F476540

General Info

Members Datasets Scaffolds Average Seq Length
707 362 1414 198

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10183715|Ga0105248_101837154
Length 225
Sequence MAAAAREGNHPFLSDPGDAHIAWLPCEPLPADEIERLIALLAKLPGLGPRSARRAALALLKRRDQLLTPLSQALSDAAARVRPCSTCGALDSSDPCSVCADQSRDGALLCVVEEVGGLWALERAGAFRGRYHVLGGLLSALDGVGPQALRIEELVDRASEGEIREVILCLPATVDGQTTAHYLAERLQRSGVQVSMLARGVPVGGELDWLDDGTIAQALRARRPA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
271 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
286 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
290 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
296 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
297 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
301 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
304 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
307 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
308 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
311 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
326 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
330 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
331 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
332 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
333 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
334 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
335 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
336 2643221583 Caulobacter sp. Root655 Isolate Unclassified
337 2643221584 Caulobacter sp. Root656 Isolate Unclassified
338 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
339 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
340 2643221640 Caulobacter sp. Root342 Isolate Unclassified
341 2643221642 Caulobacter sp. Root343 Isolate Unclassified
342 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
343 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
344 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
345 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
346 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
347 2818991435 Caulobacter henricii 536 Isolate Unclassified
348 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
349 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
350 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
351 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
352 2849560528 Caulobacter zeae 410 Isolate Unclassified
353 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
354 2851153111 Caulobacter radicis 736 Isolate Unclassified
355 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
356 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
357 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
358 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
359 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
360 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
361 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
362 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0.28
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.52
Nodule 0.14
Rhizoplane 2.4
Rhizosphere 67.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10183715 3300009177 Bacteria 2356
2 JGI25151J46595_10001638 3300003187 Bacteria 14729
3 JGI25153J46596_10029638 3300003215 Bacteria 1875
4 JGI25153J46596_10065678 3300003215 Bacteria 963
5 rootH2_10001948 3300003320 Bacteria 38548
6 rootL2_10006616 3300003322 Bacteria 3279
