ga0466967_0856629_41_334 75
120 3300046453 Ga0495627_118966 Ga0495627_118966_172_483 75
121 3300046457 Ga0495590_0052256 Ga0495590_0052256_819_1130 75
122 3300046474 Ga0495605_0070692 Ga0495605_0070692_275_586 75
123 3300046491 Ga0495584_0126171 Ga0495584_0126171_378_689 75
124 3300046492 Ga0495585_0321824 Ga0495585_0321824_338_649 75
125 3300046506 Ga0495583_0433555 Ga0495583_0433555_118_429 75
126 3300046518 Ga0495631_0104780 Ga0495631_0104780_316_627 75
127 3300046519 Ga0495632_0163704 Ga0495632_0163704_173_484 75
128 3300046520 Ga0495637_0283653 Ga0495637_0283653_55_366 75
129 3300046528 Ga0495642_0013358 Ga0495642_0013358_44_355 75
130 3300046537 Ga0495598_0039477 Ga0495598_0039477_236_547 75
131 3300046538 Ga0495609_0058883 Ga0495609_0058883_129_440 75
132 3300046558 Ga0495633_0137042 Ga0495633_0137042_343_654 75
133 3300046615 Ga0495656_0322017 Ga0495656_0322017_193_504 75
134 3300046664 Ga0495659_0159306 Ga0495659_0159306_401_712 75
135 3300046684 Ga0495669_0131803 Ga0495669_0131803_103_414 75
136 3300046810 Ga0495660_0531301 Ga0495660_0531301_144_455 75
137 3300047318 Ga0495636_0131199 Ga0495636_0131199_214_525 75
138 3300049515 Ga0501292_075571 Ga0501292_075571_212_523 75
139 3300049516 Ga0501293_033660 Ga0501293_033660_61_372 75
140 3300049574 Ga0501038_0127182 Ga0501038_0127182_1602_1913 75
141 3300049575 Ga0501039_0168589 Ga0501039_0168589_1253_1564 75
142 3300049576 Ga0501040_0009322 Ga0501040_0009322_1894_2205 75
143 3300049577 Ga0501041_0054198 Ga0501041_0054198_257_568 75
144 3300049578 Ga0501042_0131267 Ga0501042_0131267_236_547 75
145 3300049582 Ga0501048_0173616 Ga0501048_0173616_955_1266 75
146 3300049588 Ga0501072_0180960 Ga0501072_0180960_1324_1635 75
147 3300049590 Ga0501074_0047242 Ga0501074_0047242_218_529 75
148 3300049590 Ga0501074_0203523 Ga0501074_0203523_381_692 75
149 3300049591 Ga0501075_0060033 Ga0501075_0060033_1454_1765 75
150 3300049592 Ga0501076_0272278 Ga0501076_0272278_851_1153 75
151 3300049592 Ga0501076_1263065 Ga0501076_1263065_15_317 75
152 3300049592 Ga0501076_1281209 Ga0501076_1281209_139_450 75
153 3300049655 Ga0501208_144839 Ga0501208_144839_109_420 75
154 3300049656 Ga0501209_069816 Ga0501209_069816_551_862 75
155 3300049671 Ga0501238_070635 Ga0501238_070635_42_353 75
156 3300049704 Ga0501221_148890 Ga0501221_148890_58_369 75
157 3300049707 Ga0501234_079181 Ga0501234_079181_210_521 75
158 3300049741 Ga0501079_0465129 Ga0501079_0465129_80_391 75
159 3300049743 Ga0501081_0015047 Ga0501081_0015047_1777_2088 75
160 3300050507 nmdc:mga05p37_970578_c1 nmdc:mga05p37_970578_c1_347_658 75
161 3300050511 nmdc:mga08y16_58291_c1 nmdc:mga08y16_58291_c1_2803_3114 75
162 3300053083 Ga0495655_0208215 Ga0495655_0208215_169_480 75
163 3300054114 Ga0501084_0024306 Ga0501084_0024306_2828_3139 75
164 3300054114 Ga0501084_1159531 Ga0501084_1159531_30_332 75
165 3300060353 Ga0501082_0533166 Ga0501082_0533166_103_414 75
166 3300005337 Ga0070682_100090423 Ga0070682_1000904231 76
167 3300005535 Ga0070684_100344804 Ga0070684_1003448043 76
168 3300005841 Ga0068863_100723886 Ga0068863_1007238862 76
169 3300006237 Ga0097621_101137549 Ga0097621_1011375492 76
170 3300009098 Ga0105245_10912698 Ga0105245_109126982 76
171 3300009177 Ga0105248_12061870 Ga0105248_120618702 76
172 3300013104 Ga0157370_11296431 Ga0157370_112964312 76
173 3300013105 Ga0157369_10035964 Ga0157369_100359644 76
174 3300013307 Ga0157372_11000944 Ga0157372_110009443 76
175 3300014969 Ga0157376_10278680 Ga0157376_102786802 76
176 3300025927 Ga0207687_10751710 Ga0207687_107517102 76
177 3300026035 Ga0207703_11950554 Ga0207703_119505542 76
178 3300026088 Ga0207641_10707988 Ga0207641_107079882 76
179 3300028381 Ga0268264_12304378 Ga0268264_123043782 76
180 3300035172 Ga0373955_0474584 Ga0373955_0474584_261_566 76
181 3300042124 Ga0450922_022659 Ga0450922_022659_80_385 76
182 3300046461 Ga0495641_0494497 Ga0495641_0494497_230_535 76
183 3300046535 Ga0495586_0268516 Ga0495586_0268516_106_411 76
184 3300046559 Ga0495667_0959836 Ga0495667_0959836_35_340 76
185 3300047321 Ga0495676_0159844 Ga0495676_0159844_689_994 76
186 3300048903 Ga0496100_1545140 Ga0496100_1545140_200_505 76
187 3300048904 Ga0496101_0554154 Ga0496101_0554154_223_528 76
188 3300048909 Ga0496106_1148925 Ga0496106_1148925_185_490 76
189 3300048917 Ga0496114_1323514 Ga0496114_1323514_10_315 76
190 3300031903 Ga0307407_11469542 Ga0307407_114695422 77
191 3300031911 Ga0307412_11448172 Ga0307412_114481722 77
