F476504

General Info

Members Datasets Scaffolds Average Seq Length
706 517 519 298

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0066093|Ga0495609_0066093_99_1181
Length 360
Sequence MFMMKVLQWWGWSRGHRGVRRPVCQRDVLAWKNFINISLRDKQLFTAYIVLKIETMDLLQAMKTFTAVVEAGSFVGAMDATALSKPAVSRHVTELEEHLGTRLLQRTTRRLSLTSEGQIYYQRCKEVLQAVQEAEAEVGLSTGQAQGRLRIGAPQTFGALHLAALWGRFAAENPLVTLDIVLSDRVVDLVEEGYDLVIRIARMSDSNLISRALARTRMVLCASPPYLAHHGIPTQPHELARHDVISYTYWSSGDVWSFQGPQGEVTVRTHSRIHANNGDTCRAAALAHQGIILQPDFLVHEDLRSGALVELMLEFRAAELGIFAVYPTRKQLPLKVRRLVDFLVEALRDPPWGREPSSHV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2511231018 Pseudomonas sp. GM60 Isolate Nodule
6 2511231019 Pseudomonas sp. GM67 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2818991436 Collimonas arenae 515 Isolate Unclassified
30 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
31 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
32 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
40 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
41 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
42 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
43 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2842733646 Variovorax sp. R-72446 Isolate Unclassified
53 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
54 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
55 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
56 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
57 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
58 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
71 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
72 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
75 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
76 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
77 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
78 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
79 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
80 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
81 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
82 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
83 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
84 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
85 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
86 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
87 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
88 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
89 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
90 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
91 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
92 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
93 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
94 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
95 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
96 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
97 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
98 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
99 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
100 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
101 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
102 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
103 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
104 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
105 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
106 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
107 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
108 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
109 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
110 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
111 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
112 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
113 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
114 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
115 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
116 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
117 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
118 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
119 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
120 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
121 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
122 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
123 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
124 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
125 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
126 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
127 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
128 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
129 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
130 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
131 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
132 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
133 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
134 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
135 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
136 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
137 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
138 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
139 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
140 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
141 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
142 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
143 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
144 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
145 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
146 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
147 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
148 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
149 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
150 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
151 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
152 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
153 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
154 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
155 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
156 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
157 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
158 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
159 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
160 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
161 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
162 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
163 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
164 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
165 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
166 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
167 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
168 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
169 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
170 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
171 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
172 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
173 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
174 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
175 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
176 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
177 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
178 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
179 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
180 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
181 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
182 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
183 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
184 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
185 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
188 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
189 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
190 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
191 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
192 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
193 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
194 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
195 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
196 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
197 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
198 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
199 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
200 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
201 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
202 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
203 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
204 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
205 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
206 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
207 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
208 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
209 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
210 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
211 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
212 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
213 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
214 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
215 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
216 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
217 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
218 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
219 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
220 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
221 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
222 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
223 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
224 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
225 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
226 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
227 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
228 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
229 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
230 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
231 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
232 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
233 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
234 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