7 rootL2_10006617 3300003322 Bacteria 3585
8 JGI25160J50197_1021509 3300003354 Bacteria 1915
9 Ga0006562J51391_1111710 3300003578 Bacteria 9152
10 Ga0006562J51391_1111713 3300003578 Bacteria 2620
11 Ga0055536_1004559 3300003781 Bacteria 7037
12 Ga0055536_1005300 3300003781 Bacteria 6346
13 Ga0055528_1002367 3300003790 Bacteria 10184
14 Ga0055530_10006066 3300003791 Bacteria 5521
15 Ga0055530_10007826 3300003791 Bacteria 4411
16 Ga0055531_10002677 3300003794 Bacteria 11744
17 Ga0055531_10003745 3300003794 Bacteria 9552
18 Ga0055531_10008281 3300003794 Bacteria 5522
19 Ga0055531_10018482 3300003794 Bacteria 2873
20 Ga0055531_10023037 3300003794 Bacteria 2351
21 Ga0055543_1033105 3300004625 Bacteria 895
22 Ga0065165_1000795 3300005262 Bacteria 42155
23 Ga0065165_1070464 3300005262 Bacteria 931
24 Ga0070658_10000691 3300005327 Bacteria 29223
25 Ga0070658_10498602 3300005327 Bacteria 1052
26 Ga0070683_100329810 3300005329 Bacteria 1453
27 Ga0070670_100000007 3300005331 Bacteria 318672
28 Ga0070670_100134389 3300005331 Bacteria 2137
29 Ga0070670_100140903 3300005331 Bacteria 2085
30 Ga0070670_100456351 3300005331 Bacteria 1133
31 Ga0068869_100099846 3300005334 Bacteria 2194
32 Ga0070680_100001636 3300005336 Bacteria 16368
33 Ga0070680_100003915 3300005336 Bacteria 11132
34 Ga0070660_100289335 3300005339 Bacteria 1342
35 Ga0070668_100000835 3300005347 Bacteria 21310
36 Ga0070668_100003294 3300005347 Bacteria 11919
37 Ga0070668_100006709 3300005347 Bacteria 8530
38 Ga0070668_100022598 3300005347 Bacteria 4756
39 Ga0070668_100030789 3300005347 Bacteria 4082
40 Ga0070669_100002041 3300005353 Bacteria 14610
41 Ga0070669_100796996 3300005353 Bacteria 803
42 Ga0070671_100002143 3300005355 Bacteria 15242
43 Ga0070671_100333770 3300005355 Bacteria 1293
44 Ga0070673_100203455 3300005364 Bacteria 1706
45 Ga0070659_100000209 3300005366 Bacteria 45573
46 Ga0070667_100000155 3300005367 Bacteria 85527
47 Ga0070667_100012748 3300005367 Bacteria 6950
48 Ga0070667_100052116 3300005367 Bacteria 3451
49 Ga0070667_100591387 3300005367 Bacteria 1022
50 Ga0070714_100294108 3300005435 Bacteria 1512
51 Ga0070663_100621157 3300005455 Bacteria 911
52 Ga0070678_100042562 3300005456 Bacteria 3229
53 Ga0070662_100219619 3300005457 Bacteria 1516
54 Ga0070681_10003919 3300005458 Bacteria 14028
55 Ga0070681_10019999 3300005458 Bacteria 6708
56 Ga0070679_100000920 3300005530 Bacteria 25588
57 Ga0068853_100049207 3300005539 Bacteria 3622
58 Ga0068853_100104064 3300005539 Bacteria 2513
59 Ga0070665_100000837 3300005548 Bacteria 40130
60 Ga0070665_100001961 3300005548 Bacteria 23155
61 Ga0070665_100004749 3300005548 Bacteria 14144
62 Ga0070665_100350930 3300005548 Bacteria 1481
63 Ga0070665_100443676 3300005548 Bacteria 1307
64 Ga0068855_100002736 3300005563 Bacteria 21720
65 Ga0068855_100068121 3300005563 Bacteria 4144
66 Ga0068855_100407262 3300005563 Bacteria 1489
67 Ga0070664_100002660 3300005564 Bacteria 14408
68 Ga0068854_100164781 3300005578 Bacteria 1720
69 Ga0068856_100088014 3300005614 Bacteria 3088
70 Ga0068859_100000930 3300005617 Bacteria 29992
71 Ga0068859_100013364 3300005617 Bacteria 8232
72 Ga0068859_100058614 3300005617 Bacteria 3879
73 Ga0068864_100000067 3300005618 Bacteria 115834
74 Ga0068864_100000128 3300005618 Bacteria 73813
75 Ga0068864_100004938 3300005618 Bacteria 10927
76 Ga0068864_100921093 3300005618 Bacteria 864
77 Ga0068863_100000237 3300005841 Bacteria 58657
78 Ga0068863_100000360 3300005841 Bacteria 46300