192 3300042461 Ga0439460_0322011 Ga0439460_0322011_181_486 77
193 3300044706 Ga0466964_0098342 Ga0466964_0098342_607_912 77
194 3300045976 Ga0466967_0297675 Ga0466967_0297675_502_807 77
195 3300049585 Ga0501069_0274073 Ga0501069_0274073_469_780 77
196 3300005366 Ga0070659_100579322 Ga0070659_1005793221 78
197 3300005536 Ga0070697_101504292 Ga0070697_1015042922 78
198 3300005546 Ga0070696_100071548 Ga0070696_1000715483 78
199 3300006175 Ga0070712_100434365 Ga0070712_1004343652 78
200 3300006178 Ga0075367_10511627 Ga0075367_105116272 78
201 3300009148 Ga0105243_11626979 Ga0105243_116269792 78
202 3300009545 Ga0105237_11970621 Ga0105237_119706211 78
203 3300014497 Ga0182008_10298628 Ga0182008_102986282 78
204 3300015261 Ga0182006_1242283 Ga0182006_12422832 78
205 3300025928 Ga0207700_10037748 Ga0207700_100377483 78
206 3300025932 Ga0207690_10517329 Ga0207690_105173291 78
207 3300035692 Ga0373935_0055212 Ga0373935_0055212_113_418 78
208 3300037466 Ga0395898_1000409 Ga0395898_1000409_353_658 78
209 3300038443 Ga0395901_1233502 Ga0395901_1233502_90_395 78
210 3300044693 Ga0466961_0129919 Ga0466961_0129919_805_1110 78
211 3300044694 Ga0466963_0045086 Ga0466963_0045086_1561_1866 78
212 3300044694 Ga0466963_0370864 Ga0466963_0370864_160_465 78
213 3300044719 Ga0466971_0000971 Ga0466971_0000971_462_767 78
214 3300044842 Ga0466957_0183257 Ga0466957_0183257_860_1165 78
215 3300045836 Ga0466958_0033308 Ga0466958_0033308_1691_1996 78
216 3300045976 Ga0466967_0016795 Ga0466967_0016795_4945_5250 78
217 3300045976 Ga0466967_0071417 Ga0466967_0071417_1863_2168 78
218 3300045976 Ga0466967_0087550 Ga0466967_0087550_1154_1459 78
219 3300045976 Ga0466967_0194051 Ga0466967_0194051_1190_1495 78
220 3300045976 Ga0466967_1616934 Ga0466967_1616934_328_633 78
221 3300046463 Ga0495653_0089552 Ga0495653_0089552_52_357 78
222 3300046511 Ga0495608_0108276 Ga0495608_0108276_852_1157 78
223 3300046517 Ga0495630_0312628 Ga0495630_0312628_628_933 78
224 3300046525 Ga0495663_0038142 Ga0495663_0038142_738_1043 78
225 3300046559 Ga0495667_0090217 Ga0495667_0090217_1403_1708 78
226 3300046642 Ga0495634_0159299 Ga0495634_0159299_960_1265 78
227 3300046663 Ga0495635_0215938 Ga0495635_0215938_198_503 78
228 3300046675 Ga0495657_0040527 Ga0495657_0040527_2834_3139 78
229 3300046809 Ga0495600_0484756 Ga0495600_0484756_445_750 78
230 3300047322 Ga0495680_0264285 Ga0495680_0264285_887_1192 78
231 3300047471 Ga0495684_0009748 Ga0495684_0009748_1230_1535 78
232 3300048907 Ga0496104_0005098 Ga0496104_0005098_10919_11224 78
233 3300048907 Ga0496104_0316236 Ga0496104_0316236_258_563 78
234 3300048907 Ga0496104_0956680 Ga0496104_0956680_18_323 78
235 3300048908 Ga0496105_0002794 Ga0496105_0002794_2307_2612 78
236 3300048908 Ga0496105_0732390 Ga0496105_0732390_330_635 78
237 3300048911 Ga0496108_0244306 Ga0496108_0244306_1206_1511 78
238 3300048912 Ga0496109_0061457 Ga0496109_0061457_1369_1674 78
239 3300048913 Ga0496110_0647550 Ga0496110_0647550_424_729 78
240 3300048918 Ga0496115_0020286 Ga0496115_0020286_3039_3344 78
241 3300048918 Ga0496115_0398176 Ga0496115_0398176_116_421 78
242 3300049824 Ga0501045_1304043 Ga0501045_1304043_101_406 78
243 3300053077 Ga0495601_0791411 Ga0495601_0791411_121_426 78
244 3300053084 Ga0495595_0003079 Ga0495595_0003079_684_989 78
245 3300053085 Ga0495619_0070819 Ga0495619_0070819_432_737 78
246 3300059491 Ga0587070_133554 Ga0587070_133554_133_438 78
247 3300059639 Ga0587062_096861 Ga0587062_096861_194_499 78
248 3300061719 Ga0466962_0001733 Ga0466962_0001733_1688_1993 78
249 3300061734 Ga0530510_0111190 Ga0530510_0111190_216_521 78
250 3300005329 Ga0070683_100278649 Ga0070683_1002786493 79
251 3300005329 Ga0070683_100484079 Ga0070683_1004840792 79
252 3300005347 Ga0070668_100734602 Ga0070668_1007346023 79
253 3300005355 Ga0070671_100565092 Ga0070671_1005650923 79
254 3300005459 Ga0068867_100500027 Ga0068867_1005000272 79
255 3300005459 Ga0068867_100781882 Ga0068867_1007818823 79
256 3300005468 Ga0070707_102209755 Ga0070707_1022097552 79
257 3300005471 Ga0070698_100082668 Ga0070698_1000826684 79
258 3300005518 Ga0070699_100050352 Ga0070699_1000503526 79
259 3300005535 Ga0070684_100027971 Ga0070684_1000279714 79
260 3300005564 Ga0070664_100420174 Ga0070664_1004201743 79
261 3300005577 Ga0068857_100030217 Ga0068857_1000302174 79
262 3300005577 Ga0068857_102158617 Ga0068857_1021586172 79
263 3300005937 Ga0081455_10007154 Ga0081455_1000715414 79
264 3300005937 Ga0081455_10091640 Ga0081455_100916404 79