235 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
236 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
237 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
238 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
239 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
240 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
241 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
242 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
243 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
244 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
245 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
246 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
247 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
248 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
249 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
250 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
251 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
252 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
253 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
254 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
255 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
256 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
257 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
258 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
261 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
262 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
263 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
267 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
270 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
272 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
275 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
298 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
299 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
300 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
301 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
302 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
304 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
305 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
306 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
307 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
308 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
309 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
316 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
317 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
318 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
321 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
322 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
323 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
324 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
325 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
326 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
327 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
328 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
329 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
330 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
331 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
332 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
333 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
343 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
359 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
360 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
361 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
362 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
390 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
401 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
402 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
416 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
417 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
418 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
419 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
420 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
421 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
422 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
423 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
424 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
425 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
426 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
427 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
428 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
429 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
430 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
431 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
436 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
437 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
441 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
448 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
449 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
450 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
451 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
452 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
453 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
454 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
455 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
456 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
457 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
458 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
459 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
460 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
461 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
462 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
463 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
464 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
465 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
466 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
467 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
468 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
469 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
470 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
471 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
472 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
473 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
474 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
475 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
476 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
477 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
478 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
479 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
480 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
481 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
482 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
483 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
484 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
485 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
486 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
487 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
488 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
489 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
490 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
491 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
492 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
493 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
494 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
495 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
496 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
497 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
498 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
499 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
500 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
501 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
502 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
503 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
504 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
505 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
506 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
507 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
508 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
509 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
510 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
511 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
512 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
513 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
514 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
515 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
516 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
517 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.51
Metatranscriptomes 0
Isolates 26.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.8
Nodule 20.68
Rhizoplane 5.1
Rhizosphere 35.84
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10048937 3300001990 Bacteria 1286
2 JGI25155J39150_1000033 3300002704 Bacteria 105391
3 JGI25156J39149_1000043 3300002705 Bacteria 105452
4 JGI25162J39368_1000045 3300002737 Bacteria 170731
5 JGI25162J39368_1001990 3300002737 Bacteria 9128
6 JGI25154J39366_1000062 3300002738 Bacteria 105525
7 JGI25157J39369_1000060 3300002741 Bacteria 105525
8 JGI25163J39215_1000153 3300002771 Bacteria 27306
9 JGI25164J39214_1000068 3300002772 Bacteria 103192
10 JGI25164J39214_1000394 3300002772 Bacteria 25690
11 JGI25150J39212_1005705 3300002774 Bacteria 2634
12 JGI25150J39212_1007672 3300002774 Bacteria 2156
13 JGI25159J45721_1000163 3300002987 Bacteria 31237
14 JGI25159J45721_1000568 3300002987 Bacteria 16612
15 JGI25159J45721_1003739 3300002987 Bacteria 5266
16 JGI25151J46595_10010907 3300003187 Bacteria 4201
17 JGI25165J46597_1000086 3300003214 Bacteria 170731
18 JGI25153J46596_10006692 3300003215 Bacteria 5794
19 JGI25153J46596_10032912 3300003215 Bacteria 1720
20 JGI25153J46596_10042047 3300003215 Bacteria 1398
21 rootH2_10000947 3300003320 Bacteria 1921
22 JGI25160J50197_1000174 3300003354 Bacteria 54817
23 JGI25160J50197_1000197 3300003354 Bacteria 50744
24 JGI25160J50197_1002717 3300003354 Bacteria 8137
25 JGI25160J50197_1006955 3300003354 Bacteria 4498
26 JGI25161J50226_1000057 3300003374 Bacteria 102462
27 Ga0055526_1002444 3300003771 Bacteria 12572
28 Ga0055526_1007488 3300003771 Bacteria 5659
29 Ga0055537_1000319 3300003773 Bacteria 32834
30 Ga0055537_1011463 3300003773 Bacteria 1797
31 Ga0055524_1000357 3300003775 Bacteria 41402
32 Ga0055536_1013804 3300003781 Bacteria 2882
33 Ga0055534_1002935 3300003784 Bacteria 5650
34 Ga0055528_1002195 3300003790 Bacteria 10662