79 Ga0068863_100001315 3300005841 Bacteria 24750
80 Ga0068863_100028144 3300005841 Bacteria 5366
81 Ga0068863_100115230 3300005841 Bacteria 2561
82 Ga0068858_100005137 3300005842 Bacteria 12825
83 Ga0068858_100064368 3300005842 Bacteria 3394
84 Ga0068858_100830981 3300005842 Bacteria 902
85 Ga0068860_100000047 3300005843 Bacteria 213287
86 Ga0068860_100000226 3300005843 Bacteria 87552
87 Ga0068860_100063847 3300005843 Bacteria 3497
88 Ga0068860_100147841 3300005843 Bacteria 2262
89 Ga0068860_100720602 3300005843 Bacteria 1008
90 Ga0068862_100001031 3300005844 Bacteria 26791
91 Ga0068862_100010926 3300005844 Bacteria 7497
92 Ga0068862_100024798 3300005844 Bacteria 5032
93 Ga0068862_100110357 3300005844 Bacteria 2414
94 Ga0081455_10076737 3300005937 Bacteria 2751
95 Ga0081455_10099108 3300005937 Bacteria 2344
96 Ga0081539_10009430 3300005985 Bacteria 8160
97 Ga0075365_10328677 3300006038 Bacteria 1077
98 Ga0075363_100150220 3300006048 Bacteria 1315
99 Ga0075364_10001761 3300006051 Bacteria 11966
100 Ga0075362_10064516 3300006177 Bacteria 1662
101 Ga0075367_10000883 3300006178 Bacteria 12032
102 Ga0075367_10047761 3300006178 Bacteria 2519
103 Ga0075369_10090610 3300006186 Bacteria 1364
104 Ga0075370_10005916 3300006353 Bacteria 6119
105 Ga0075370_10085789 3300006353 Bacteria 1813
106 Ga0075370_10128855 3300006353 Bacteria 1476
107 Ga0075370_10268917 3300006353 Bacteria 1012
108 Ga0068871_100125155 3300006358 Bacteria 2175
109 Ga0068865_100006112 3300006881 Bacteria 7342
110 Ga0097620_100000930 3300006931 Bacteria 29992
111 Ga0097620_100013364 3300006931 Bacteria 8232
112 Ga0097620_100058614 3300006931 Bacteria 3879
113 Ga0105240_10006042 3300009093 Bacteria 17895
114 Ga0105240_10029450 3300009093 Bacteria 7152
115 Ga0105240_10247609 3300009093 Bacteria 2063
116 Ga0105240_10457353 3300009093 Bacteria 1427
117 Ga0105240_10492270 3300009093 Bacteria 1365
118 Ga0105245_10119836 3300009098 Bacteria 2457
119 Ga0105245_10264801 3300009098 Bacteria 1674
120 Ga0105245_10711432 3300009098 Bacteria 1038
121 Ga0105245_11342609 3300009098 Bacteria 764
122 Ga0105247_10226381 3300009101 Bacteria 1268
123 Ga0105243_10433963 3300009148 Bacteria 1228
124 Ga0105243_10485363 3300009148 Bacteria 1167
125 Ga0105243_11275127 3300009148 Bacteria 751
126 Ga0105242_10274349 3300009176 Bacteria 1529
127 Ga0105248_10000517 3300009177 Bacteria 43853
128 Ga0105248_10003956 3300009177 Bacteria 16383
129 Ga0105248_10040989 3300009177 Bacteria 5192
130 Ga0105248_10125467 3300009177 Bacteria 2896
131 Ga0105248_10366643 3300009177 Bacteria 1622
132 Ga0105248_10400924 3300009177 Bacteria 1544
133 Ga0105237_10109011 3300009545 Bacteria 2760
134 Ga0105237_10760747 3300009545 Bacteria 975
135 Ga0105238_10032406 3300009551 Bacteria 5318
136 Ga0105238_10139712 3300009551 Bacteria 2399
137 Ga0105238_10173047 3300009551 Bacteria 2136
138 Ga0105238_10203161 3300009551 Bacteria 1957
139 Ga0105238_10437498 3300009551 Bacteria 1304
140 Ga0105249_10001758 3300009553 Bacteria 18894
141 Ga0105249_10127470 3300009553 Bacteria 2425
142 Ga0105239_10184677 3300010375 Bacteria 2333
143 Ga0105239_10324199 3300010375 Bacteria 1737
144 Ga0157373_10001725 3300013100 Bacteria 16609
145 Ga0157373_10004265 3300013100 Bacteria 10768
146 Ga0157370_10017626 3300013104 Bacteria 7200
147 Ga0157369_10940894 3300013105 Bacteria 886
148 Ga0157369_11068307 3300013105 Bacteria 826
149 Ga0157372_10403769 3300013307 Bacteria 1592
150 Ga0157375_10040775 3300013308 Bacteria 4479