265 3300005983 Ga0081540_1093167 Ga0081540_10931671 79
266 3300006028 Ga0070717_10887563 Ga0070717_108875632 79
267 3300006175 Ga0070712_100363249 Ga0070712_1003632492 79
268 3300006852 Ga0075433_10253621 Ga0075433_102536212 79
269 3300006871 Ga0075434_100103255 Ga0075434_1001032555 79
270 3300006881 Ga0068865_101364949 Ga0068865_1013649491 79
271 3300009094 Ga0111539_10994997 Ga0111539_109949972 79
272 3300009094 Ga0111539_12929904 Ga0111539_129299041 79
273 3300009098 Ga0105245_10187661 Ga0105245_101876612 79
274 3300009147 Ga0114129_10019250 Ga0114129_100192505 79
275 3300009147 Ga0114129_12816128 Ga0114129_128161282 79
276 3300009148 Ga0105243_10438802 Ga0105243_104388023 79
277 3300009148 Ga0105243_10508009 Ga0105243_105080092 79
278 3300009553 Ga0105249_10129149 Ga0105249_101291495 79
279 3300011119 Ga0105246_10758086 Ga0105246_107580862 79
280 3300012476 Ga0157344_1025678 Ga0157344_10256782 79
281 3300012483 Ga0157337_1000969 Ga0157337_10009693 79
282 3300012508 Ga0157315_1026828 Ga0157315_10268281 79
283 3300013105 Ga0157369_10583990 Ga0157369_105839903 79
284 3300013296 Ga0157374_10529927 Ga0157374_105299274 79
285 3300014969 Ga0157376_10391186 Ga0157376_103911863 79
286 3300015261 Ga0182006_1053905 Ga0182006_10539054 79
287 3300025931 Ga0207644_10309324 Ga0207644_103093241 79
288 3300025935 Ga0207709_10865606 Ga0207709_108656062 79
289 3300025941 Ga0207711_10226028 Ga0207711_102260283 79
290 3300025942 Ga0207689_10792094 Ga0207689_107920941 79
291 3300025944 Ga0207661_10191482 Ga0207661_101914823 79
292 3300025944 Ga0207661_12111172 Ga0207661_121111721 79
293 3300025945 Ga0207679_10364574 Ga0207679_103645742 79
294 3300025949 Ga0207667_10769222 Ga0207667_107692221 79
295 3300025960 Ga0207651_10599117 Ga0207651_105991172 79
296 3300025981 Ga0207640_10931003 Ga0207640_109310032 79
297 3300025981 Ga0207640_10963821 Ga0207640_109638212 79
298 3300026089 Ga0207648_10562546 Ga0207648_105625463 79
299 3300026116 Ga0207674_10032996 Ga0207674_100329962 79
300 3300027907 Ga0207428_10396899 Ga0207428_103968993 79
301 3300031251 Ga0265327_10015346 Ga0265327_100153464 79
302 3300035086 Ga0373934_0100557 Ga0373934_0100557_582_887 79
303 3300035117 Ga0373953_0070354 Ga0373953_0070354_313_618 79
304 3300035118 Ga0373954_0040886 Ga0373954_0040886_703_1008 79
305 3300035410 Ga0373924_0111660 Ga0373924_0111660_429_734 79
306 3300035724 Ga0373933_0215219 Ga0373933_0215219_490_837 79
307 3300036401 Ga0373937_0162707 Ga0373937_0162707_1625_1930 79
308 3300037312 Ga0395899_0002898 Ga0395899_0002898_2149_2454 79
309 3300037312 Ga0395899_0124192 Ga0395899_0124192_1329_1634 79
310 3300037312 Ga0395899_0509680 Ga0395899_0509680_377_682 79
311 3300037418 Ga0395900_0080879 Ga0395900_0080879_1054_1359 79
312 3300037418 Ga0395900_0082293 Ga0395900_0082293_2556_2861 79
313 3300037418 Ga0395900_0125629 Ga0395900_0125629_1503_1808 79
314 3300037418 Ga0395900_0126057 Ga0395900_0126057_2005_2310 79
315 3300037418 Ga0395900_0651759 Ga0395900_0651759_24_329 79
316 3300037466 Ga0395898_0007360 Ga0395898_0007360_629_934 79
317 3300037466 Ga0395898_0031910 Ga0395898_0031910_685_990 79
318 3300037466 Ga0395898_0331309 Ga0395898_0331309_1079_1384 79
319 3300037466 Ga0395898_0439711 Ga0395898_0439711_810_1115 79
320 3300037466 Ga0395898_0638129 Ga0395898_0638129_128_433 79
321 3300037471 Ga0395905_0073515 Ga0395905_0073515_565_870 79
322 3300037471 Ga0395905_0077321 Ga0395905_0077321_552_857 79
323 3300037471 Ga0395905_0109850 Ga0395905_0109850_2262_2567 79
324 3300037471 Ga0395905_0152799 Ga0395905_0152799_706_1011 79
325 3300037471 Ga0395905_0187841 Ga0395905_0187841_1481_1786 79
326 3300038443 Ga0395901_0021517 Ga0395901_0021517_565_870 79
327 3300038443 Ga0395901_0060354 Ga0395901_0060354_954_1259 79
328 3300038443 Ga0395901_0086522 Ga0395901_0086522_1722_2027 79
329 3300038443 Ga0395901_0111459 Ga0395901_0111459_911_1216 79
330 3300038443 Ga0395901_0153011 Ga0395901_0153011_1030_1335 79
331 3300038996 Ga0242420_000859 Ga0242420_000859_2075_2380 79
332 3300039437 Ga0436365_0473746 Ga0436365_0473746_323_628 79
333 3300039437 Ga0436365_0851166 Ga0436365_0851166_847_1152 79
334 3300041410 Ga0439461_0145975 Ga0439461_0145975_72_383 79
335 3300041411 Ga0439466_0046192 Ga0439466_0046192_964_1275 79
336 3300041443 Ga0451789_0214170 Ga0451789_0214170_320_625 79
337 3300042009 Ga0439451_071014 Ga0439451_071014_129_440 79
338 3300042118 Ga0450914_001396 Ga0450914_001396_71_382 79
339 3300042120 Ga0450917_003298 Ga0450917_003298_375_686 79