35 Ga0055530_10000826 3300003791 Bacteria 25589
36 Ga0055540_1000470 3300003792 Bacteria 31110
37 Ga0055540_1007173 3300003792 Bacteria 4262
38 Ga0055531_10001843 3300003794 Bacteria 14970
39 Ga0055531_10005040 3300003794 Bacteria 7829
40 Ga0055543_1000498 3300004625 Bacteria 22690
41 Ga0055543_1009618 3300004625 Bacteria 2069
42 Ga0065165_1001167 3300005262 Bacteria 30545
43 Ga0065165_1002365 3300005262 Bacteria 16315
44 Ga0065165_1051281 3300005262 Bacteria 1170
45 Ga0065714_10094667 3300005288 Bacteria 1809
46 Ga0070658_10446848 3300005327 Bacteria 1113
47 Ga0070676_10002377 3300005328 Bacteria 9630
48 Ga0070670_100182004 3300005331 Bacteria 1825
49 Ga0068869_100054857 3300005334 Plasmid 2903
50 Ga0070680_100038486 3300005336 Bacteria 3868
51 Ga0070660_100302350 3300005339 Bacteria 1312
52 Ga0070668_100000298 3300005347 Bacteria 32492
53 Ga0070668_100091702 3300005347 Bacteria 2396
54 Ga0070668_100475049 3300005347 Bacteria 1079
55 Ga0070669_100004356 3300005353 Bacteria 10216
56 Ga0070669_100115968 3300005353 Bacteria 2038
57 Ga0070671_100181425 3300005355 Bacteria 1782
58 Ga0070671_100214591 3300005355 Bacteria 1633
59 Ga0070673_100155727 3300005364 Bacteria 1939
60 Ga0070659_100025062 3300005366 Bacteria 4578
61 Ga0070667_100067268 3300005367 Bacteria 3045
62 Ga0070700_100289890 3300005441 Unclassified 1190
63 Ga0070663_100032985 3300005455 Bacteria 3574
64 Ga0070663_100321938 3300005455 Bacteria 1244
65 Ga0070662_100001567 3300005457 Bacteria 14137
66 Ga0070681_10229443 3300005458 Bacteria 1771
67 Ga0068867_100320941 3300005459 Bacteria 1283
68 Ga0070679_100256918 3300005530 Bacteria 1702
69 Ga0068853_100001125 3300005539 Bacteria 18939
70 Ga0068853_100055875 3300005539 Bacteria 3403
71 Ga0068855_100028666 3300005563 Bacteria 6661
72 Ga0068854_100090808 3300005578 Bacteria 2272
73 Ga0070702_100037142 3300005615 Plasmid 2704
74 Ga0068852_100152797 3300005616 Bacteria 2148
75 Ga0068852_100352909 3300005616 Bacteria 1436
76 Ga0068852_100437731 3300005616 Bacteria 1292
77 Ga0068864_100296881 3300005618 Bacteria 1512
78 Ga0068861_100000129 3300005719 Bacteria 38855
79 Ga0068862_100000218 3300005844 Bacteria 63913
80 Ga0075365_10065056 3300006038 Bacteria 2444
81 Ga0075365_10205596 3300006038 Bacteria 1380
82 Ga0075368_10002578 3300006042 Bacteria 5945
83 Ga0075363_100012959 3300006048 Bacteria 4027
84 Ga0075363_100064295 3300006048 Bacteria 1982
85 Ga0075432_10021258 3300006058 Bacteria 2217
86 Ga0075367_10110122 3300006178 Bacteria 1689
87 Ga0075369_10119180 3300006186 Bacteria 1194
88 Ga0075366_10029117 3300006195 Bacteria 3243
89 Ga0075370_10128944 3300006353 Bacteria 1475
90 Ga0075430_100042854 3300006846 Bacteria 3827
91 Ga0099824_1022009 3300006942 Bacteria 4298
92 Ga0079104_1000319 3300006946 Bacteria 60367
93 Ga0105250_10000151 3300009092 Bacteria 60339
94 Ga0105240_10642474 3300009093 Bacteria 1164
95 Ga0111539_10135817 3300009094 Unclassified 2880
96 Ga0105247_10172246 3300009101 Bacteria 1440
97 Ga0105243_10036778 3300009148 Bacteria 3802
98 Ga0105241_10075194 3300009174 Bacteria 2632
99 Ga0105241_10624560 3300009174 Bacteria 976
100 Ga0105237_10002301 3300009545 Bacteria 23744
101 Ga0105237_10066311 3300009545 Bacteria 3605
102 Ga0105237_10724963 3300009545 Bacteria 1001
103 Ga0105238_10005594 3300009551 Bacteria 12418
104 Ga0105238_10538331 3300009551 Bacteria 1171
105 Ga0105147_103562 3300009982 Bacteria 1304
106 Ga0105239_10035625 3300010375 Bacteria 5465
107 Ga0105239_10217029 3300010375 Bacteria 2145
108 Ga0105239_10640227 3300010375 Unclassified 1214
109 Ga0105239_10648736 3300010375 Bacteria 1206
110 Ga0105246_10035946 3300011119 Bacteria 3315
111 Ga0157326_1001197 3300012513 Bacteria 2887
112 Ga0157371_10001987 3300013102 Bacteria 20249
113 Ga0157371_10025267 3300013102 Bacteria 4331
114 Ga0157371_10047744 3300013102 Unclassified 3044
115 Ga0157370_10008677 3300013104 Bacteria 10938
116 Ga0157370_10194342 3300013104 Bacteria 1883
117 Ga0157374_10131548 3300013296 Bacteria 2422
118 Ga0163162_10066744 3300013306 Unclassified 3647
119 Ga0163162_10183680 3300013306 Bacteria 2218
120 Ga0157372_10008439 3300013307 Bacteria 10937
121 Ga0157375_10313686 3300013308 Bacteria 1732
122 Ga0163163_10050743 3300014325 Bacteria 4087
123 Ga0182008_10010392 3300014497 Bacteria 4981
124 Ga0157377_10102830 3300014745 Bacteria 1705
125 Ga0157379_10202799 3300014968 Bacteria 1794
126 Ga0157376_10127798 3300014969 Bacteria 2263
127 Ga0214544_1000011 3300021320 Bacteria 262952
128 Ga0214542_1000009 3300021321 Bacteria 262861
129 Ga0214545_1000007 3300021324 Bacteria 262984
130 Ga0214543_1000020 3300021327 Bacteria 262861
131 Ga0209435_100041 3300025206 Bacteria 105577
132 Ga0209760_100019 3300025207 Bacteria 170806
133 Ga0209436_104431 3300025208 Bacteria 3474
134 Ga0207427_100011 3300025231 Bacteria 640076
135 Ga0207427_100105 3300025231 Bacteria 118241
136 Ga0209437_100044 3300025233 Bacteria 430619
137 Ga0209437_100129 3300025233 Bacteria 184661
138 Ga0207425_1001969 3300025245 Bacteria 7698
139 Ga0207425_1005863 3300025245 Bacteria 3439
140 Ga0209646_1000144 3300025246 Bacteria 105691
141 Ga0209026_1000159 3300025250 Bacteria 105691
142 Ga0209677_105923 3300025253 Bacteria 3048
143 Ga0209148_1000267 3300025254 Bacteria 81839
144 Ga0209759_1000001 3300025256 Bacteria 2799452
145 Ga0209759_1020561 3300025256 Bacteria 1528
146 Ga0209129_1009240 3300025258 Bacteria 2627
147 Ga0209233_1000057 3300025261 Bacteria 430619
148 Ga0209233_1000447 3300025261 Bacteria 27425
149 Ga0209565_1000101 3300025263 Bacteria 129092
150 Ga0209565_1006493 3300025263 Bacteria 3272
151 Ga0209455_1001652 3300025272 Bacteria 9674
152 Ga0209673_1000687 3300025273 Bacteria 48530
153 Ga0209130_1000146 3300025284 Bacteria 111777
154 Ga0209130_1000420 3300025284 Bacteria 45713
155 Ga0209675_1000121 3300025291 Bacteria 107684
156 Ga0209675_1003922 3300025291 Bacteria 6823
157 Ga0209676_1000073 3300025292 Bacteria 305947
158 Ga0209676_1004663 3300025292 Bacteria 7530
159 Ga0209025_1003575 3300025294 Bacteria 14532
160 Ga0209025_1010663 3300025294 Bacteria 6190
161 Ga0209025_1026620 3300025294 Bacteria 2895
162 Ga0209564_1000798 3300025295 Bacteria 43280
163 Ga0209564_1001300 3300025295 Bacteria 26937
164 Ga0209564_1008688 3300025295 Bacteria 4961
165 Ga0209758_1000015 3300025297 Bacteria 851943
166 Ga0209758_1000711 3300025297 Bacteria 49164
167 Ga0209758_1001468 3300025297 Bacteria 27665
168 Ga0209758_1001864 3300025297 Bacteria 23116
169 Ga0209758_1003916 3300025297 Bacteria 12991
170 Ga0209758_1015428 3300025297 Bacteria 3955
171 Ga0209758_1031229 3300025297 Bacteria 2189
172 Ga0209758_1031951 3300025297 Bacteria 2148
173 Ga0209050_1000008 3300025298 Bacteria 1144179
174 Ga0209050_1006437 3300025298 Bacteria 6951
175 Ga0209256_1000168 3300025299 Bacteria 132040
176 Ga0209256_1004771 3300025299 Bacteria 8264
177 Ga0209256_1039820 3300025299 Bacteria 1205
178 Ga0207426_1000291 3300025302 Bacteria 99437
179 Ga0207426_1001932 3300025302 Bacteria 14885
180 Ga0207426_1003610 3300025302 Bacteria 8206
181 Ga0207426_1005098 3300025302 Bacteria 6134
182 Ga0207426_1008822 3300025302 Bacteria 4036
183 Ga0207426_1009528 3300025302 Bacteria 3834
184 Ga0207426_1021974 3300025302 Bacteria 2197
185 Ga0209051_1000005 3300025303 Bacteria 1142353
186 Ga0209257_1000031 3300025304 Bacteria 688770
187 Ga0209257_1001688 3300025304 Bacteria 24840
188 Ga0209257_1009644 3300025304 Bacteria 5108
189 Ga0209257_1018719 3300025304 Bacteria 2645
190 Ga0207696_1001662 3300025711 Bacteria 11634
191 Ga0207647_10009749 3300025904 Bacteria 6815
192 Ga0207645_10046658 3300025907 Unclassified 2767
193 Ga0207684_10326893 3300025910 Bacteria 1321
194 Ga0207684_10498505 3300025910 Bacteria 1044
195 Ga0207654_10028697 3300025911 Bacteria 3036
196 Ga0207695_10000059 3300025913 Bacteria 363920
197 Ga0207671_10001109 3300025914 Bacteria 32478
198 Ga0207671_10180267 3300025914 Bacteria 1644
199 Ga0207660_10023502 3300025917 Bacteria 4164
200 Ga0207681_10003227 3300025923 Bacteria 10229
201 Ga0207694_10271954 3300025924 Bacteria 1390
202 Ga0207690_10042128 3300025932 Bacteria 2996
203 Ga0207690_10081940 3300025932 Bacteria 2256
204 Ga0207706_10048646 3300025933 Bacteria 3749
205 Ga0207709_10000358 3300025935 Bacteria 46175
206 Ga0207667_10040235 3300025949 Bacteria 4978
207 Ga0207668_10002278 3300025972 Bacteria 11199
208 Ga0207639_10094221 3300026041 Bacteria 2403
209 Ga0207678_10189749 3300026067 Bacteria 1756
210 Ga0207678_10222390 3300026067 Bacteria 1616
211 Ga0207678_10278296 3300026067 Bacteria 1436
212 Ga0207674_10234512 3300026116 Bacteria 1783
213 Ga0207675_100000114 3300026118 Bacteria 65080
214 Ga0207698_10039785 3300026142 Bacteria 3486
215 Ga0209281_1000029 3300027111 Bacteria 431495
216 Ga0209389_1000012 3300027296 Bacteria 213243
217 Ga0209389_1000069 3300027296 Bacteria 98063
218 Ga0209589_1000077 3300027357 Bacteria 98063
219 Ga0209489_100019 3300027361 Bacteria 213243
220 Ga0209489_100020 3300027361 Bacteria 207541
221 Ga0209700_100018 3300027363 Bacteria 238200
222 Ga0268265_10001884 3300028380 Bacteria 16677
223 Ga0307515_10002570 3300028794 Bacteria 39179
224 Ga0307513_10000070 3300031456 Bacteria 139895
225 Ga0307513_10000104 3300031456 Bacteria 119239
226 Ga0307513_10012101 3300031456 Bacteria 10671
227 Ga0307408_100003460 3300031548 Bacteria 10793
228 Ga0307514_10001524 3300031649 Bacteria 27729
229 Ga0307514_10007179 3300031649 Bacteria 9611
230 Ga0307516_10017017 3300031730 Bacteria 7593
231 Ga0307510_10010708 3300033180 Bacteria 10903
232 Ga0307510_10179538 3300033180 Bacteria 1682
233 Ga0373924_0006808 3300035410 Bacteria 4107
234 Ga0395900_0001756 3300037418 Bacteria 24872
235 Ga0395898_0005085 3300037466 Bacteria 14256
236 Ga0395905_0000531 3300037471 Bacteria 52244
237 Ga0395905_0018632 3300037471 Bacteria 6584
238 Ga0395905_0069928 3300037471 Bacteria 3288
239 Ga0436364_1482759 3300037853 Bacteria 1104
240 Ga0395901_0017340 3300038443 Bacteria 7351
241 Ga0395901_0389366 3300038443 Bacteria 1433
242 Ga0400485_12696 3300038735 Bacteria 2961
243 Ga0400488_53103 3300038741 Bacteria 5947
244 Ga0400483_172813 3300039062 Bacteria 37070
245 Ga0400487_14482 3300039110 Bacteria 3896
246 Ga0400487_16231 3300039110 Bacteria 1108
247 Ga0400487_28140 3300039110 Bacteria 5271
248 Ga0400487_55369 3300039110 Bacteria 86531
249 Ga0436365_0016026 3300039437 Bacteria 1067
250 Ga0439465_0000804 3300041413 Bacteria 9844
251 Ga0439465_0098638 3300041413 Bacteria 1007
252 Ga0451789_0433418 3300041443 Bacteria 1233
253 Ga0451791_0386492 3300041451 Unclassified 1378
254 Ga0451793_1819141 3300041452 Bacteria 987
255 Ga0451797_0353803 3300041453 Bacteria 1966
256 Ga0451802_0069302 3300041460 Bacteria 1130
257 Ga0451807_0929487 3300041486 Bacteria 7554
258 Ga0451853_1566766 3300041512 Bacteria 1831
259 Ga0439431_0000289 3300041997 Bacteria 10354
260 Ga0439431_0056420 3300041997 Unclassified 1027
261 Ga0439442_010688 3300042002 Bacteria 1864