151 Ga0163163_10002788 3300014325 Bacteria 14762
152 Ga0163163_10021531 3300014325 Bacteria 6086
153 Ga0163163_10319343 3300014325 Bacteria 1607
154 Ga0163163_10507164 3300014325 Bacteria 1268
155 Ga0157380_11383713 3300014326 Bacteria 754
156 Ga0157379_10010392 3300014968 Bacteria 8109
157 Ga0157379_10039266 3300014968 Bacteria 4223
158 Ga0157379_10069595 3300014968 Bacteria 3148
159 Ga0163161_10209264 3300017792 Bacteria 1506
160 Ga0213872_10032017 3300021361 Bacteria 2410
161 Ga0213874_10033925 3300021377 Bacteria 1491
162 Ga0213876_10000081 3300021384 Bacteria 108997
163 Ga0213876_10103573 3300021384 Bacteria 1509
164 Ga0213876_10146159 3300021384 Bacteria 1257
165 Ga0209026_1001197 3300025250 Bacteria 12016
166 Ga0209148_1005548 3300025254 Bacteria 2877
167 Ga0209565_1000179 3300025263 Bacteria 79300
168 Ga0209673_1001719 3300025273 Bacteria 18427
169 Ga0209130_1000512 3300025284 Bacteria 39134
170 Ga0209675_1028681 3300025291 Bacteria 1350
171 Ga0209676_1000253 3300025292 Bacteria 113412
172 Ga0209676_1002091 3300025292 Bacteria 15424
173 Ga0209025_1000114 3300025294 Bacteria 218921
174 Ga0209564_1002926 3300025295 Bacteria 12410
175 Ga0209564_1018550 3300025295 Bacteria 2645
176 Ga0209758_1000562 3300025297 Bacteria 58446
177 Ga0209758_1000894 3300025297 Bacteria 40579
178 Ga0209758_1001428 3300025297 Bacteria 28251
179 Ga0209758_1002432 3300025297 Bacteria 19004
180 Ga0209050_1000173 3300025298 Bacteria 149800
181 Ga0209050_1000649 3300025298 Bacteria 53856
182 Ga0209050_1001201 3300025298 Bacteria 30402
183 Ga0209050_1013251 3300025298 Bacteria 3681
184 Ga0209256_1007675 3300025299 Bacteria 5241
185 Ga0209256_1015897 3300025299 Bacteria 2602
186 Ga0209256_1020239 3300025299 Bacteria 2084
187 Ga0207426_1000181 3300025302 Bacteria 158308
188 Ga0207426_1007086 3300025302 Bacteria 4741
189 Ga0209051_1004510 3300025303 Bacteria 8546
190 Ga0209257_1000196 3300025304 Bacteria 149656
191 Ga0209257_1000427 3300025304 Bacteria 81007
192 Ga0209257_1002800 3300025304 Bacteria 16403
193 Ga0209257_1005712 3300025304 Bacteria 8542
194 Ga0207680_10061594 3300025903 Bacteria 2289
195 Ga0207705_10003988 3300025909 Bacteria 11228
196 Ga0207705_10215672 3300025909 Bacteria 1456
197 Ga0207705_10372212 3300025909 Bacteria 1103
198 Ga0207705_10854544 3300025909 Bacteria 706
199 Ga0207707_10000991 3300025912 Bacteria 27315
200 Ga0207695_10000572 3300025913 Bacteria 75360
201 Ga0207695_10007614 3300025913 Bacteria 13721
202 Ga0207695_10013848 3300025913 Bacteria 9593
203 Ga0207695_10014639 3300025913 Bacteria 9276
204 Ga0207695_10463694 3300025913 Bacteria 1150
205 Ga0207671_10177142 3300025914 Bacteria 1658
206 Ga0207660_10005036 3300025917 Bacteria 8610
207 Ga0207660_10007574 3300025917 Bacteria 7028
208 Ga0207660_10281558 3300025917 Bacteria 1320
209 Ga0207657_10136326 3300025919 Bacteria 2008
210 Ga0207649_10400556 3300025920 Bacteria 1027
211 Ga0207652_10003273 3300025921 Bacteria 13419
212 Ga0207681_10003889 3300025923 Bacteria 9273
213 Ga0207681_10691844 3300025923 Bacteria 847
214 Ga0207694_10152430 3300025924 Bacteria 1863
215 Ga0207694_10678058 3300025924 Bacteria 869
216 Ga0207694_10735518 3300025924 Bacteria 832
217 Ga0207650_10000030 3300025925 Bacteria 235824
218 Ga0207650_10094286 3300025925 Bacteria 2293
219 Ga0207650_10188888 3300025925 Bacteria 1645
220 Ga0207687_10475036 3300025927 Bacteria 1040
221 Ga0207687_10669417 3300025927 Bacteria 879
222 Ga0207664_10207052 3300025929 Bacteria 1696