340 3300042147 Ga0450910_017161 Ga0450910_017161_613_924 79
341 3300042156 Ga0439446_0033002 Ga0439446_0033002_402_713 79
342 3300042436 Ga0439435_0087305 Ga0439435_0087305_51_362 79
343 3300042438 Ga0439459_0024711 Ga0439459_0024711_544_855 79
344 3300044684 Ga0466966_0227600 Ga0466966_0227600_289_594 79
345 3300044693 Ga0466961_0004522 Ga0466961_0004522_756_1061 79
346 3300045049 Ga0466959_0001767 Ga0466959_0001767_12290_12595 79
347 3300045051 Ga0451576_0392396 Ga0451576_0392396_955_1260 79
348 3300045976 Ga0466967_0082853 Ga0466967_0082853_2285_2590 79
349 3300046462 Ga0495651_0129691 Ga0495651_0129691_46_351 79
350 3300046463 Ga0495653_0400563 Ga0495653_0400563_63_368 79
351 3300046474 Ga0495605_0176084 Ga0495605_0176084_251_556 79
352 3300046501 Ga0495607_0282001 Ga0495607_0282001_84_398 79
353 3300046511 Ga0495608_0483358 Ga0495608_0483358_299_604 79
354 3300046514 Ga0495618_0229320 Ga0495618_0229320_591_896 79
355 3300046516 Ga0495628_0539716 Ga0495628_0539716_72_377 79
356 3300046516 Ga0495628_0809890 Ga0495628_0809890_263_568 79
357 3300046517 Ga0495630_0101819 Ga0495630_0101819_1528_1833 79
358 3300046520 Ga0495637_0103078 Ga0495637_0103078_559_867 79
359 3300046523 Ga0495644_0050527 Ga0495644_0050527_673_981 79
360 3300046523 Ga0495644_0162987 Ga0495644_0162987_170_484 79
361 3300046525 Ga0495663_0340727 Ga0495663_0340727_180_488 79
362 3300046528 Ga0495642_0247190 Ga0495642_0247190_317_625 79
363 3300046529 Ga0495652_0159220 Ga0495652_0159220_1203_1508 79
364 3300046529 Ga0495652_0466651 Ga0495652_0466651_565_870 79
365 3300046529 Ga0495652_0678530 Ga0495652_0678530_301_606 79
366 3300046533 Ga0495640_0333906 Ga0495640_0333906_259_564 79
367 3300046559 Ga0495667_0016704 Ga0495667_0016704_1942_2247 79
368 3300046559 Ga0495667_0294934 Ga0495667_0294934_431_742 79
369 3300046559 Ga0495667_0356909 Ga0495667_0356909_539_844 79
370 3300046615 Ga0495656_0018932 Ga0495656_0018932_461_769 79
371 3300046615 Ga0495656_0139976 Ga0495656_0139976_534_839 79
372 3300046615 Ga0495656_0166621 Ga0495656_0166621_263_568 79
373 3300046642 Ga0495634_0171225 Ga0495634_0171225_1008_1313 79
374 3300046642 Ga0495634_0204807 Ga0495634_0204807_526_831 79
375 3300046648 Ga0495611_0124386 Ga0495611_0124386_468_776 79
376 3300046663 Ga0495635_0181983 Ga0495635_0181983_453_758 79
377 3300046675 Ga0495657_0155565 Ga0495657_0155565_136_441 79
378 3300046675 Ga0495657_0267301 Ga0495657_0267301_521_826 79
379 3300046678 Ga0495599_0869680 Ga0495599_0869680_104_409 79
380 3300046679 Ga0495623_0401753 Ga0495623_0401753_45_350 79
381 3300046680 Ga0495646_0152428 Ga0495646_0152428_754_1059 79
382 3300046684 Ga0495669_0259092 Ga0495669_0259092_62_367 79
383 3300046689 Ga0495613_0300497 Ga0495613_0300497_410_715 79
384 3300046690 Ga0495624_0142110 Ga0495624_0142110_981_1286 79
385 3300046794 Ga0495589_0306121 Ga0495589_0306121_367_675 79
386 3300047317 Ga0495604_0471009 Ga0495604_0471009_425_730 79
387 3300047317 Ga0495604_0697375 Ga0495604_0697375_28_333 79
388 3300047317 Ga0495604_0873870 Ga0495604_0873870_191_502 79
389 3300047318 Ga0495636_0123538 Ga0495636_0123538_615_923 79
390 3300047322 Ga0495680_0002837 Ga0495680_0002837_12787_13092 79
391 3300047322 Ga0495680_0016214 Ga0495680_0016214_4168_4473 79
392 3300047323 Ga0495683_0484471 Ga0495683_0484471_160_468 79
393 3300047443 Ga0495687_138806 Ga0495687_138806_125_436 79
394 3300047444 Ga0495675_0296064 Ga0495675_0296064_157_462 79
395 3300047471 Ga0495684_0014916 Ga0495684_0014916_3244_3549 79
396 3300047471 Ga0495684_0845089 Ga0495684_0845089_258_563 79
397 3300048088 Ga0495602_0929179 Ga0495602_0929179_140_445 79
398 3300048903 Ga0496100_0074729 Ga0496100_0074729_1184_1489 79
399 3300048904 Ga0496101_0355964 Ga0496101_0355964_68_373 79
400 3300048904 Ga0496101_0470468 Ga0496101_0470468_207_512 79
401 3300048907 Ga0496104_0151334 Ga0496104_0151334_218_523 79
402 3300048907 Ga0496104_0158667 Ga0496104_0158667_211_516 79
403 3300048908 Ga0496105_0038494 Ga0496105_0038494_1134_1439 79
404 3300048908 Ga0496105_0474474 Ga0496105_0474474_390_695 79
405 3300048908 Ga0496105_0876647 Ga0496105_0876647_259_564 79
406 3300048908 Ga0496105_1173908 Ga0496105_1173908_238_543 79
407 3300048909 Ga0496106_0287226 Ga0496106_0287226_10_315 79
408 3300048911 Ga0496108_0020577 Ga0496108_0020577_4127_4432 79
409 3300048911 Ga0496108_0099911 Ga0496108_0099911_2122_2427 79
410 3300048911 Ga0496108_1260722 Ga0496108_1260722_299_604 79
411 3300048912 Ga0496109_0020613 Ga0496109_0020613_1763_2068 79