262 Ga0439445_0000661 3300042004 Bacteria 7116
263 Ga0439448_0010988 3300042005 Bacteria 2693
264 Ga0439432_000340 3300042006 Bacteria 17043
265 Ga0466972_0000100 3300044658 Bacteria 76018
266 Ga0466972_0009241 3300044658 Bacteria 4951
267 Ga0466965_0045854 3300044683 Bacteria 2163
268 Ga0466966_0000411 3300044684 Bacteria 27522
269 Ga0466961_0000065 3300044693 Bacteria 63259
270 Ga0466961_0157268 3300044693 Bacteria 1418
271 Ga0466963_0125056 3300044694 Bacteria 1772
272 Ga0466964_0028577 3300044706 Bacteria 2198
273 Ga0466964_0101152 3300044706 Bacteria 1271
274 Ga0466968_0031952 3300044735 Bacteria 2187
275 Ga0466959_0000634 3300045049 Bacteria 20407
276 Ga0466967_0151733 3300045976 Bacteria 2166
277 Ga0495617_000150 3300046452 Bacteria 44881
278 Ga0495627_010695 3300046453 Bacteria 3323
279 Ga0495627_014032 3300046453 Bacteria 2808
280 Ga0495627_022012 3300046453 Bacteria 2102
281 Ga0495603_0288446 3300046455 Bacteria 943
282 Ga0495591_031173 3300046458 Bacteria 1602
283 Ga0495629_0006648 3300046459 Bacteria 8555
284 Ga0495629_0469443 3300046459 Bacteria 851
285 Ga0495638_0000034 3300046460 Bacteria 282038
286 Ga0495638_0016221 3300046460 Bacteria 4993
287 Ga0495638_0018221 3300046460 Bacteria 4665
288 Ga0495638_0021025 3300046460 Bacteria 4304
289 Ga0495651_0004449 3300046462 Bacteria 10735
290 Ga0495653_0055849 3300046463 Bacteria 3012
291 Ga0495650_0075723 3300046471 Bacteria 1309
292 Ga0495605_0035453 3300046474 Bacteria 2521
293 Ga0495639_0000584 3300046475 Bacteria 16986
294 Ga0495664_0080171 3300046477 Bacteria 1956
295 Ga0495607_0000010 3300046501 Bacteria 206525
296 Ga0495583_0000574 3300046506 Bacteria 50599
297 Ga0495610_0000198 3300046512 Bacteria 67337
298 Ga0495610_0012610 3300046512 Bacteria 5074
299 Ga0495610_0074779 3300046512 Bacteria 1571
300 Ga0495616_0001944 3300046513 Bacteria 13903
301 Ga0495618_0192163 3300046514 Bacteria 1294
302 Ga0495628_0031335 3300046516 Bacteria 4302
303 Ga0495628_0288955 3300046516 Bacteria 1216
304 Ga0495630_0239789 3300046517 Bacteria 1385
305 Ga0495631_0000063 3300046518 Bacteria 66560
306 Ga0495631_0113148 3300046518 Bacteria 1167
307 Ga0495637_0028531 3300046520 Bacteria 2492
308 Ga0495637_0046552 3300046520 Bacteria 1834
309 Ga0495648_0012566 3300046524 Bacteria 6304
310 Ga0495648_0202857 3300046524 Bacteria 991
311 Ga0495663_0000394 3300046525 Bacteria 16143
312 Ga0495663_0002766 3300046525 Bacteria 5194
313 Ga0495652_0005379 3300046529 Bacteria 12070
314 Ga0495652_0005458 3300046529 Bacteria 11981
315 Ga0495652_0059495 3300046529 Bacteria 3232
316 Ga0495652_0262389 3300046529 Bacteria 1274
317 Ga0495640_0028879 3300046533 Bacteria 3988
318 Ga0495587_0015865 3300046536 Bacteria 4693
319 Ga0495609_0001891 3300046538 Bacteria 13361
320 Ga0495609_0066093 3300046538 Bacteria 1593
321 Ga0495621_0086418 3300046539 Bacteria 1176
322 Ga0495597_0000109 3300046542 Bacteria 73193
323 Ga0495597_0006150 3300046542 Bacteria 6242
324 Ga0495645_0010468 3300046543 Bacteria 6503
325 Ga0495622_0038233 3300046557 Bacteria 2234
326 Ga0495622_0100009 3300046557 Bacteria 1329
327 Ga0495633_0000279 3300046558 Bacteria 59067
328 Ga0495667_0005992 3300046559 Bacteria 8219
329 Ga0495668_0141576 3300046616 Bacteria 1316
330 Ga0495634_0002102 3300046642 Bacteria 16821
331 Ga0495634_0044463 3300046642 Bacteria 3006
332 Ga0495611_0000001 3300046648 Bacteria 2628469
333 Ga0495625_0000001 3300046660 Bacteria 1641829
334 Ga0495625_0000272 3300046660 Bacteria 80655
335 Ga0495625_0018259 3300046660 Bacteria 5481
336 Ga0495635_0005123 3300046663 Bacteria 9117
337 Ga0495635_0039091 3300046663 Bacteria 3284
338 Ga0495661_0026369 3300046665 Bacteria 3744
339 Ga0495588_0019314 3300046674 Bacteria 3337
340 Ga0495588_0019843 3300046674 Bacteria 3297
341 Ga0495588_0031887 3300046674 Bacteria 2654
342 Ga0495657_0002384 3300046675 Bacteria 15809
343 Ga0495657_0012411 3300046675 Bacteria 6331
344 Ga0495599_0049233 3300046678 Bacteria 2641
345 Ga0495623_0004943 3300046679 Bacteria 8742
346 Ga0495623_0013961 3300046679 Bacteria 5205
347 Ga0495646_0011497 3300046680 Bacteria 5619
348 Ga0495646_0141415 3300046680 Bacteria 1345
349 Ga0495646_0227456 3300046680 Bacteria 1006
350 Ga0495658_0198903 3300046683 Bacteria 1248
351 Ga0495613_0015638 3300046689 Bacteria 5647
352 Ga0495624_0065880 3300046690 Bacteria 2262
353 Ga0495624_0088150 3300046690 Bacteria 1916
354 Ga0495624_0174103 3300046690 Bacteria 1312
355 Ga0495670_0007445 3300046691 Bacteria 5375
356 Ga0495670_0032372 3300046691 Bacteria 2601
357 Ga0495671_0000129 3300046692 Bacteria 68297
358 Ga0495671_0004704 3300046692 Bacteria 8072
359 Ga0495671_0031410 3300046692 Bacteria 2715
360 Ga0495649_0037274 3300046694 Bacteria 2669
361 Ga0495589_0000048 3300046794 Bacteria 117134
362 Ga0495600_0021305 3300046809 Bacteria 4149
363 Ga0495660_0000008 3300046810 Bacteria 435769
364 Ga0495660_0059670 3300046810 Bacteria 2051
365 Ga0495660_0141514 3300046810 Bacteria 1196
366 Ga0495604_0002741 3300047317 Bacteria 14128
367 Ga0495604_0085485 3300047317 Bacteria 2353
368 Ga0495674_0017071 3300047319 Bacteria 6761
369 Ga0495674_0265485 3300047319 Bacteria 1409
370 Ga0495672_0000006 3300047320 Bacteria 589807
371 Ga0495672_0146076 3300047320 Bacteria 1230
372 Ga0495676_0005698 3300047321 Bacteria 11420
373 Ga0495676_0050060 3300047321 Bacteria 3353
374 Ga0495676_0368933 3300047321 Bacteria 957
375 Ga0495680_0001876 3300047322 Bacteria 22116
376 Ga0495687_054245 3300047443 Bacteria 1683
377 Ga0495675_0158377 3300047444 Bacteria 1395
378 Ga0495675_0267943 3300047444 Bacteria 1021
379 Ga0495679_000001 3300047446 Bacteria 1607568
380 Ga0495673_0000089 3300047469 Bacteria 188744
381 Ga0495681_0001359 3300047470 Bacteria 18478
382 Ga0495681_0082111 3300047470 Bacteria 1437
383 Ga0495684_0138363 3300047471 Bacteria 1826
384 Ga0495686_0217277 3300047472 Bacteria 1089
385 Ga0495593_0002546 3300047673 Bacteria 10934
386 Ga0495593_0102009 3300047673 Bacteria 1471
387 Ga0495602_0027901 3300048088 Bacteria 5415
388 Ga0496100_0149403 3300048903 Bacteria 1664
389 Ga0496100_0229514 3300048903 Bacteria 1365
390 Ga0496101_0017039 3300048904 Bacteria 4920
391 Ga0496101_0362687 3300048904 Bacteria 1139
392 Ga0496101_0432120 3300048904 Bacteria 1038
393 Ga0496102_0000823 3300048905 Bacteria 30109
394 Ga0496102_0015608 3300048905 Bacteria 6616
395 Ga0496103_0005342 3300048906 Bacteria 7699
396 Ga0496103_0128641 3300048906 Bacteria 1616
397 Ga0496104_0009070 3300048907 Bacteria 8843
398 Ga0496105_0036292 3300048908 Bacteria 4060
399 Ga0496105_0109606 3300048908 Bacteria 2279
400 Ga0496105_0207387 3300048908 Bacteria 1598
401 Ga0496106_0484205 3300048909 Bacteria 994
402 Ga0496107_0087292 3300048910 Bacteria 2277
403 Ga0496107_0202694 3300048910 Bacteria 1475
404 Ga0496108_0215951 3300048911 Bacteria 1666
405 Ga0496108_0239813 3300048911 Bacteria 1577
406 Ga0496109_0194288 3300048912 Bacteria 1907
407 Ga0496110_0003952 3300048913 Bacteria 11401
408 Ga0496110_0238924 3300048913 Bacteria 1653
409 Ga0496111_0099951 3300048914 Bacteria 2130
410 Ga0496111_0435680 3300048914 Bacteria 968
411 Ga0496111_0472800 3300048914 Bacteria 924
412 Ga0496112_0208189 3300048915 Bacteria 1913
413 Ga0496112_0240664 3300048915 Bacteria 1762
414 Ga0496112_0332894 3300048915 Bacteria 1462
415 Ga0496113_0032035 3300048916 Bacteria 3819
416 Ga0496114_0033872 3300048917 Bacteria 4211
417 Ga0496114_0052300 3300048917 Bacteria 3403
418 Ga0496116_0000592 3300048919 Bacteria 48338
419 Ga0496116_0017100 3300048919 Bacteria 5647
420 Ga0496116_0038608 3300048919 Bacteria 3313
421 Ga0496117_0032525 3300048920 Bacteria 3962
422 Ga0496117_0189762 3300048920 Bacteria 1172
423 Ga0496118_0024006 3300048921 Bacteria 5278
424 Ga0496118_0118801 3300048921 Bacteria 1730
425 Ga0496119_0000417 3300048922 Bacteria 58548
426 Ga0496119_0007397 3300048922 Bacteria 9903
427 Ga0496120_0000812 3300048923 Bacteria 44729
428 Ga0496120_0030270 3300048923 Bacteria 3292
429 Ga0496121_0039988 3300048924 Bacteria 4121
430 Ga0496121_0049586 3300048924 Bacteria 3558
431 Ga0496121_0204898 3300048924 Bacteria 1402
432 Ga0496122_0000662 3300048925 Bacteria 69323
433 Ga0496122_0002201 3300048925 Bacteria 28467
434 Ga0496123_0000478 3300048926 Bacteria 69650
435 Ga0496123_0040785 3300048926 Bacteria 3228
436 Ga0496124_0001684 3300048927 Bacteria 31350
437 Ga0496124_0128667 3300048927 Bacteria 2015
438 Ga0496125_0000363 3300048928 Bacteria 85601
439 Ga0496125_0000395 3300048928 Bacteria 81224
440 Ga0496125_0009386 3300048928 Bacteria 10066
441 Ga0496125_0044133 3300048928 Bacteria 3775
442 Ga0496126_0076031 3300048929 Unclassified 2980
443 Ga0496126_0212896 3300048929 Bacteria 1626
444 Ga0496126_0272860 3300048929 Bacteria 1403
445 Ga0495678_000080 3300049459 Bacteria 120033
446 Ga0495682_0000284 3300049460 Bacteria 39605
447 Ga0495682_0026858 3300049460 Bacteria 2136
448 Ga0501042_0387860 3300049578 Bacteria 1012
449 Ga0501046_0103211 3300049580 Bacteria 2186
450 nmdc:mga0yw44_6610_c1 3300050492 Bacteria 5619
451 nmdc:mga0yw44_75640_c1 3300050492 Bacteria 2100
452 nmdc:mga0k408_51574_c1 3300050493 Bacteria 2383
453 nmdc:mga06z11_124482_c1 3300050494 Bacteria 1441
454 nmdc:mga0qj67_704_c1 3300050509 Bacteria 22789
455 nmdc:mga06r32_123000_c1 3300050510 Bacteria 2560
456 nmdc:mga0sz30_29112_c1 3300050516 Bacteria 2275
457 Ga0500610_0000022 3300053079 Bacteria 60344
458 Ga0495619_0100733 3300053085 Bacteria 1966
459 Ga0500578_0040493 3300053086 Bacteria 2994
460 Ga0500643_000048 3300053087 Bacteria 147879
461 Ga0500643_014941 3300053087 Bacteria 2678
462 Ga0500644_0001218 3300053088 Bacteria 7185
463 Ga0500651_0000262 3300053093 Bacteria 31432
464 Ga0500651_0002652 3300053093 Bacteria 9511
465 Ga0500651_0060678 3300053093 Bacteria 2363
466 Ga0500651_0091230 3300053093 Bacteria 1875
467 Ga0500566_0001615 3300053094 Bacteria 13269
468 Ga0500640_119559 3300053095 Bacteria 1058
469 Ga0500641_0056613 3300053096 Bacteria 1625
470 Ga0500555_000019 3300053103 Bacteria 175470
471 Ga0500555_022477 3300053103 Bacteria 1811
472 Ga0500556_0028019 3300053104 Bacteria 1887
473 Ga0500556_0167155 3300053104 Bacteria 868
474 Ga0500557_000083 3300053105 Bacteria 32931
475 Ga0500560_023247 3300053107 Bacteria 1795
476 Ga0500562_007342 3300053108 Bacteria 2781
477 Ga0500562_068951 3300053108 Bacteria 954
478 Ga0500569_019125 3300053109 Bacteria 1778
479 Ga0500571_001088 3300053110 Bacteria 12161
480 Ga0500593_000085 3300053117 Bacteria 34051
481 Ga0500593_000473 3300053117 Bacteria 15950
482 Ga0500594_0000256 3300053118 Bacteria 12584
483 Ga0500594_0058653 3300053118 Unclassified 1104
484 Ga0500607_000049 3300053121 Bacteria 80941
485 Ga0500618_041719 3300053125 Bacteria 1053
486 Ga0500626_010141 3300053128 Bacteria 3944
487 Ga0500626_061028 3300053128 Bacteria 1686
488 Ga0500628_002179 3300053129 Bacteria 3267
489 Ga0500642_0005571 3300053130 Bacteria 4073
490 Ga0500655_000276 3300053133 Bacteria 11872