223 Ga0207644_10000907 3300025931 Bacteria 18778
224 Ga0207644_10157344 3300025931 Bacteria 1763
225 Ga0207644_10183025 3300025931 Bacteria 1643
226 Ga0207690_10000116 3300025932 Bacteria 65776
227 Ga0207706_10117019 3300025933 Bacteria 2344
228 Ga0207686_10197441 3300025934 Bacteria 1439
229 Ga0207709_10284543 3300025935 Bacteria 1222
230 Ga0207711_10000669 3300025941 Bacteria 34078
231 Ga0207711_10001710 3300025941 Bacteria 20197
232 Ga0207711_10002365 3300025941 Bacteria 16890
233 Ga0207711_10035152 3300025941 Bacteria 4246
234 Ga0207711_10078303 3300025941 Bacteria 2883
235 Ga0207711_10149504 3300025941 Bacteria 2107
236 Ga0207689_10054823 3300025942 Bacteria 3282
237 Ga0207679_10004250 3300025945 Bacteria 8902
238 Ga0207679_10142440 3300025945 Bacteria 1940
239 Ga0207667_10003535 3300025949 Bacteria 19325
240 Ga0207667_10060083 3300025949 Bacteria 3979
241 Ga0207667_10079569 3300025949 Bacteria 3397
242 Ga0207667_10095078 3300025949 Bacteria 3076
243 Ga0207667_10504864 3300025949 Bacteria 1226
244 Ga0207651_10189711 3300025960 Bacteria 1638
245 Ga0207712_10000758 3300025961 Bacteria 24361
246 Ga0207668_10000010 3300025972 Bacteria 185249
247 Ga0207668_10000108 3300025972 Bacteria 59119
248 Ga0207668_10002370 3300025972 Bacteria 11009
249 Ga0207668_10010421 3300025972 Bacteria 5614
250 Ga0207668_10024326 3300025972 Bacteria 3907
251 Ga0207640_10345286 3300025981 Bacteria 1194
252 Ga0207658_10000265 3300025986 Bacteria 55108
253 Ga0207658_10044033 3300025986 Bacteria 3248
254 Ga0207658_10072468 3300025986 Bacteria 2611
255 Ga0207658_10086970 3300025986 Bacteria 2412
256 Ga0207658_10596361 3300025986 Bacteria 992
257 Ga0207677_10130839 3300026023 Bacteria 1905
258 Ga0207677_11034575 3300026023 Bacteria 746
259 Ga0207703_10000082 3300026035 Bacteria 110579
260 Ga0207703_10014762 3300026035 Bacteria 6097
261 Ga0207703_10020945 3300026035 Bacteria 5116
262 Ga0207703_10194158 3300026035 Bacteria 1800
263 Ga0207703_10434040 3300026035 Bacteria 1224
264 Ga0207639_10022198 3300026041 Bacteria 4569
265 Ga0207639_10154333 3300026041 Bacteria 1927
266 Ga0207639_11089405 3300026041 Bacteria 749
267 Ga0207702_10042818 3300026078 Bacteria 3800
268 Ga0207702_10346680 3300026078 Bacteria 1420
269 Ga0207641_10000007 3300026088 Bacteria 441443
270 Ga0207641_10001651 3300026088 Bacteria 21777
271 Ga0207641_10007794 3300026088 Bacteria 8898
272 Ga0207641_10166119 3300026088 Bacteria 2010
273 Ga0207641_10271717 3300026088 Bacteria 1591
274 Ga0207641_10548126 3300026088 Bacteria 1127
275 Ga0207676_10000183 3300026095 Bacteria 55220
276 Ga0207676_10000241 3300026095 Bacteria 47707
277 Ga0207676_10017590 3300026095 Bacteria 5183
278 Ga0207676_10357631 3300026095 Bacteria 1352
279 Ga0207676_11274646 3300026095 Bacteria 729
280 Ga0207674_10158408 3300026116 Bacteria 2219
281 Ga0207675_100107085 3300026118 Bacteria 2636
282 Ga0207675_100656774 3300026118 Bacteria 1055
283 Ga0207675_100721546 3300026118 Bacteria 1007
284 Ga0207683_10015037 3300026121 Bacteria 6587
285 Ga0207698_10213695 3300026142 Bacteria 1737
286 Ga0207698_11287074 3300026142 Bacteria 746
287 Ga0209281_1013891 3300027111 Bacteria 1721
288 Ga0209813_10032610 3300027866 Bacteria 1545
289 Ga0268266_10000003 3300028379 Bacteria 1701703
290 Ga0268266_10000656 3300028379 Bacteria 46813
291 Ga0268266_10005366 3300028379 Bacteria 11979
292 Ga0268266_10218545 3300028379 Bacteria 1751
293 Ga0268266_10240639 3300028379 Bacteria 1670
294 Ga0268266_10443235 3300028379 Bacteria 1233