412 3300048912 Ga0496109_0776217 Ga0496109_0776217_453_758 79
413 3300048912 Ga0496109_2022606 Ga0496109_2022606_101_406 79
414 3300048913 Ga0496110_0008791 Ga0496110_0008791_6644_6949 79
415 3300048913 Ga0496110_0438681 Ga0496110_0438681_262_567 79
416 3300048914 Ga0496111_0012957 Ga0496111_0012957_221_526 79
417 3300048914 Ga0496111_0799660 Ga0496111_0799660_190_495 79
418 3300048915 Ga0496112_0012288 Ga0496112_0012288_1607_1912 79
419 3300048915 Ga0496112_0513699 Ga0496112_0513699_174_479 79
420 3300048917 Ga0496114_0419537 Ga0496114_0419537_686_991 79
421 3300048918 Ga0496115_0959933 Ga0496115_0959933_130_435 79
422 3300049570 Ga0501033_0013479 Ga0501033_0013479_5799_6101 79
423 3300050507 nmdc:mga05p37_26949_c1 nmdc:mga05p37_26949_c1_2895_3200 79
424 3300050512 nmdc:mga0n895_153171_c1 nmdc:mga0n895_153171_c1_769_1074 79
425 3300050512 nmdc:mga0n895_1644697_c1 nmdc:mga0n895_1644697_c1_52_357 79
426 3300050515 nmdc:mga0a205_173064_c1 nmdc:mga0a205_173064_c1_581_886 79
427 3300053077 Ga0495601_0147141 Ga0495601_0147141_620_925 79
428 3300053077 Ga0495601_0764565 Ga0495601_0764565_60_365 79
429 3300053084 Ga0495595_0008224 Ga0495595_0008224_3771_4076 79
430 3300053085 Ga0495619_0160628 Ga0495619_0160628_652_957 79
431 3300053085 Ga0495619_0878549 Ga0495619_0878549_239_544 79
432 3300059504 Ga0587082_060835 Ga0587082_060835_102_407 79
433 3300059509 Ga0587089_103707 Ga0587089_103707_75_380 79
434 3300059639 Ga0587062_126594 Ga0587062_126594_169_474 79
435 3300059645 Ga0587076_080924 Ga0587076_080924_23_328 79
436 3300005340 Ga0070689_100275630 Ga0070689_1002756302 80
437 3300005354 Ga0070675_100413889 Ga0070675_1004138892 80
438 3300005356 Ga0070674_100672841 Ga0070674_1006728412 80
439 3300005364 Ga0070673_102137321 Ga0070673_1021373212 80
440 3300005365 Ga0070688_100276444 Ga0070688_1002764442 80
441 3300005366 Ga0070659_100940073 Ga0070659_1009400731 80
442 3300005440 Ga0070705_100145123 Ga0070705_1001451232 80
443 3300005441 Ga0070700_100311560 Ga0070700_1003115602 80
444 3300005441 Ga0070700_100549446 Ga0070700_1005494462 80
445 3300005457 Ga0070662_100040018 Ga0070662_1000400182 80
446 3300005518 Ga0070699_100288580 Ga0070699_1002885803 80
447 3300005543 Ga0070672_100524934 Ga0070672_1005249341 80
448 3300005617 Ga0068859_102765314 Ga0068859_1027653141 80
449 3300005618 Ga0068864_102365372 Ga0068864_1023653721 80
450 3300005840 Ga0068870_10208673 Ga0068870_102086732 80
451 3300005843 Ga0068860_102363218 Ga0068860_1023632182 80
452 3300005844 Ga0068862_100186136 Ga0068862_1001861362 80
453 3300006844 Ga0075428_100469260 Ga0075428_1004692602 80
454 3300006844 Ga0075428_101623726 Ga0075428_1016237262 80
455 3300006844 Ga0075428_102000985 Ga0075428_1020009851 80
456 3300006852 Ga0075433_10626417 Ga0075433_106264171 80
457 3300006881 Ga0068865_100390119 Ga0068865_1003901192 80
458 3300006931 Ga0097620_102765048 Ga0097620_1027650482 80
459 3300009094 Ga0111539_10451625 Ga0111539_104516253 80
460 3300009098 Ga0105245_10256949 Ga0105245_102569491 80
461 3300009147 Ga0114129_10083439 Ga0114129_100834392 80
462 3300009147 Ga0114129_11858363 Ga0114129_118583632 80
463 3300009553 Ga0105249_10910758 Ga0105249_109107582 80
464 3300009553 Ga0105249_10991108 Ga0105249_109911082 80
465 3300010375 Ga0105239_13137395 Ga0105239_131373952 80
466 3300011119 Ga0105246_10344307 Ga0105246_103443073 80
467 3300013308 Ga0157375_11516010 Ga0157375_115160102 80
468 3300014745 Ga0157377_10219495 Ga0157377_102194951 80
469 3300025885 Ga0207653_10028703 Ga0207653_100287033 80
470 3300025908 Ga0207643_10688886 Ga0207643_106888862 80
471 3300025923 Ga0207681_10642878 Ga0207681_106428782 80
472 3300025933 Ga0207706_10032167 Ga0207706_100321674 80
473 3300025936 Ga0207670_10325848 Ga0207670_103258482 80
474 3300025938 Ga0207704_11669478 Ga0207704_116694781 80
475 3300025942 Ga0207689_10512985 Ga0207689_105129852 80
476 3300025961 Ga0207712_11051097 Ga0207712_110510972 80
477 3300026075 Ga0207708_10244044 Ga0207708_102440442 80
478 3300026075 Ga0207708_10256758 Ga0207708_102567582 80
479 3300026088 Ga0207641_11650941 Ga0207641_116509412 80
480 3300026118 Ga0207675_100067548 Ga0207675_1000675482 80
481 3300026118 Ga0207675_100457238 Ga0207675_1004572383 80
482 3300027876 Ga0209974_10037398 Ga0209974_100373982 80
483 3300027907 Ga0207428_10218425 Ga0207428_102184252 80
484 3300028380 Ga0268265_10196532 Ga0268265_101965322 80
485 3300035241 Ga0373961_0427376 Ga0373961_0427376_154_444 80