491 Ga0500655_010286 3300053133 Bacteria 1689
492 Ga0500655_016281 3300053133 Bacteria 1369
493 Ga0500658_0000335 3300053134 Bacteria 20976
494 Ga0500658_0024606 3300053134 Bacteria 2308
495 Ga0500559_0002782 3300053136 Bacteria 8854
496 Ga0500559_0007886 3300053136 Bacteria 4699
497 Ga0500559_0031748 3300053136 Unclassified 2266
498 Ga0500559_0081598 3300053136 Bacteria 1470
499 Ga0500564_052876 3300053138 Bacteria 1855
500 Ga0500568_0028888 3300053139 Bacteria 2308
501 Ga0500616_0009986 3300053153 Bacteria 5709
502 Ga0500622_0061141 3300053156 Bacteria 1920
503 Ga0500624_001537 3300053157 Bacteria 3604
504 Ga0500627_0001849 3300053158 Bacteria 6050
505 Ga0500634_0047912 3300053161 Bacteria 2306
506 Ga0500638_011434 3300053162 Bacteria 3936
507 Ga0500636_0000148 3300053177 Bacteria 36338
508 Ga0500636_0010502 3300053177 Bacteria 5405
509 Ga0500649_068841 3300053722 Bacteria 1464
510 Ga0500625_008986 3300053729 Bacteria 4441
511 Ga0500645_000958 3300053730 Bacteria 16414
512 Ga0500645_001096 3300053730 Bacteria 14812
513 Ga0500645_006274 3300053730 Bacteria 4265
514 Ga0500609_006345 3300053731 Bacteria 1611
515 Ga0500552_000562 3300053733 Bacteria 3474
516 Ga0500565_000514 3300053734 Bacteria 2146
517 Ga0500601_000280 3300053737 Bacteria 9696
518 Ga0500661_000191 3300055283 Bacteria 10748
519 Ga0500661_005979 3300055283 Bacteria 2269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0469443 Ga0495629_0469443_123_839 238
2 3300047471 Ga0495684_0138363 Ga0495684_0138363_1093_1812 239
3 iso_pu_bacteria 8019659431 8019668139 242
4 3300013308 Ga0157375_10313686 Ga0157375_103136862 255
5 3300009174 Ga0105241_10624560 Ga0105241_106245601 262
6 3300041413 Ga0439465_0098638 Ga0439465_0098638_11_799 262
7 3300046557 Ga0495622_0100009 Ga0495622_0100009_13_801 262
8 3300050492 nmdc:mga0yw44_75640_c1 nmdc:mga0yw44_75640_c1_22_810 262
9 3300053104 Ga0500556_0167155 Ga0500556_0167155_64_852 262
10 3300025910 Ga0207684_10326893 Ga0207684_103268931 271
11 3300026116 Ga0207674_10234512 Ga0207674_102345121 275
12 3300037471 Ga0395905_0000531 Ga0395905_0000531_34618_35514 280
13 3300047321 Ga0495676_0368933 Ga0495676_0368933_80_946 280
14 iso_pu_bacteria 2738541277 2738723694 281
15 iso_pu_bacteria 2738543019 2739284425 281
16 iso_pu_bacteria 2919155634 2919156369 282
17 3300038443 Ga0395901_0389366 Ga0395901_0389366_425_1342 283
18 3300006846 Ga0075430_100042854 Ga0075430_1000428544 284
19 3300012513 Ga0157326_1001197 Ga0157326_10011971 284
20 3300050509 nmdc:mga0qj67_704_c1 nmdc:mga0qj67_704_c1_20922_21842 284
21 3300053088 Ga0500644_0001218 Ga0500644_0001218_2068_2976 284
22 3300053117 Ga0500593_000473 Ga0500593_000473_11230_12138 284
23 3300053129 Ga0500628_002179 Ga0500628_002179_1103_2011 284
24 3300053730 Ga0500645_000958 Ga0500645_000958_10662_11570 284
25 3300053730 Ga0500645_001096 Ga0500645_001096_11970_12878 284
26 3300053730 Ga0500645_006274 Ga0500645_006274_2183_3091 284
27 3300055283 Ga0500661_000191 Ga0500661_000191_6285_7193 284
28 iso_pu_bacteria 2744054633 2745081920 284
29 iso_pu_bacteria 8019538911 8019539677 284
30 3300025297 Ga0209758_1031951 Ga0209758_10319512 285
31 3300031649 Ga0307514_10007179 Ga0307514_1000717911 285
32 3300005366 Ga0070659_100025062 Ga0070659_1000250621 286
33 3300005539 Ga0068853_100001125 Ga0068853_10000112519 286
34 3300005563 Ga0068855_100028666 Ga0068855_1000286664 286
35 3300009551 Ga0105238_10005594 Ga0105238_100055944 286
36 3300013102 Ga0157371_10025267 Ga0157371_100252673 286
37 3300013104 Ga0157370_10008677 Ga0157370_100086773 286
38 3300013307 Ga0157372_10008439 Ga0157372_100084394 286
39 3300025932 Ga0207690_10042128 Ga0207690_100421281 286
40 3300025949 Ga0207667_10040235 Ga0207667_100402353 286
41 3300047470 Ga0495681_0082111 Ga0495681_0082111_38_922 286
42 iso_pu_bacteria 2511231002 2511243064 286
43 iso_pu_bacteria 2511231018 2511339789 286
44 iso_pu_bacteria 2511231019 2511346843 286
45 iso_pu_bacteria 2721755523 2722881083 286
46 iso_pu_bacteria 2818991436 2819541911 286
47 iso_pu_bacteria 2839138175 2839143730 286
48 iso_pu_bacteria 2860339153 2860339942 286
49 iso_pu_bacteria 2881927736 2881928539 286
50 iso_pu_bacteria 2885192300 2885194989 286
51 iso_pu_bacteria 2931396565 2931400165 286
52 iso_pu_bacteria 3007619802 3007623155 286
53 3300048929 Ga0496126_0076031 Ga0496126_0076031_1222_2115 287
54 iso_pu_bacteria 2687453129 2687579382 287
55 3300006178 Ga0075367_10110122 Ga0075367_101101222 288
56 3300006186 Ga0075369_10119180 Ga0075369_101191801 288
57 3300006195 Ga0075366_10029117 Ga0075366_100291174 288
58 3300026067 Ga0207678_10189749 Ga0207678_101897492 288
59 3300031730 Ga0307516_10017017 Ga0307516_100170179 288
60 3300050493 nmdc:mga0k408_51574_c1 nmdc:mga0k408_51574_c1_473_1339 288
61 3300050494 nmdc:mga06z11_124482_c1 nmdc:mga06z11_124482_c1_141_1007 288
62 3300053722 Ga0500649_068841 Ga0500649_068841_11_877 288
63 iso_pu_bacteria 2842733646 2842738476 288
64 iso_pu_bacteria 2906626472 2906630879 289
65 iso_pu_bacteria 8006926726 8006932286 289
66 3300002704 JGI25155J39150_1000033 JGI25155J39150_100003355 290
67 3300002705 JGI25156J39149_1000043 JGI25156J39149_100004355 290
68 3300002737 JGI25162J39368_1000045 JGI25162J39368_1000045148 290
69 3300002738 JGI25154J39366_1000062 JGI25154J39366_100006240 290
70 3300002741 JGI25157J39369_1000060 JGI25157J39369_100006055 290
71 3300002771 JGI25163J39215_1000153 JGI25163J39215_10001534 290
72 3300002772 JGI25164J39214_1000068 JGI25164J39214_100006883 290
73 3300002774 JGI25150J39212_1005705 JGI25150J39212_10057052 290
74 3300002774 JGI25150J39212_1007672 JGI25150J39212_10076721 290
75 3300002987 JGI25159J45721_1000163 JGI25159J45721_10001634 290
76 3300002987 JGI25159J45721_1000568 JGI25159J45721_10005686 290
77 3300002987 JGI25159J45721_1003739 JGI25159J45721_10037395 290
78 3300003187 JGI25151J46595_10010907 JGI25151J46595_100109073 290
79 3300003214 JGI25165J46597_1000086 JGI25165J46597_1000086148 290
80 3300003354 JGI25160J50197_1000174 JGI25160J50197_100017431 290
81 3300003354 JGI25160J50197_1000197 JGI25160J50197_100019728 290
82 3300003374 JGI25161J50226_1000057 JGI25161J50226_100005764 290
83 3300003771 Ga0055526_1002444 Ga0055526_10024445 290
84 3300003771 Ga0055526_1007488 Ga0055526_10074881 290
85 3300003773 Ga0055537_1000319 Ga0055537_100031924 290
86 3300003773 Ga0055537_1011463 Ga0055537_10114632 290
87 3300003775 Ga0055524_1000357 Ga0055524_100035733 290
88 3300003781 Ga0055536_1013804 Ga0055536_10138043 290
89 3300003784 Ga0055534_1002935 Ga0055534_10029354 290
90 3300003790 Ga0055528_1002195 Ga0055528_10021953 290
91 3300003791 Ga0055530_10000826 Ga0055530_100008263 290
92 3300003792 Ga0055540_1000470 Ga0055540_100047028 290
93 3300003792 Ga0055540_1007173 Ga0055540_10071733 290
94 3300003794 Ga0055531_10001843 Ga0055531_100018438 290
95 3300004625 Ga0055543_1000498 Ga0055543_100049814 290
96 3300005262 Ga0065165_1051281 Ga0065165_10512811 290
97 3300005288 Ga0065714_10094667 Ga0065714_100946671 290
98 3300005355 Ga0070671_100181425 Ga0070671_1001814252 290
99 3300006048 Ga0075363_100064295 Ga0075363_1000642952 290
100 3300006058 Ga0075432_10021258 Ga0075432_100212582 290
101 3300006353 Ga0075370_10128944 Ga0075370_101289442 290
102 3300006946 Ga0079104_1000319 Ga0079104_100031913 290
103 3300009092 Ga0105250_10000151 Ga0105250_1000015145 290
104 3300013102 Ga0157371_10001987 Ga0157371_100019878 290
105 3300013104 Ga0157370_10194342 Ga0157370_101943422 290
106 3300014497 Ga0182008_10010392 Ga0182008_100103923 290
107 3300025206 Ga0209435_100041 Ga0209435_10004155 290
108 3300025207 Ga0209760_100019 Ga0209760_10001923 290
109 3300025208 Ga0209436_104431 Ga0209436_1044313 290
110 3300025231 Ga0207427_100011 Ga0207427_10001123 290
111 3300025233 Ga0209437_100044 Ga0209437_10004423 290
112 3300025245 Ga0207425_1001969 Ga0207425_10019697 290
113 3300025245 Ga0207425_1005863 Ga0207425_10058633 290
114 3300025246 Ga0209646_1000144 Ga0209646_100014455 290
115 3300025250 Ga0209026_1000159 Ga0209026_100015955 290
116 3300025256 Ga0209759_1000001 Ga0209759_10000012584 290
117 3300025258 Ga0209129_1009240 Ga0209129_10092403 290
118 3300025261 Ga0209233_1000057 Ga0209233_100005723 290
119 3300025263 Ga0209565_1000101 Ga0209565_100010167 290
120 3300025263 Ga0209565_1006493 Ga0209565_10064933 290
121 3300025273 Ga0209673_1000687 Ga0209673_100068741 290
122 3300025284 Ga0209130_1000146 Ga0209130_100014640 290
123 3300025284 Ga0209130_1000420 Ga0209130_100042024 290
124 3300025291 Ga0209675_1000121 Ga0209675_100012141 290
125 3300025291 Ga0209675_1003922 Ga0209675_10039223 290
126 3300025292 Ga0209676_1000073 Ga0209676_100007372 290
127 3300025292 Ga0209676_1004663 Ga0209676_10046636 290
128 3300025294 Ga0209025_1003575 Ga0209025_10035751 290
129 3300025294 Ga0209025_1010663 Ga0209025_10106634 290
130 3300025294 Ga0209025_1026620 Ga0209025_10266201 290
131 3300025295 Ga0209564_1000798 Ga0209564_100079832 290
132 3300025295 Ga0209564_1001300 Ga0209564_100130025 290
133 3300025297 Ga0209758_1003916 Ga0209758_10039168 290
134 3300025297 Ga0209758_1031229 Ga0209758_10312291 290
135 3300025298 Ga0209050_1000008 Ga0209050_1000008991 290
136 3300025298 Ga0209050_1006437 Ga0209050_10064371 290
137 3300025299 Ga0209256_1000168 Ga0209256_100016841 290
138 3300025302 Ga0207426_1000291 Ga0207426_100029164 290
139 3300025302 Ga0207426_1005098 Ga0207426_10050985 290
140 3300025303 Ga0209051_1000005 Ga0209051_1000005991 290
141 3300025304 Ga0209257_1000031 Ga0209257_1000031581 290
142 3300025304 Ga0209257_1009644 Ga0209257_10096443 290
143 3300025711 Ga0207696_1001662 Ga0207696_10016622 290
144 3300025910 Ga0207684_10498505 Ga0207684_104985051 290
145 3300025935 Ga0207709_10000358 Ga0207709_1000035814 290
146 3300027111 Ga0209281_1000029 Ga0209281_100002943 290
147 3300031456 Ga0307513_10000070 Ga0307513_1000007020 290
148 3300031548 Ga0307408_100003460 Ga0307408_1000034606 290
149 3300041413 Ga0439465_0000804 Ga0439465_0000804_5523_6422 290
150 3300041512 Ga0451853_1566766 Ga0451853_1566766_694_1620 290
151 3300041997 Ga0439431_0000289 Ga0439431_0000289_5151_6050 290
152 3300042002 Ga0439442_010688 Ga0439442_010688_358_1257 290
153 3300042004 Ga0439445_0000661 Ga0439445_0000661_1085_1984 290
154 3300042005 Ga0439448_0010988 Ga0439448_0010988_438_1334 290
155 3300042006 Ga0439432_000340 Ga0439432_000340_3072_3971 290
156 3300046453 Ga0495627_022012 Ga0495627_022012_172_1116 290
157 3300046460 Ga0495638_0016221 Ga0495638_0016221_2001_2900 290
158 3300046474 Ga0495605_0035453 Ga0495605_0035453_315_1214 290
159 3300046517 Ga0495630_0239789 Ga0495630_0239789_172_1071 290
160 3300046529 Ga0495652_0005379 Ga0495652_0005379_6419_7321 290
161 3300046536 Ga0495587_0015865 Ga0495587_0015865_2648_3547 290
162 3300046542 Ga0495597_0000109 Ga0495597_0000109_30400_31341 290
163 3300046542 Ga0495597_0006150 Ga0495597_0006150_3276_4220 290