295 Ga0268265_10001171 3300028380 Bacteria 22981
296 Ga0268265_10006429 3300028380 Bacteria 7965
297 Ga0268265_10038568 3300028380 Bacteria 3515
298 Ga0268265_10055110 3300028380 Bacteria 3020
299 Ga0268265_10057571 3300028380 Bacteria 2963
300 Ga0268265_10112329 3300028380 Bacteria 2227
301 Ga0268265_10127299 3300028380 Bacteria 2110
302 Ga0268265_10221228 3300028380 Bacteria 1657
303 Ga0268264_10000110 3300028381 Bacteria 206663
304 Ga0268264_10000125 3300028381 Bacteria 186416
305 Ga0268264_10037317 3300028381 Bacteria 4006
306 Ga0268264_10105324 3300028381 Bacteria 2460
307 Ga0268264_10119463 3300028381 Bacteria 2321
308 Ga0268264_10648218 3300028381 Bacteria 1045
309 Ga0268264_10747980 3300028381 Bacteria 974
310 Ga0265337_1007448 3300028556 Bacteria 4094
311 Ga0265326_10008000 3300028558 Bacteria 3211
312 Ga0307517_10001402 3300028786 Bacteria 40531
313 Ga0307517_10059611 3300028786 Bacteria 3651
314 Ga0307517_10320056 3300028786 Bacteria 859
315 Ga0307515_10005814 3300028794 Bacteria 24897
316 Ga0307515_10085154 3300028794 Bacteria 4049
317 Ga0265338_10025285 3300028800 Bacteria 6031
318 Ga0265338_10028732 3300028800 Bacteria 5537
319 Ga0265338_10031038 3300028800 Bacteria 5247
320 Ga0265338_10052621 3300028800 Bacteria 3651
321 Ga0265338_10058720 3300028800 Bacteria 3393
322 Ga0265338_10671416 3300028800 Bacteria 717
323 Ga0265324_10081898 3300029957 Bacteria 1098
324 Ga0265340_10243103 3300031247 Bacteria 803
325 Ga0265327_10000130 3300031251 Bacteria 165066
326 Ga0265327_10002013 3300031251 Bacteria 22950
327 Ga0265327_10044047 3300031251 Bacteria 2382
328 Ga0265316_10729134 3300031344 Bacteria 698
329 Ga0307513_10000077 3300031456 Bacteria 134167
330 Ga0307513_10003700 3300031456 Bacteria 20671
331 Ga0307513_10010991 3300031456 Bacteria 11295
332 Ga0307513_10022306 3300031456 Bacteria 7446
333 Ga0307513_10140360 3300031456 Bacteria 2344
334 Ga0307513_10216508 3300031456 Bacteria 1741
335 Ga0307513_10405850 3300031456 Bacteria 1096
336 Ga0307408_100268800 3300031548 Bacteria 1415
337 Ga0265313_10174950 3300031595 Bacteria 905
338 Ga0265314_10008476 3300031711 Bacteria 8799
339 Ga0265314_10081291 3300031711 Bacteria 2136
340 Ga0265314_10246885 3300031711 Bacteria 1027
341 Ga0265342_10080481 3300031712 Bacteria 1882
342 Ga0307516_10000001 3300031730 Bacteria 510338
343 Ga0307405_10290772 3300031731 Bacteria 1235
344 Ga0307413_10018776 3300031824 Bacteria 3636
345 Ga0307410_10287561 3300031852 Bacteria 1293
346 Ga0307410_10442740 3300031852 Bacteria 1058
347 Ga0307406_10409942 3300031901 Bacteria 1077
348 Ga0307407_10083402 3300031903 Bacteria 1939
349 Ga0307407_10458433 3300031903 Bacteria 927
350 Ga0307409_100020575 3300031995 Bacteria 4501
351 Ga0307414_10512579 3300032004 Bacteria 1063
352 Ga0307411_10147329 3300032005 Bacteria 1744
353 Ga0307415_100741727 3300032126 Bacteria 891
354 Ga0307510_10002396 3300033180 Bacteria 21254
355 Ga0307510_10104784 3300033180 Bacteria 2600
356 Ga0373944_0003544 3300035089 Bacteria 4036
357 Ga0373936_0004632 3300035113 Bacteria 5201
358 Ga0373941_0029632 3300035115 Bacteria 1616
359 Ga0373960_0023318 3300035121 Bacteria 1666
360 Ga0373942_0004841 3300035207 Bacteria 3126
361 Ga0373927_0000472 3300035695 Bacteria 30834
362 Ga0373933_0203689 3300035724 Bacteria 1267
363 Ga0373947_0243254 3300035725 Bacteria 1188
364 Ga0373937_0097527 3300036401 Bacteria 2727
365 Ga0373937_0237520 3300036401 Bacteria 1717
366 Ga0373925_0000003 3300037068 Bacteria 362401