486 3300048912 Ga0496109_0716441 Ga0496109_0716441_258_548 80
487 3300048916 Ga0496113_0627853 Ga0496113_0627853_22_312 80
488 3300050507 nmdc:mga05p37_451163_c1 nmdc:mga05p37_451163_c1_21_311 80
489 3300050511 nmdc:mga08y16_413865_c1 nmdc:mga08y16_413865_c1_863_1156 80
490 3300050511 nmdc:mga08y16_78142_c1 nmdc:mga08y16_78142_c1_2581_2871 80
491 3300027682 Ga0209971_1119350 Ga0209971_11193501 81
492 3300005329 Ga0070683_100524440 Ga0070683_1005244402 82
493 3300005345 Ga0070692_10169102 Ga0070692_101691021 82
494 3300005445 Ga0070708_100490447 Ga0070708_1004904472 82
495 3300005445 Ga0070708_100873164 Ga0070708_1008731641 82
496 3300005458 Ga0070681_10290798 Ga0070681_102907983 82
497 3300005518 Ga0070699_100617848 Ga0070699_1006178482 82
498 3300005536 Ga0070697_100234608 Ga0070697_1002346082 82
499 3300005544 Ga0070686_100284456 Ga0070686_1002844562 82
500 3300005546 Ga0070696_101011041 Ga0070696_1010110411 82
501 3300005564 Ga0070664_100921101 Ga0070664_1009211012 82
502 3300005618 Ga0068864_100675894 Ga0068864_1006758942 82
503 3300005842 Ga0068858_100631815 Ga0068858_1006318152 82
504 3300013307 Ga0157372_11303705 Ga0157372_113037052 82
505 3300014325 Ga0163163_10786814 Ga0163163_107868142 82
506 3300014968 Ga0157379_10973229 Ga0157379_109732291 82
507 3300025944 Ga0207661_10451894 Ga0207661_104518942 82
508 3300025945 Ga0207679_11277072 Ga0207679_112770721 82
509 3300026035 Ga0207703_10487315 Ga0207703_104873151 82
510 3300026095 Ga0207676_10854240 Ga0207676_108542401 82
511 3300035115 Ga0373941_0192595 Ga0373941_0192595_147_434 82
512 3300035207 Ga0373942_0079965 Ga0373942_0079965_93_380 82
513 3300046476 Ga0495662_0625522 Ga0495662_0625522_128_415 82
514 3300046517 Ga0495630_0700242 Ga0495630_0700242_250_537 82
515 3300046684 Ga0495669_0423644 Ga0495669_0423644_27_314 82
516 3300047321 Ga0495676_0772083 Ga0495676_0772083_220_507 82
517 3300049584 Ga0501068_0085790 Ga0501068_0085790_984_1271 82
518 3300049585 Ga0501069_0033204 Ga0501069_0033204_1396_1683 82
519 3300049586 Ga0501070_1390042 Ga0501070_1390042_44_331 82
520 3300049587 Ga0501071_0979609 Ga0501071_0979609_304_591 82
521 3300049741 Ga0501079_0879897 Ga0501079_0879897_70_357 82
522 3300049741 Ga0501079_1347081 Ga0501079_1347081_109_396 82
523 3300049742 Ga0501080_1834738 Ga0501080_1834738_102_389 82
524 3300053077 Ga0495601_0378310 Ga0495601_0378310_32_319 82
525 3300053085 Ga0495619_0371901 Ga0495619_0371901_536_823 82
526 3300001990 JGI24737J22298_10159499 JGI24737J22298_101594992 83
527 3300002244 JGI24742J22300_10087163 JGI24742J22300_100871632 83
528 3300002459 JGI24751J29686_10043076 JGI24751J29686_100430761 83
529 3300004798 Ga0058859_11656751 Ga0058859_116567512 83
530 3300005328 Ga0070676_10149709 Ga0070676_101497092 83
531 3300005329 Ga0070683_100498378 Ga0070683_1004983782 83
532 3300005330 Ga0070690_100015506 Ga0070690_1000155062 83
533 3300005331 Ga0070670_100036039 Ga0070670_1000360394 83
534 3300005336 Ga0070680_100808603 Ga0070680_1008086032 83
535 3300005336 Ga0070680_101364601 Ga0070680_1013646012 83
536 3300005337 Ga0070682_100033554 Ga0070682_1000335544 83
537 3300005340 Ga0070689_100011400 Ga0070689_1000114006 83
538 3300005341 Ga0070691_10048903 Ga0070691_100489031 83
539 3300005343 Ga0070687_100004900 Ga0070687_1000049002 83
540 3300005344 Ga0070661_100454121 Ga0070661_1004541211 83
541 3300005345 Ga0070692_10099297 Ga0070692_100992972 83
542 3300005347 Ga0070668_100900717 Ga0070668_1009007171 83
543 3300005353 Ga0070669_100776964 Ga0070669_1007769642 83
544 3300005354 Ga0070675_100137721 Ga0070675_1001377212 83
545 3300005355 Ga0070671_100320123 Ga0070671_1003201232 83
546 3300005356 Ga0070674_100208719 Ga0070674_1002087192 83
547 3300005364 Ga0070673_100074774 Ga0070673_1000747743 83
548 3300005365 Ga0070688_100003816 Ga0070688_1000038167 83
549 3300005366 Ga0070659_100006869 Ga0070659_1000068697 83
550 3300005367 Ga0070667_100481136 Ga0070667_1004811361 83
551 3300005440 Ga0070705_100063523 Ga0070705_1000635233 83
552 3300005440 Ga0070705_100225276 Ga0070705_1002252762 83
553 3300005441 Ga0070700_100006192 Ga0070700_1000061926 83
554 3300005441 Ga0070700_100206715 Ga0070700_1002067152 83
555 3300005444 Ga0070694_100221425 Ga0070694_1002214252 83
556 3300005444 Ga0070694_100238167 Ga0070694_1002381672 83
557 3300005444 Ga0070694_100995817 Ga0070694_1009958172 83
558 3300005455 Ga0070663_100134303 Ga0070663_1001343031 83
559 3300005456 Ga0070678_100281709 Ga0070678_1002817092 83