164 3300046642 Ga0495634_0002102 Ga0495634_0002102_5641_6540 290
165 3300046663 Ga0495635_0005123 Ga0495635_0005123_3467_4366 290
166 3300046679 Ga0495623_0004943 Ga0495623_0004943_4595_5494 290
167 3300046680 Ga0495646_0011497 Ga0495646_0011497_2133_3032 290
168 3300046690 Ga0495624_0065880 Ga0495624_0065880_494_1396 290
169 3300046692 Ga0495671_0031410 Ga0495671_0031410_889_1788 290
170 3300047319 Ga0495674_0017071 Ga0495674_0017071_1654_2553 290
171 3300047444 Ga0495675_0267943 Ga0495675_0267943_53_952 290
172 3300047470 Ga0495681_0001359 Ga0495681_0001359_10323_11267 290
173 3300048905 Ga0496102_0000823 Ga0496102_0000823_23447_24346 290
174 3300048906 Ga0496103_0005342 Ga0496103_0005342_3116_4015 290
175 3300048919 Ga0496116_0017100 Ga0496116_0017100_1567_2466 290
176 3300048920 Ga0496117_0032525 Ga0496117_0032525_30_929 290
177 3300048921 Ga0496118_0024006 Ga0496118_0024006_2839_3738 290
178 3300048924 Ga0496121_0204898 Ga0496121_0204898_253_1152 290
179 3300048929 Ga0496126_0212896 Ga0496126_0212896_18_917 290
180 3300048929 Ga0496126_0272860 Ga0496126_0272860_229_1137 290
181 3300053118 Ga0500594_0058653 Ga0500594_0058653_74_991 290
182 3300053136 Ga0500559_0007886 Ga0500559_0007886_317_1234 290
183 iso_pu_bacteria 2507262055 2507505903 290
184 iso_pu_bacteria 2508501009 2508540094 290
185 iso_pu_bacteria 2508501042 2508696164 290
186 iso_pu_bacteria 2511231028 2511396612 290
187 iso_pu_bacteria 2513237092 2513627462 290
188 iso_pu_bacteria 2513237094 2513638774 290
189 iso_pu_bacteria 2513237095 2513649876 290
190 iso_pu_bacteria 2513237102 2513704360 290
191 iso_pu_bacteria 2513237139 2513877263 290
192 iso_pu_bacteria 2513237161 2514011250 290
193 iso_pu_bacteria 2515154112 2515631376 290
194 iso_pu_bacteria 2524023205 2524442990 290
195 iso_pu_bacteria 2528768022 2528855115 290
196 iso_pu_bacteria 2617270735 2617347785 290
197 iso_pu_bacteria 2617270741 2617374708 290
198 iso_pu_bacteria 2791355196 2793061559 290
199 iso_pu_bacteria 2802429603 2805916137 290
200 iso_pu_bacteria 2816332527 2818240876 290
201 iso_pu_bacteria 2824600985 2824605519 290
202 iso_pu_bacteria 2824609381 2824610817 290
203 iso_pu_bacteria 2824626560 2824627808 290
204 iso_pu_bacteria 2824653114 2824653869 290
205 iso_pu_bacteria 2824661429 2824663777 290
206 iso_pu_bacteria 2824671348 2824676103 290
207 iso_pu_bacteria 2824679649 2824686516 290
208 iso_pu_bacteria 2824687955 2824692456 290
209 iso_pu_bacteria 2824696289 2824699879 290
210 iso_pu_bacteria 2824753945 2824763432 290
211 iso_pu_bacteria 2824763712 2824772165 290
212 iso_pu_bacteria 2824773399 2824775734 290
213 iso_pu_bacteria 2838122688 2838125108 290
214 iso_pu_bacteria 2841941048 2841945846 290
215 iso_pu_bacteria 2841949485 2841956827 290
216 iso_pu_bacteria 2841966195 2841973343 290
217 iso_pu_bacteria 2841974524 2841979493 290
218 iso_pu_bacteria 2841983080 2841989382 290
219 iso_pu_bacteria 2842038055 2842044373 290
220 iso_pu_bacteria 2842045827 2842051638 290
221 iso_pu_bacteria 2844315083 2844321478 290
222 iso_pu_bacteria 2847930680 2847939462 290
223 iso_pu_bacteria 2847939898 2847941212 290
224 iso_pu_bacteria 2849076700 2849082203 290
225 iso_pu_bacteria 2857509624 2857513321 290
226 iso_pu_bacteria 2874590934 2874596361 290
227 iso_pu_bacteria 2874612657 2874620226 290
228 iso_pu_bacteria 2874620515 2874622450 290
229 iso_pu_bacteria 2874628541 2874633333 290
230 iso_pu_bacteria 2874645413 2874650349 290
231 iso_pu_bacteria 2876761206 2876761650 290
232 iso_pu_bacteria 2876771140 2876776826 290
233 iso_pu_bacteria 2876818435 2876824616 290
234 iso_pu_bacteria 2879074833 2879080963 290
235 iso_pu_bacteria 2879083081 2879091096 290
236 iso_pu_bacteria 2879099564 2879106659 290
237 iso_pu_bacteria 2879127579 2879133809 290
238 iso_pu_bacteria 2879142872 2879143069 290
239 iso_pu_bacteria 2881364244 2881369623 290
240 iso_pu_bacteria 2881665667 2881670145 290
241 iso_pu_bacteria 2885366525 2885367728 290
242 iso_pu_bacteria 2885409591 2885418269 290
243 iso_pu_bacteria 2888378607 2888387733 290
244 iso_pu_bacteria 2888388044 2888389953 290
245 iso_pu_bacteria 2888419890 2888421148 290
246 iso_pu_bacteria 2903727486 2903727943 290
247 iso_pu_bacteria 2904666416 2904671543 290
248 iso_pu_bacteria 2904711408 2904719835 290
249 iso_pu_bacteria 2906602504 2906602573 290
250 iso_pu_bacteria 2906643746 2906651670 290
251 iso_pu_bacteria 2922393267 2922398531 290
252 iso_pu_bacteria 2929615660 2929622229 290
253 iso_pu_bacteria 2929624759 2929630124 290
254 iso_pu_bacteria 2932784394 2932787945 290
255 iso_pu_bacteria 2932794094 2932800643 290
256 iso_pu_bacteria 2932801729 2932808374 290
257 iso_pu_bacteria 2932809354 2932813320 290
258 iso_pu_bacteria 2932818245 2932820017 290
259 iso_pu_bacteria 2932828146 2932832919 290
260 iso_pu_bacteria 2933577622 2933584157 290
261 iso_pu_bacteria 2935608549 2935614325 290
262 iso_pu_bacteria 2935616580 2935620404 290
263 iso_pu_bacteria 2935638405 2935640728 290
264 iso_pu_bacteria 2935648319 2935649355 290
265 iso_pu_bacteria 2935656913 2935657873 290
266 iso_pu_bacteria 2935665750 2935668920 290
267 iso_pu_bacteria 2935675223 2935681354 290
268 iso_pu_bacteria 2935684952 2935687229 290
269 iso_pu_bacteria 2935694250 2935696800 290
270 iso_pu_bacteria 2935703347 2935709108 290
271 iso_pu_bacteria 2935713505 2935716917 290
272 iso_pu_bacteria 2935722832 2935722958 290
273 iso_pu_bacteria 2935732158 2935734515 290
274 iso_pu_bacteria 2935741537 2935744694 290
275 iso_pu_bacteria 2935750917 2935753195 290
276 iso_pu_bacteria 2935760218 2935767599 290
277 iso_pu_bacteria 2935769743 2935770194 290
278 iso_pu_bacteria 2935777560 2935777776 290
279 iso_pu_bacteria 2935785616 2935786752 290
280 iso_pu_bacteria 2935793552 2935794806 290
281 iso_pu_bacteria 2935801545 2935804838 290
282 iso_pu_bacteria 2935810662 2935815987 290
283 iso_pu_bacteria 2935819856 2935826543 290
284 iso_pu_bacteria 2935827899 2935832235 290
285 iso_pu_bacteria 2935837841 2935840935 290
286 iso_pu_bacteria 2935847175 2935851163 290
287 iso_pu_bacteria 2935855204 2935859290 290
288 iso_pu_bacteria 2935864058 2935864474 290
289 iso_pu_bacteria 2935873716 2935875174 290
290 iso_pu_bacteria 2935883170 2935883481 290
291 iso_pu_bacteria 2935908558 2935913212 290
292 iso_pu_bacteria 2935916978 2935922634 290
293 iso_pu_bacteria 2935926038 2935930863 290
294 iso_pu_bacteria 2935934488 2935939803 290
295 iso_pu_bacteria 2935942939 2935946752 290
296 iso_pu_bacteria 2935951376 2935956047 290
297 iso_pu_bacteria 2935959822 2935963872 290
298 iso_pu_bacteria 2935967501 2935972840 290
299 iso_pu_bacteria 2935975950 2935978243 290
300 iso_pu_bacteria 2935984226 2935985631 290
301 iso_pu_bacteria 2935992306 2935995851 290
302 iso_pu_bacteria 2936002035 2936005762 290
303 iso_pu_bacteria 2936011229 2936012092 290
304 iso_pu_bacteria 2936019824 2936020827 290
305 iso_pu_bacteria 2936028420 2936029385 290
306 iso_pu_bacteria 2936037263 2936041890 290
307 iso_pu_bacteria 2936046547 2936048291 290
308 iso_pu_bacteria 2936055302 2936056598 290
309 iso_pu_bacteria 2940556831 2940559108 290
310 iso_pu_bacteria 2941531003 2941532058 290
311 iso_pu_bacteria 2941538514 2941541803 290
312 iso_pu_bacteria 3005506211 3005510890 290
313 iso_pu_bacteria 3005594810 3005601845 290
314 iso_pu_bacteria 3005710791 3005717582 290
315 iso_pu_bacteria 3005718088 3005724631 290
316 iso_pu_bacteria 8016511872 8016517282 290
317 iso_pu_bacteria 8016522445 8016526951 290
318 iso_pu_bacteria 8016530956 8016532036 290
319 iso_pu_bacteria 8016539877 8016545245 290
320 iso_pu_bacteria 8016548790 8016556843 290
321 iso_pu_bacteria 8016557553 8016565196 290
322 iso_pu_bacteria 8016566248 8016570324 290
323 iso_pu_bacteria 8016575299 8016582872 290
324 iso_pu_bacteria 8016583857 8016585423 290
325 iso_pu_bacteria 8016595262 8016602839 290
326 iso_pu_bacteria 8016603502 8016605708 290
327 iso_pu_bacteria 8016613128 8016617616 290
328 iso_pu_bacteria 8016622563 8016623954 290
329 iso_pu_bacteria 8016630954 8016634909 290
330 iso_pu_bacteria 8017057580 8017059313 290
331 iso_pu_bacteria 8019530166 8019531854 290
332 iso_pu_bacteria 8019547302 8019550974 290
333 iso_pu_bacteria 8019586578 8019594188 290
334 iso_pu_bacteria 8019608314 8019611138 290
335 iso_pu_bacteria 8019629233 8019631334 290
336 iso_pu_bacteria 8019638758 8019639286 290
337 iso_pu_bacteria 8019648815 8019651705 290
338 iso_pu_bacteria 8019668869 8019677604 290
339 iso_pu_bacteria 8019678201 8019687344 290
340 iso_pu_bacteria 8019687851 8019693321 290
341 iso_pu_bacteria 8055742211 8055743522 290
342 3300005328 Ga0070676_10002377 Ga0070676_100023773 291
343 3300005334 Ga0068869_100054857 Ga0068869_1000548572 291
344 3300005347 Ga0070668_100000298 Ga0070668_1000002989 291
345 3300005353 Ga0070669_100004356 Ga0070669_1000043564 291
346 3300005441 Ga0070700_100289890 Ga0070700_1002898902 291
347 3300005457 Ga0070662_100001567 Ga0070662_1000015672 291
348 3300005615 Ga0070702_100037142 Ga0070702_1000371423 291
349 3300005719 Ga0068861_100000129 Ga0068861_10000012929 291
350 3300005844 Ga0068862_100000218 Ga0068862_10000021843 291
351 3300009094 Ga0111539_10135817 Ga0111539_101358174 291
352 3300009982 Ga0105147_103562 Ga0105147_1035621 291
353 3300010375 Ga0105239_10640227 Ga0105239_106402271 291
354 3300013306 Ga0163162_10066744 Ga0163162_100667442 291
355 3300025907 Ga0207645_10046658 Ga0207645_100466582 291
356 3300025923 Ga0207681_10003227 Ga0207681_100032279 291
357 3300025972 Ga0207668_10002278 Ga0207668_100022788 291
358 3300026118 Ga0207675_100000114 Ga0207675_10000011423 291
359 3300028380 Ga0268265_10001884 Ga0268265_100018843 291
360 3300028794 Ga0307515_10002570 Ga0307515_1000257016 291
361 3300031456 Ga0307513_10012101 Ga0307513_100121013 291
362 3300031649 Ga0307514_10001524 Ga0307514_1000152416 291
363 3300041486 Ga0451807_0929487 Ga0451807_0929487_6531_7430 291
364 3300041997 Ga0439431_0056420 Ga0439431_0056420_13_912 291
365 3300046452 Ga0495617_000150 Ga0495617_000150_17295_18194 291
366 3300046453 Ga0495627_010695 Ga0495627_010695_1167_2084 291
367 3300046460 Ga0495638_0000034 Ga0495638_0000034_164850_165749 291
368 3300046460 Ga0495638_0018221 Ga0495638_0018221_105_1022 291
369 3300046501 Ga0495607_0000010 Ga0495607_0000010_195657_196556 291
370 3300046506 Ga0495583_0000574 Ga0495583_0000574_32317_33216 291
371 3300046512 Ga0495610_0012610 Ga0495610_0012610_692_1609 291
372 3300046513 Ga0495616_0001944 Ga0495616_0001944_9633_10550 291
373 3300046520 Ga0495637_0028531 Ga0495637_0028531_1502_2434 291
374 3300046520 Ga0495637_0046552 Ga0495637_0046552_670_1587 291
375 3300046538 Ga0495609_0001891 Ga0495609_0001891_2655_3554 291
376 3300046538 Ga0495609_0066093 Ga0495609_0066093_99_1181 291
377 3300046539 Ga0495621_0086418 Ga0495621_0086418_193_1110 291
378 3300046648 Ga0495611_0000001 Ga0495611_0000001_1163555_1164454 291
379 3300046660 Ga0495625_0000001 Ga0495625_0000001_751584_752483 291