367 Ga0373925_0025075 3300037068 Bacteria 4355
368 Ga0395899_0000016 3300037312 Bacteria 468322
369 Ga0395899_0000498 3300037312 Bacteria 43627
370 Ga0395899_0141846 3300037312 Bacteria 1709
371 Ga0395900_0000008 3300037418 Bacteria 480459
372 Ga0395900_0083540 3300037418 Bacteria 3281
373 Ga0395900_0308438 3300037418 Bacteria 1566
374 Ga0395900_0453618 3300037418 Bacteria 1238
375 Ga0395898_0062872 3300037466 Bacteria 3603
376 Ga0395898_0079926 3300037466 Bacteria 3153
377 Ga0395905_0001355 3300037471 Bacteria 29823
378 Ga0395905_0009683 3300037471 Bacteria 9406
379 Ga0395905_0154768 3300037471 Bacteria 2156
380 Ga0395905_0307066 3300037471 Bacteria 1475
381 Ga0395905_0525428 3300037471 Bacteria 1084
382 Ga0436364_0481903 3300037853 Bacteria 2556
383 Ga0436364_0882847 3300037853 Bacteria 3537
384 Ga0395901_0000008 3300038443 Bacteria 495962
385 Ga0395901_0119434 3300038443 Bacteria 2770
386 Ga0395901_0197473 3300038443 Bacteria 2109
387 Ga0395901_0205575 3300038443 Bacteria 2063
388 Ga0395901_0288213 3300038443 Bacteria 1704
389 Ga0436365_0187494 3300039437 Bacteria 67801
390 Ga0436365_0368117 3300039437 Bacteria 3063
391 Ga0436365_0884483 3300039437 Bacteria 9260
392 Ga0436365_1923138 3300039437 Bacteria 1485
393 Ga0436360_0945988 3300039438 Bacteria 894
394 Ga0436360_1148462 3300039438 Bacteria 2296
395 Ga0436360_1296374 3300039438 Bacteria 1627
396 Ga0436361_0104010 3300039447 Bacteria 17086
397 Ga0436361_0564979 3300039447 Bacteria 1999
398 Ga0436361_0741749 3300039447 Bacteria 2739
399 Ga0436361_1172229 3300039447 Bacteria 3117
400 Ga0436363_1475916 3300039450 Bacteria 4420
401 Ga0439438_102225 3300041405 Bacteria 695
402 Ga0439431_0076912 3300041997 Bacteria 896
403 Ga0439446_0086344 3300042156 Bacteria 977
404 Ga0439435_0014860 3300042436 Bacteria 1929
405 Ga0450901_002375 3300042533 Bacteria 2037
406 Ga0466966_0144037 3300044684 Bacteria 1455
407 Ga0466966_0241279 3300044684 Bacteria 1090
408 Ga0466968_0099559 3300044735 Bacteria 1296
409 Ga0466960_0047359 3300044901 Bacteria 2062
410 Ga0495617_053556 3300046452 Bacteria 1340
411 Ga0495627_004929 3300046453 Bacteria 5487
412 Ga0495590_0022517 3300046457 Bacteria 2228
413 Ga0495629_0019869 3300046459 Bacteria 4794
414 Ga0495638_0000530 3300046460 Bacteria 44348
415 Ga0495638_0001235 3300046460 Bacteria 24108
416 Ga0495638_0005396 3300046460 Bacteria 9525
417 Ga0495638_0008848 3300046460 Bacteria 7106
418 Ga0495638_0009539 3300046460 Bacteria 6801
419 Ga0495638_0266893 3300046460 Bacteria 936
420 Ga0495653_0541692 3300046463 Bacteria 721
421 Ga0495650_0000024 3300046471 Bacteria 496674
422 Ga0495650_0061598 3300046471 Bacteria 1502
423 Ga0495650_0077380 3300046471 Bacteria 1291
424 Ga0495583_0000003 3300046506 Bacteria 709273
425 Ga0495583_0028948 3300046506 Bacteria 2716
426 Ga0495583_0063093 3300046506 Bacteria 1648
427 Ga0495583_0195837 3300046506 Bacteria 823
428 Ga0495606_0038419 3300046507 Bacteria 3239
429 Ga0495606_0083232 3300046507 Bacteria 1984
430 Ga0495610_0000478 3300046512 Bacteria 41250
431 Ga0495610_0000679 3300046512 Bacteria 32891
432 Ga0495610_0007161 3300046512 Bacteria 7507
433 Ga0495616_0000099 3300046513 Bacteria 73607
434 Ga0495616_0028726 3300046513 Bacteria 2941
435 Ga0495620_0027085 3300046515 Bacteria 2687
436 Ga0495630_0318924 3300046517 Bacteria 1188
437 Ga0495631_0007265 3300046518 Bacteria 5645
438 Ga0495632_0005209 3300046519 Bacteria 8667
439 Ga0495637_0003545 3300046520 Bacteria 8271
440 Ga0495637_0073993 3300046520 Bacteria 1369