560 3300005458 Ga0070681_10744552 Ga0070681_107445522 83
561 3300005459 Ga0068867_100018210 Ga0068867_1000182103 83
562 3300005466 Ga0070685_10113869 Ga0070685_101138692 83
563 3300005467 Ga0070706_100514454 Ga0070706_1005144542 83
564 3300005471 Ga0070698_100022281 Ga0070698_1000222816 83
565 3300005535 Ga0070684_100138019 Ga0070684_1001380192 83
566 3300005536 Ga0070697_100077363 Ga0070697_1000773633 83
567 3300005536 Ga0070697_100849142 Ga0070697_1008491421 83
568 3300005539 Ga0068853_100639430 Ga0068853_1006394301 83
569 3300005543 Ga0070672_100098764 Ga0070672_1000987643 83
570 3300005544 Ga0070686_100004377 Ga0070686_1000043774 83
571 3300005546 Ga0070696_100006955 Ga0070696_1000069555 83
572 3300005547 Ga0070693_100134308 Ga0070693_1001343082 83
573 3300005547 Ga0070693_101277033 Ga0070693_1012770331 83
574 3300005548 Ga0070665_101450863 Ga0070665_1014508631 83
575 3300005564 Ga0070664_100030578 Ga0070664_1000305782 83
576 3300005577 Ga0068857_100027184 Ga0068857_1000271845 83
577 3300005577 Ga0068857_102331831 Ga0068857_1023318311 83
578 3300005578 Ga0068854_100103070 Ga0068854_1001030702 83
579 3300005578 Ga0068854_100754145 Ga0068854_1007541451 83
580 3300005615 Ga0070702_100007071 Ga0070702_1000070712 83
581 3300005616 Ga0068852_100022059 Ga0068852_1000220593 83
582 3300005617 Ga0068859_100137104 Ga0068859_1001371042 83
583 3300005618 Ga0068864_100086000 Ga0068864_1000860002 83
584 3300005718 Ga0068866_10098729 Ga0068866_100987292 83
585 3300005719 Ga0068861_101046552 Ga0068861_1010465521 83
586 3300005840 Ga0068870_10003863 Ga0068870_100038634 83
587 3300005842 Ga0068858_100055220 Ga0068858_1000552203 83
588 3300005843 Ga0068860_100004060 Ga0068860_1000040605 83
589 3300006038 Ga0075365_10928082 Ga0075365_109280821 83
590 3300006844 Ga0075428_100204411 Ga0075428_1002044113 83
591 3300006844 Ga0075428_101680577 Ga0075428_1016805772 83
592 3300006847 Ga0075431_100065436 Ga0075431_1000654363 83
593 3300006881 Ga0068865_100110705 Ga0068865_1001107051 83
594 3300006931 Ga0097620_100137097 Ga0097620_1001370972 83
595 3300009098 Ga0105245_10046707 Ga0105245_100467074 83
596 3300009101 Ga0105247_10050427 Ga0105247_100504273 83
597 3300009148 Ga0105243_10015460 Ga0105243_100154606 83
598 3300009176 Ga0105242_10047340 Ga0105242_100473404 83
599 3300009177 Ga0105248_10051124 Ga0105248_100511242 83
600 3300009551 Ga0105238_12674923 Ga0105238_126749231 83
601 3300009553 Ga0105249_10006756 Ga0105249_100067565 83
602 3300010375 Ga0105239_10128806 Ga0105239_101288061 83
603 3300011119 Ga0105246_10599021 Ga0105246_105990212 83
604 3300013100 Ga0157373_11253780 Ga0157373_112537801 83
605 3300013297 Ga0157378_10003446 Ga0157378_1000344612 83
606 3300013306 Ga0163162_10137854 Ga0163162_101378542 83
607 3300013308 Ga0157375_10013278 Ga0157375_100132786 83
608 3300014325 Ga0163163_10008650 Ga0163163_100086508 83
609 3300014326 Ga0157380_10033356 Ga0157380_100333564 83
610 3300014745 Ga0157377_10007842 Ga0157377_100078423 83
611 3300014968 Ga0157379_10084518 Ga0157379_100845181 83
612 3300017792 Ga0163161_10064380 Ga0163161_100643801 83
613 3300025899 Ga0207642_10032257 Ga0207642_100322572 83
614 3300025900 Ga0207710_10118324 Ga0207710_101183242 83
615 3300025901 Ga0207688_10126286 Ga0207688_101262862 83
616 3300025908 Ga0207643_10001789 Ga0207643_100017893 83
617 3300025909 Ga0207705_10612733 Ga0207705_106127332 83
618 3300025910 Ga0207684_11147625 Ga0207684_111476251 83
619 3300025912 Ga0207707_10835692 Ga0207707_108356922 83
620 3300025917 Ga0207660_11317392 Ga0207660_113173922 83
621 3300025918 Ga0207662_10000237 Ga0207662_1000023715 83
622 3300025920 Ga0207649_10087818 Ga0207649_100878181 83
623 3300025923 Ga0207681_10904150 Ga0207681_109041501 83
624 3300025925 Ga0207650_10356623 Ga0207650_103566231 83
625 3300025926 Ga0207659_10010535 Ga0207659_100105354 83
626 3300025927 Ga0207687_10027593 Ga0207687_100275933 83
627 3300025931 Ga0207644_10529163 Ga0207644_105291632 83
628 3300025932 Ga0207690_10466257 Ga0207690_104662572 83
629 3300025934 Ga0207686_10783383 Ga0207686_107833832 83
630 3300025935 Ga0207709_10027266 Ga0207709_100272661 83
631 3300025936 Ga0207670_10250582 Ga0207670_102505821 83
632 3300025937 Ga0207669_10171024 Ga0207669_101710242 83
633 3300025938 Ga0207704_10456914 Ga0207704_104569142 83
634 3300025940 Ga0207691_10012785 Ga0207691_100127858 83
635 3300025960 Ga0207651_10127559 Ga0207651_101275592 83
636 3300025961 Ga0207712_10068519 Ga0207712_100685193 83