380 3300046660 Ga0495625_0018259 Ga0495625_0018259_3043_3960 291
381 3300046665 Ga0495661_0026369 Ga0495661_0026369_2801_3700 291
382 3300046674 Ga0495588_0031887 Ga0495588_0031887_171_1088 291
383 3300046683 Ga0495658_0198903 Ga0495658_0198903_58_1140 291
384 3300046690 Ga0495624_0088150 Ga0495624_0088150_582_1664 291
385 3300046691 Ga0495670_0007445 Ga0495670_0007445_342_1274 291
386 3300046691 Ga0495670_0032372 Ga0495670_0032372_605_1687 291
387 3300046692 Ga0495671_0000129 Ga0495671_0000129_19445_20344 291
388 3300046692 Ga0495671_0004704 Ga0495671_0004704_3548_4465 291
389 3300046794 Ga0495589_0000048 Ga0495589_0000048_88300_89199 291
390 3300046810 Ga0495660_0000008 Ga0495660_0000008_117456_118355 291
391 3300046810 Ga0495660_0141514 Ga0495660_0141514_121_1038 291
392 3300047321 Ga0495676_0005698 Ga0495676_0005698_7377_8459 291
393 3300047446 Ga0495679_000001 Ga0495679_000001_422502_423401 291
394 3300047469 Ga0495673_0000089 Ga0495673_0000089_21132_22031 291
395 3300047673 Ga0495593_0002546 Ga0495593_0002546_2476_3558 291
396 3300049459 Ga0495678_000080 Ga0495678_000080_97270_98169 291
397 3300049460 Ga0495682_0000284 Ga0495682_0000284_17656_18555 291
398 3300049578 Ga0501042_0387860 Ga0501042_0387860_26_925 291
399 3300050510 nmdc:mga06r32_123000_c1 nmdc:mga06r32_123000_c1_1178_2107 291
400 3300053079 Ga0500610_0000022 Ga0500610_0000022_14323_15240 291
401 3300053087 Ga0500643_014941 Ga0500643_014941_1208_2290 291
402 3300053093 Ga0500651_0000262 Ga0500651_0000262_27840_28757 291
403 3300053093 Ga0500651_0060678 Ga0500651_0060678_1109_2191 291
404 3300053103 Ga0500555_000019 Ga0500555_000019_88782_89681 291
405 3300053107 Ga0500560_023247 Ga0500560_023247_595_1677 291
406 3300053108 Ga0500562_007342 Ga0500562_007342_1347_2264 291
407 3300053110 Ga0500571_001088 Ga0500571_001088_8462_9544 291
408 3300053117 Ga0500593_000085 Ga0500593_000085_5956_6873 291
409 3300053118 Ga0500594_0000256 Ga0500594_0000256_9827_10759 291
410 3300053121 Ga0500607_000049 Ga0500607_000049_11775_12692 291
411 3300053128 Ga0500626_061028 Ga0500626_061028_117_1199 291
412 3300053133 Ga0500655_000276 Ga0500655_000276_9251_10333 291
413 3300053134 Ga0500658_0000335 Ga0500658_0000335_17227_18144 291
414 3300053136 Ga0500559_0002782 Ga0500559_0002782_2882_3964 291
415 3300053153 Ga0500616_0009986 Ga0500616_0009986_2796_3728 291
416 3300053157 Ga0500624_001537 Ga0500624_001537_1634_2716 291
417 3300053158 Ga0500627_0001849 Ga0500627_0001849_1550_2467 291
418 3300053161 Ga0500634_0047912 Ga0500634_0047912_1039_2121 291
419 3300053162 Ga0500638_011434 Ga0500638_011434_1299_2381 291
420 3300053177 Ga0500636_0010502 Ga0500636_0010502_3953_5035 291
421 3300005364 Ga0070673_100155727 Ga0070673_1001557271 292
422 3300005367 Ga0070667_100067268 Ga0070667_1000672683 292
423 3300005455 Ga0070663_100321938 Ga0070663_1003219382 292
424 3300005539 Ga0068853_100055875 Ga0068853_1000558751 292
425 3300013102 Ga0157371_10047744 Ga0157371_100477442 292
426 3300013306 Ga0163162_10183680 Ga0163162_101836803 292
427 3300025256 Ga0209759_1020561 Ga0209759_10205611 292
428 3300026041 Ga0207639_10094221 Ga0207639_100942213 292
429 3300026067 Ga0207678_10222390 Ga0207678_102223902 292
430 3300031456 Ga0307513_10000104 Ga0307513_1000010437 292
431 3300041443 Ga0451789_0433418 Ga0451789_0433418_178_1107 292
432 3300041453 Ga0451797_0353803 Ga0451797_0353803_377_1306 292
433 3300041460 Ga0451802_0069302 Ga0451802_0069302_150_1079 292
434 3300046453 Ga0495627_014032 Ga0495627_014032_574_1482 292
435 3300046458 Ga0495591_031173 Ga0495591_031173_282_1190 292
436 3300046460 Ga0495638_0021025 Ga0495638_0021025_1398_2357 292
437 3300046475 Ga0495639_0000584 Ga0495639_0000584_188_1090 292
438 3300046512 Ga0495610_0000198 Ga0495610_0000198_58735_59643 292
439 3300046518 Ga0495631_0000063 Ga0495631_0000063_6922_7830 292
440 3300046525 Ga0495663_0000394 Ga0495663_0000394_15223_16125 292
441 3300046525 Ga0495663_0002766 Ga0495663_0002766_1649_2572 292
442 3300046558 Ga0495633_0000279 Ga0495633_0000279_40567_41490 292
443 3300046660 Ga0495625_0000272 Ga0495625_0000272_55997_56956 292
444 3300046674 Ga0495588_0019314 Ga0495588_0019314_920_1822 292
445 3300047320 Ga0495672_0000006 Ga0495672_0000006_487086_487988 292
446 3300047320 Ga0495672_0146076 Ga0495672_0146076_52_954 292
447 3300048903 Ga0496100_0149403 Ga0496100_0149403_195_1097 292
448 3300048904 Ga0496101_0017039 Ga0496101_0017039_3125_4027 292
449 3300048905 Ga0496102_0015608 Ga0496102_0015608_897_1799 292
450 3300048906 Ga0496103_0128641 Ga0496103_0128641_666_1568 292
451 3300048911 Ga0496108_0239813 Ga0496108_0239813_574_1476 292
452 3300048913 Ga0496110_0003952 Ga0496110_0003952_2464_3366 292
453 3300048914 Ga0496111_0099951 Ga0496111_0099951_656_1558 292
454 3300048917 Ga0496114_0033872 Ga0496114_0033872_3219_4121 292
455 3300048919 Ga0496116_0000592 Ga0496116_0000592_25873_26808 292
456 3300048922 Ga0496119_0000417 Ga0496119_0000417_28570_29505 292
457 3300048923 Ga0496120_0000812 Ga0496120_0000812_27715_28650 292
458 3300048925 Ga0496122_0000662 Ga0496122_0000662_56359_57267 292
459 3300048925 Ga0496122_0002201 Ga0496122_0002201_17866_18801 292
460 3300048926 Ga0496123_0000478 Ga0496123_0000478_56358_57266 292
461 3300048926 Ga0496123_0040785 Ga0496123_0040785_749_1684 292
462 3300048927 Ga0496124_0001684 Ga0496124_0001684_8519_9454 292
463 3300048928 Ga0496125_0000363 Ga0496125_0000363_63136_64071 292
464 3300048928 Ga0496125_0000395 Ga0496125_0000395_38503_39405 292
465 3300048928 Ga0496125_0044133 Ga0496125_0044133_1208_2143 292
466 3300049580 Ga0501046_0103211 Ga0501046_0103211_199_1149 292
467 3300053093 Ga0500651_0002652 Ga0500651_0002652_4878_5846 292
468 3300053128 Ga0500626_010141 Ga0500626_010141_111_1013 292
469 3300053136 Ga0500559_0081598 Ga0500559_0081598_282_1235 292
470 3300053734 Ga0500565_000514 Ga0500565_000514_389_1357 292
471 iso_pu_bacteria 2513237104 2513715409 292
472 iso_pu_bacteria 2517093001 2517105685 292
473 iso_pu_bacteria 2841957949 2841960572 292
474 iso_pu_bacteria 2908775508 2908777191 292
475 iso_pu_bacteria 3005483717 3005489736 292
476 iso_pu_bacteria 3005587118 3005592780 292
477 iso_pu_bacteria 8056967851 8056975355 292
478 3300002737 JGI25162J39368_1001990 JGI25162J39368_10019903 293
479 3300002772 JGI25164J39214_1000394 JGI25164J39214_10003948 293
480 3300005336 Ga0070680_100038486 Ga0070680_1000384864 293
481 3300005458 Ga0070681_10229443 Ga0070681_102294432 293
482 3300005530 Ga0070679_100256918 Ga0070679_1002569182 293
483 3300005616 Ga0068852_100437731 Ga0068852_1004377311 293
484 3300025231 Ga0207427_100105 Ga0207427_10010523 293
485 3300025233 Ga0209437_100129 Ga0209437_10012987 293
486 3300025261 Ga0209233_1000447 Ga0209233_100044723 293
487 3300025917 Ga0207660_10023502 Ga0207660_100235025 293
488 3300035410 Ga0373924_0006808 Ga0373924_0006808_566_1519 293
489 3300053136 Ga0500559_0031748 Ga0500559_0031748_630_1574 293
490 3300001990 JGI24737J22298_10048937 JGI24737J22298_100489371 294
491 3300003215 JGI25153J46596_10006692 JGI25153J46596_100066924 294
492 3300003215 JGI25153J46596_10032912 JGI25153J46596_100329122 294
493 3300003215 JGI25153J46596_10042047 JGI25153J46596_100420471 294
494 3300003320 rootH2_10000947 rootH2_100009471 294
495 3300003354 JGI25160J50197_1002717 JGI25160J50197_10027175 294
496 3300003354 JGI25160J50197_1006955 JGI25160J50197_10069553 294
497 3300003794 Ga0055531_10005040 Ga0055531_100050405 294
498 3300004625 Ga0055543_1009618 Ga0055543_10096181 294
499 3300005262 Ga0065165_1001167 Ga0065165_10011674 294
500 3300005262 Ga0065165_1002365 Ga0065165_10023654 294
501 3300005327 Ga0070658_10446848 Ga0070658_104468481 294
502 3300005331 Ga0070670_100182004 Ga0070670_1001820042 294
503 3300005339 Ga0070660_100302350 Ga0070660_1003023501 294
504 3300005347 Ga0070668_100091702 Ga0070668_1000917022 294
505 3300005347 Ga0070668_100475049 Ga0070668_1004750491 294
506 3300005353 Ga0070669_100115968 Ga0070669_1001159682 294
507 3300005355 Ga0070671_100214591 Ga0070671_1002145912 294
508 3300005455 Ga0070663_100032985 Ga0070663_1000329853 294
509 3300005459 Ga0068867_100320941 Ga0068867_1003209411 294
510 3300005578 Ga0068854_100090808 Ga0068854_1000908083 294
511 3300005616 Ga0068852_100152797 Ga0068852_1001527972 294
512 3300005616 Ga0068852_100352909 Ga0068852_1003529091 294
513 3300005618 Ga0068864_100296881 Ga0068864_1002968812 294
514 3300006038 Ga0075365_10065056 Ga0075365_100650563 294
515 3300006038 Ga0075365_10205596 Ga0075365_102055962 294
516 3300006042 Ga0075368_10002578 Ga0075368_100025783 294
517 3300006048 Ga0075363_100012959 Ga0075363_1000129593 294
518 3300006942 Ga0099824_1022009 Ga0099824_10220094 294
519 3300009093 Ga0105240_10642474 Ga0105240_106424742 294
520 3300009101 Ga0105247_10172246 Ga0105247_101722462 294
521 3300009148 Ga0105243_10036778 Ga0105243_100367783 294
522 3300009174 Ga0105241_10075194 Ga0105241_100751943 294
523 3300009545 Ga0105237_10002301 Ga0105237_100023016 294
524 3300009545 Ga0105237_10066311 Ga0105237_100663113 294
525 3300009545 Ga0105237_10724963 Ga0105237_107249631 294
526 3300009551 Ga0105238_10538331 Ga0105238_105383312 294
527 3300010375 Ga0105239_10035625 Ga0105239_100356253 294
528 3300010375 Ga0105239_10217029 Ga0105239_102170291 294
529 3300010375 Ga0105239_10648736 Ga0105239_106487362 294
530 3300011119 Ga0105246_10035946 Ga0105246_100359463 294
531 3300013296 Ga0157374_10131548 Ga0157374_101315483 294
532 3300014325 Ga0163163_10050743 Ga0163163_100507434 294
533 3300014745 Ga0157377_10102830 Ga0157377_101028301 294
534 3300014968 Ga0157379_10202799 Ga0157379_102027991 294
535 3300014969 Ga0157376_10127798 Ga0157376_101277982 294
536 3300021320 Ga0214544_1000011 Ga0214544_100001193 294
537 3300021321 Ga0214542_1000009 Ga0214542_1000009149 294
538 3300021324 Ga0214545_1000007 Ga0214545_100000793 294
539 3300021327 Ga0214543_1000020 Ga0214543_1000020149 294
540 3300025253 Ga0209677_105923 Ga0209677_1059232 294
541 3300025254 Ga0209148_1000267 Ga0209148_100026759 294
542 3300025272 Ga0209455_1001652 Ga0209455_10016522 294
543 3300025295 Ga0209564_1008688 Ga0209564_10086884 294
544 3300025297 Ga0209758_1000015 Ga0209758_1000015807 294
545 3300025297 Ga0209758_1000711 Ga0209758_100071126 294
546 3300025297 Ga0209758_1001468 Ga0209758_100146812 294
547 3300025297 Ga0209758_1001864 Ga0209758_10018642 294
548 3300025297 Ga0209758_1015428 Ga0209758_10154284 294
549 3300025299 Ga0209256_1004771 Ga0209256_10047714 294
550 3300025299 Ga0209256_1039820 Ga0209256_10398202 294
551 3300025302 Ga0207426_1001932 Ga0207426_100193210 294
552 3300025302 Ga0207426_1003610 Ga0207426_10036104 294
553 3300025302 Ga0207426_1008822 Ga0207426_10088224 294
554 3300025302 Ga0207426_1009528 Ga0207426_10095283 294
555 3300025302 Ga0207426_1021974 Ga0207426_10219741 294
556 3300025304 Ga0209257_1001688 Ga0209257_100168813 294
557 3300025304 Ga0209257_1018719 Ga0209257_10187193 294
558 3300025904 Ga0207647_10009749 Ga0207647_100097494 294
559 3300025911 Ga0207654_10028697 Ga0207654_100286971 294
560 3300025913 Ga0207695_10000059 Ga0207695_1000005953 294
561 3300025914 Ga0207671_10001109 Ga0207671_100011096 294
562 3300025914 Ga0207671_10180267 Ga0207671_101802671 294
563 3300025924 Ga0207694_10271954 Ga0207694_102719542 294
564 3300025932 Ga0207690_10081940 Ga0207690_100819402 294
565 3300025933 Ga0207706_10048646 Ga0207706_100486463 294
566 3300026067 Ga0207678_10278296 Ga0207678_102782962 294
567 3300026142 Ga0207698_10039785 Ga0207698_100397852 294
568 3300027296 Ga0209389_1000012 Ga0209389_1000012165 294
569 3300027296 Ga0209389_1000069 Ga0209389_100006956 294
570 3300027357 Ga0209589_1000077 Ga0209589_100007756 294
571 3300027361 Ga0209489_100019 Ga0209489_100019165 294
572 3300027361 Ga0209489_100020 Ga0209489_10002023 294
573 3300027363 Ga0209700_100018 Ga0209700_100018184 294
574 3300033180 Ga0307510_10010708 Ga0307510_100107086 294
575 3300033180 Ga0307510_10179538 Ga0307510_101795381 294
576 3300037418 Ga0395900_0001756 Ga0395900_0001756_20274_21158 294
577 3300037466 Ga0395898_0005085 Ga0395898_0005085_291_1175 294
578 3300037471 Ga0395905_0018632 Ga0395905_0018632_882_1766 294
579 3300037471 Ga0395905_0069928 Ga0395905_0069928_1939_2823 294
580 3300037853 Ga0436364_1482759 Ga0436364_1482759_143_1033 294
581 3300038443 Ga0395901_0017340 Ga0395901_0017340_3603_4487 294
582 3300038735 Ga0400485_12696 Ga0400485_12696_1749_2726 294
583 3300038741 Ga0400488_53103 Ga0400488_53103_4309_5223 294
584 3300039062 Ga0400483_172813 Ga0400483_172813_28309_29232 294
585 3300039110 Ga0400487_14482 Ga0400487_14482_1319_2233 294
586 3300039110 Ga0400487_16231 Ga0400487_16231_114_1040 294
587 3300039110 Ga0400487_28140 Ga0400487_28140_938_1861 294
588 3300039110 Ga0400487_55369 Ga0400487_55369_45241_46182 294
589 3300039437 Ga0436365_0016026 Ga0436365_0016026_75_965 294
590 3300041451 Ga0451791_0386492 Ga0451791_0386492_46_1020 294
591 3300041452 Ga0451793_1819141 Ga0451793_1819141_24_908 294
592 3300044658 Ga0466972_0000100 Ga0466972_0000100_40938_41822 294
593 3300044658 Ga0466972_0009241 Ga0466972_0009241_3465_4349 294
594 3300044683 Ga0466965_0045854 Ga0466965_0045854_157_1041 294
595 3300044684 Ga0466966_0000411 Ga0466966_0000411_22113_22997 294
596 3300044693 Ga0466961_0000065 Ga0466961_0000065_55590_56474 294
597 3300044693 Ga0466961_0157268 Ga0466961_0157268_282_1166 294
598 3300044694 Ga0466963_0125056 Ga0466963_0125056_542_1432 294
599 3300044706 Ga0466964_0028577 Ga0466964_0028577_904_1788 294
600 3300044706 Ga0466964_0101152 Ga0466964_0101152_190_1080 294
601 3300044735 Ga0466968_0031952 Ga0466968_0031952_940_1830 294
602 3300045049 Ga0466959_0000634 Ga0466959_0000634_11955_12839 294
603 3300045976 Ga0466967_0151733 Ga0466967_0151733_710_1600 294
604 3300046455 Ga0495603_0288446 Ga0495603_0288446_13_897 294
605 3300046459 Ga0495629_0006648 Ga0495629_0006648_1538_2422 294
606 3300046462 Ga0495651_0004449 Ga0495651_0004449_4368_5252 294
607 3300046463 Ga0495653_0055849 Ga0495653_0055849_694_1578 294
608 3300046471 Ga0495650_0075723 Ga0495650_0075723_217_1158 294
609 3300046477 Ga0495664_0080171 Ga0495664_0080171_782_1666 294
610 3300046512 Ga0495610_0074779 Ga0495610_0074779_168_1058 294
611 3300046514 Ga0495618_0192163 Ga0495618_0192163_220_1104 294
612 3300046516 Ga0495628_0031335 Ga0495628_0031335_1991_2875 294
613 3300046516 Ga0495628_0288955 Ga0495628_0288955_109_993 294
614 3300046518 Ga0495631_0113148 Ga0495631_0113148_169_1053 294
615 3300046524 Ga0495648_0012566 Ga0495648_0012566_2838_3728 294
616 3300046524 Ga0495648_0202857 Ga0495648_0202857_36_920 294
617 3300046529 Ga0495652_0005458 Ga0495652_0005458_5580_6464 294
618 3300046529 Ga0495652_0059495 Ga0495652_0059495_2287_3171 294
619 3300046529 Ga0495652_0262389 Ga0495652_0262389_81_965 294
620 3300046533 Ga0495640_0028879 Ga0495640_0028879_461_1345 294
621 3300046543 Ga0495645_0010468 Ga0495645_0010468_1563_2447 294
622 3300046557 Ga0495622_0038233 Ga0495622_0038233_701_1585 294
623 3300046559 Ga0495667_0005992 Ga0495667_0005992_1484_2368 294
624 3300046616 Ga0495668_0141576 Ga0495668_0141576_186_1076 294
625 3300046642 Ga0495634_0044463 Ga0495634_0044463_1108_1992 294
626 3300046663 Ga0495635_0039091 Ga0495635_0039091_1155_2039 294
627 3300046674 Ga0495588_0019843 Ga0495588_0019843_2049_2933 294
628 3300046675 Ga0495657_0002384 Ga0495657_0002384_1037_1921 294
629 3300046675 Ga0495657_0012411 Ga0495657_0012411_44_928 294
630 3300046678 Ga0495599_0049233 Ga0495599_0049233_773_1657 294
631 3300046679 Ga0495623_0013961 Ga0495623_0013961_1384_2268 294
632 3300046680 Ga0495646_0141415 Ga0495646_0141415_222_1106 294
633 3300046680 Ga0495646_0227456 Ga0495646_0227456_89_973 294
634 3300046689 Ga0495613_0015638 Ga0495613_0015638_2529_3413 294
635 3300046690 Ga0495624_0174103 Ga0495624_0174103_291_1175 294
636 3300046694 Ga0495649_0037274 Ga0495649_0037274_1452_2336 294
637 3300046809 Ga0495600_0021305 Ga0495600_0021305_2592_3476 294
638 3300046810 Ga0495660_0059670 Ga0495660_0059670_144_1034 294
639 3300047317 Ga0495604_0002741 Ga0495604_0002741_5541_6425 294
640 3300047317 Ga0495604_0085485 Ga0495604_0085485_173_1057 294
641 3300047319 Ga0495674_0265485 Ga0495674_0265485_207_1091 294
642 3300047321 Ga0495676_0050060 Ga0495676_0050060_1915_2799 294
643 3300047322 Ga0495680_0001876 Ga0495680_0001876_7340_8224 294
644 3300047443 Ga0495687_054245 Ga0495687_054245_57_947 294
645 3300047444 Ga0495675_0158377 Ga0495675_0158377_81_965 294
646 3300047472 Ga0495686_0217277 Ga0495686_0217277_160_1050 294
647 3300047673 Ga0495593_0102009 Ga0495593_0102009_547_1431 294
648 3300048088 Ga0495602_0027901 Ga0495602_0027901_4319_5203 294
649 3300048903 Ga0496100_0229514 Ga0496100_0229514_30_914 294
650 3300048904 Ga0496101_0362687 Ga0496101_0362687_76_960 294
651 3300048904 Ga0496101_0432120 Ga0496101_0432120_64_948 294
652 3300048907 Ga0496104_0009070 Ga0496104_0009070_385_1269 294
653 3300048908 Ga0496105_0036292 Ga0496105_0036292_922_1806 294
654 3300048908 Ga0496105_0109606 Ga0496105_0109606_564_1454 294
655 3300048908 Ga0496105_0207387 Ga0496105_0207387_667_1551 294
656 3300048909 Ga0496106_0484205 Ga0496106_0484205_84_974 294
657 3300048910 Ga0496107_0087292 Ga0496107_0087292_716_1600 294
658 3300048910 Ga0496107_0202694 Ga0496107_0202694_25_915 294
659 3300048911 Ga0496108_0215951 Ga0496108_0215951_709_1599 294
660 3300048912 Ga0496109_0194288 Ga0496109_0194288_999_1889 294
661 3300048913 Ga0496110_0238924 Ga0496110_0238924_736_1626 294
662 3300048914 Ga0496111_0435680 Ga0496111_0435680_41_931 294
663 3300048914 Ga0496111_0472800 Ga0496111_0472800_26_910 294
664 3300048915 Ga0496112_0208189 Ga0496112_0208189_184_1068 294
665 3300048915 Ga0496112_0240664 Ga0496112_0240664_101_991 294
666 3300048915 Ga0496112_0332894 Ga0496112_0332894_154_1038 294
667 3300048916 Ga0496113_0032035 Ga0496113_0032035_283_1167 294
668 3300048917 Ga0496114_0052300 Ga0496114_0052300_1014_1898 294
669 3300048919 Ga0496116_0038608 Ga0496116_0038608_184_1068 294
670 3300048920 Ga0496117_0189762 Ga0496117_0189762_255_1145 294
671 3300048921 Ga0496118_0118801 Ga0496118_0118801_629_1513 294
672 3300048922 Ga0496119_0007397 Ga0496119_0007397_310_1194 294
673 3300048923 Ga0496120_0030270 Ga0496120_0030270_163_1047 294
674 3300048924 Ga0496121_0039988 Ga0496121_0039988_505_1389 294
675 3300048924 Ga0496121_0049586 Ga0496121_0049586_700_1584 294
676 3300048927 Ga0496124_0128667 Ga0496124_0128667_711_1601 294
677 3300048928 Ga0496125_0009386 Ga0496125_0009386_2906_3796 294
678 3300049460 Ga0495682_0026858 Ga0495682_0026858_700_1584 294
679 3300050492 nmdc:mga0yw44_6610_c1 nmdc:mga0yw44_6610_c1_3498_4382 294
680 3300050516 nmdc:mga0sz30_29112_c1 nmdc:mga0sz30_29112_c1_1311_2201 294
681 3300053085 Ga0495619_0100733 Ga0495619_0100733_820_1704 294
682 3300053086 Ga0500578_0040493 Ga0500578_0040493_519_1409 294
683 3300053087 Ga0500643_000048 Ga0500643_000048_110042_110926 294
684 3300053093 Ga0500651_0091230 Ga0500651_0091230_427_1311 294
685 3300053094 Ga0500566_0001615 Ga0500566_0001615_4975_5859 294
686 3300053095 Ga0500640_119559 Ga0500640_119559_71_955 294
687 3300053096 Ga0500641_0056613 Ga0500641_0056613_644_1528 294
688 3300053103 Ga0500555_022477 Ga0500555_022477_341_1225 294
689 3300053104 Ga0500556_0028019 Ga0500556_0028019_703_1587 294
690 3300053105 Ga0500557_000083 Ga0500557_000083_19728_20612 294
691 3300053108 Ga0500562_068951 Ga0500562_068951_56_940 294
692 3300053109 Ga0500569_019125 Ga0500569_019125_125_1009 294
693 3300053125 Ga0500618_041719 Ga0500618_041719_138_1022 294
694 3300053130 Ga0500642_0005571 Ga0500642_0005571_781_1665 294
695 3300053133 Ga0500655_010286 Ga0500655_010286_647_1531 294
696 3300053133 Ga0500655_016281 Ga0500655_016281_16_900 294
697 3300053134 Ga0500658_0024606 Ga0500658_0024606_156_1040 294
698 3300053138 Ga0500564_052876 Ga0500564_052876_195_1079 294
699 3300053139 Ga0500568_0028888 Ga0500568_0028888_217_1101 294
700 3300053156 Ga0500622_0061141 Ga0500622_0061141_792_1676 294
701 3300053177 Ga0500636_0000148 Ga0500636_0000148_2440_3324 294
702 3300053729 Ga0500625_008986 Ga0500625_008986_2470_3354 294
703 3300053731 Ga0500609_006345 Ga0500609_006345_151_1035 294
704 3300053733 Ga0500552_000562 Ga0500552_000562_2082_2966 294
705 3300053737 Ga0500601_000280 Ga0500601_000280_8172_9056 294
706 3300055283 Ga0500661_005979 Ga0500661_005979_244_1134 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

59

118

0.98

PF03466

LysR_substrate

LysR substrate binding domain

142

348

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.955 1 84
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9528 1 84
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9511 1 81
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9383 1 84
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9362 1 84
ID Description Score Start End Superfamily
af_P37641_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9914 4 81 1.10.10.10
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9877 5 82 1.10.10.10
af_P76250_6_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9848 4 82 1.10.10.10
af_P77700_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9807 5 82 1.10.10.10
af_P45463_8_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9801 5 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A527IW94-F1-model_v4 deleted 0.9989 1 74
AF-A0A7H4MN97-F1-model_v4 LysR family transcriptional regulator 0.975 1 75 GO:0003700
GO:0006351
GO:0043565
AF-A0A7Y8HXQ6-F1-model_v4 LysR family transcriptional regulator 0.9746 4 80 GO:0000976
GO:0003700
AF-A0A527IW94-F1-model_v4 deleted 0.9726 1 74
AF-Q7UTS6-F1-model_v4 Probable transcription regulator, HTH_1 family 0.9697 1 83 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
92.63 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map