637 3300025961 Ga0207712_10625568 Ga0207712_106255682 83
638 3300025972 Ga0207668_10230153 Ga0207668_102301532 83
639 3300025981 Ga0207640_10146008 Ga0207640_101460082 83
640 3300025986 Ga0207658_10429120 Ga0207658_104291202 83
641 3300026035 Ga0207703_10088091 Ga0207703_100880913 83
642 3300026041 Ga0207639_10092058 Ga0207639_100920582 83
643 3300026067 Ga0207678_10015566 Ga0207678_100155665 83
644 3300026075 Ga0207708_10007304 Ga0207708_100073048 83
645 3300026089 Ga0207648_10001684 Ga0207648_1000168412 83
646 3300026089 Ga0207648_11053909 Ga0207648_110539092 83
647 3300026116 Ga0207674_10027111 Ga0207674_100271116 83
648 3300026118 Ga0207675_100376852 Ga0207675_1003768522 83
649 3300026142 Ga0207698_10063639 Ga0207698_100636393 83
650 3300027543 Ga0209999_1059138 Ga0209999_10591382 83
651 3300027617 Ga0210002_1106016 Ga0210002_11060161 83
652 3300028379 Ga0268266_10256326 Ga0268266_102563262 83
653 3300028381 Ga0268264_10068651 Ga0268264_100686511 83
654 3300031548 Ga0307408_100060910 Ga0307408_1000609102 83
655 3300031731 Ga0307405_10143618 Ga0307405_101436183 83
656 3300031901 Ga0307406_10404829 Ga0307406_104048291 83
657 3300031911 Ga0307412_10180365 Ga0307412_101803652 83
658 3300032002 Ga0307416_100000904 Ga0307416_10000090410 83
659 3300032126 Ga0307415_100004099 Ga0307415_1000040998 83
660 3300035092 Ga0373952_0051874 Ga0373952_0051874_376_666 83
661 3300035121 Ga0373960_0424203 Ga0373960_0424203_116_406 83
662 3300035171 Ga0373946_0413211 Ga0373946_0413211_326_616 83
663 3300035242 Ga0373962_0245608 Ga0373962_0245608_19_309 83
664 3300035691 Ga0373931_0125146 Ga0373931_0125146_481_771 83
665 3300037418 Ga0395900_1266213 Ga0395900_1266213_90_380 83
666 3300042435 Ga0439434_0365322 Ga0439434_0365322_26_316 83
667 3300048903 Ga0496100_0340760 Ga0496100_0340760_643_933 83
668 3300048904 Ga0496101_0104332 Ga0496101_0104332_72_362 83
669 3300048905 Ga0496102_0201073 Ga0496102_0201073_1277_1567 83
670 3300048907 Ga0496104_0215908 Ga0496104_0215908_631_921 83
671 3300048908 Ga0496105_0091710 Ga0496105_0091710_32_322 83
672 3300048909 Ga0496106_0172803 Ga0496106_0172803_937_1227 83
673 3300048910 Ga0496107_0953777 Ga0496107_0953777_240_530 83
674 3300048911 Ga0496108_0038707 Ga0496108_0038707_2128_2418 83
675 3300048912 Ga0496109_0043729 Ga0496109_0043729_2770_3060 83
676 3300048913 Ga0496110_0063612 Ga0496110_0063612_1349_1639 83
677 3300048914 Ga0496111_0009841 Ga0496111_0009841_4616_4906 83
678 3300048915 Ga0496112_1586333 Ga0496112_1586333_223_513 83
679 3300048916 Ga0496113_0101444 Ga0496113_0101444_190_480 83
680 3300049568 Ga0501031_0457693 Ga0501031_0457693_497_787 83
681 3300049570 Ga0501033_1041244 Ga0501033_1041244_211_501 83
682 3300049572 Ga0501036_0398146 Ga0501036_0398146_376_669 83
683 3300049573 Ga0501037_0558792 Ga0501037_0558792_31_321 83
684 3300049575 Ga0501039_0171289 Ga0501039_0171289_1023_1313 83
685 3300049575 Ga0501039_1231993 Ga0501039_1231993_268_558 83
686 3300049577 Ga0501041_0357219 Ga0501041_0357219_589_879 83
687 3300049582 Ga0501048_0107480 Ga0501048_0107480_77_367 83
688 3300049584 Ga0501068_1071047 Ga0501068_1071047_55_345 83
689 3300049587 Ga0501071_0794534 Ga0501071_0794534_327_617 83
690 3300049588 Ga0501072_0583689 Ga0501072_0583689_284_574 83
691 3300049588 Ga0501072_0823885 Ga0501072_0823885_56_346 83
692 3300049593 Ga0501077_0350241 Ga0501077_0350241_73_363 83
693 3300049741 Ga0501079_0073479 Ga0501079_0073479_717_1007 83
694 3300049741 Ga0501079_0349213 Ga0501079_0349213_87_377 83
695 3300049741 Ga0501079_0530085 Ga0501079_0530085_417_710 83
696 3300049768 Ga0501271_021714 Ga0501271_021714_412_702 83
697 3300049772 Ga0501275_094447 Ga0501275_094447_131_421 83
698 3300049822 Ga0501035_0630813 Ga0501035_0630813_359_649 83
699 3300049822 Ga0501035_1087289 Ga0501035_1087289_291_581 83
700 3300050507 nmdc:mga05p37_550876_c1 nmdc:mga05p37_550876_c1_245_535 83
701 3300050511 nmdc:mga08y16_1866217_c1 nmdc:mga08y16_1866217_c1_215_505 83
702 3300054114 Ga0501084_0211544 Ga0501084_0211544_1280_1570 83
703 3300060353 Ga0501082_0833087 Ga0501082_0833087_305_595 83
704 3300060353 Ga0501082_1097232 Ga0501082_1097232_259_549 83
705 3300061734 Ga0530510_0190060 Ga0530510_0190060_1209_1502 83
706 3300061734 Ga0530510_0191777 Ga0530510_0191777_673_963 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

41

64

0.95

PF12797

Fer4_2

4Fe-4S binding domain

39

60

0.92

Feature Viewer

pLDDT pTM Quality
69.91 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map