441 Ga0495643_0006929 3300046522 Bacteria 7373
442 Ga0495648_0000634 3300046524 Bacteria 37553
443 Ga0495648_0157746 3300046524 Bacteria 1176
444 Ga0495642_0219450 3300046528 Bacteria 830
445 Ga0495652_0058471 3300046529 Bacteria 3264
446 Ga0495654_0000135 3300046530 Bacteria 77516
447 Ga0495654_0146032 3300046530 Bacteria 1050
448 Ga0495654_0180499 3300046530 Bacteria 914
449 Ga0495609_0060216 3300046538 Bacteria 1679
450 Ga0495621_0179988 3300046539 Bacteria 843
451 Ga0495597_0207097 3300046542 Bacteria 783
452 Ga0495645_0057116 3300046543 Bacteria 2834
453 Ga0495622_0000762 3300046557 Bacteria 18003
454 Ga0495633_0000423 3300046558 Bacteria 43996
455 Ga0495633_0117414 3300046558 Bacteria 1233
456 Ga0495668_0000291 3300046616 Bacteria 68802
457 Ga0495668_0005259 3300046616 Bacteria 8860
458 Ga0495668_0019454 3300046616 Bacteria 3913
459 Ga0495668_0021477 3300046616 Bacteria 3701
460 Ga0495668_0039891 3300046616 Bacteria 2620
461 Ga0495668_0093250 3300046616 Bacteria 1649
462 Ga0495668_0115627 3300046616 Bacteria 1467
463 Ga0495625_0001134 3300046660 Bacteria 34437
464 Ga0495625_0003614 3300046660 Bacteria 15193
465 Ga0495625_0010213 3300046660 Bacteria 7789
466 Ga0495625_0031018 3300046660 Bacteria 3979
467 Ga0495625_0040043 3300046660 Bacteria 3420
468 Ga0495625_0070340 3300046660 Bacteria 2457
469 Ga0495625_0191523 3300046660 Bacteria 1354
470 Ga0495588_0266618 3300046674 Bacteria 902
471 Ga0495669_0000044 3300046684 Bacteria 85633
472 Ga0495669_0000152 3300046684 Bacteria 44284
473 Ga0495669_0026139 3300046684 Bacteria 2550
474 Ga0495669_0055181 3300046684 Bacteria 1789
475 Ga0495669_0137431 3300046684 Bacteria 1153
476 Ga0495613_0004090 3300046689 Bacteria 10901
477 Ga0495613_0253042 3300046689 Bacteria 1229
478 Ga0495624_0258863 3300046690 Bacteria 1052
479 Ga0495671_0146783 3300046692 Bacteria 1148
480 Ga0495671_0147930 3300046692 Bacteria 1144
481 Ga0495671_0290240 3300046692 Bacteria 787
482 Ga0495649_0000262 3300046694 Bacteria 46820
483 Ga0495589_0028088 3300046794 Bacteria 2841
484 Ga0495660_0059882 3300046810 Bacteria 2047
485 Ga0495672_0000784 3300047320 Bacteria 34445
486 Ga0495672_0004858 3300047320 Bacteria 10818
487 Ga0495672_0028037 3300047320 Bacteria 3570
488 Ga0495683_0117628 3300047323 Bacteria 1264
489 Ga0495687_044573 3300047443 Bacteria 1927
490 Ga0495677_0146016 3300047445 Bacteria 909
491 Ga0495677_0207543 3300047445 Bacteria 762
492 Ga0495679_003275 3300047446 Bacteria 7844
493 Ga0495673_0000340 3300047469 Bacteria 59502
494 Ga0495673_0001300 3300047469 Bacteria 20332
495 Ga0495673_0003929 3300047469 Bacteria 9530
496 Ga0495673_0218700 3300047469 Bacteria 706
497 Ga0495681_0017489 3300047470 Bacteria 3978
498 Ga0495681_0031241 3300047470 Bacteria 2699
499 Ga0495686_0001205 3300047472 Bacteria 29808
500 Ga0495686_0004549 3300047472 Bacteria 11369
501 Ga0495686_0022417 3300047472 Bacteria 4180
502 Ga0495686_0035200 3300047472 Bacteria 3221
503 Ga0495686_0037968 3300047472 Bacteria 3084
504 Ga0495686_0043703 3300047472 Bacteria 2839
505 Ga0495593_0071401 3300047673 Bacteria 1803
506 Ga0496101_0009511 3300048904 Bacteria 6388
507 Ga0496101_0059471 3300048904 Bacteria 2770
508 Ga0496102_0011792 3300048905 Bacteria 7543
509 Ga0496106_0004442 3300048909 Bacteria 10395
510 Ga0496106_0529481 3300048909 Bacteria 946
511 Ga0496106_0553305 3300048909 Bacteria 923
512 Ga0496107_0000987 3300048910 Bacteria 16906
513 Ga0496107_0104495 3300048910 Bacteria 2079
514 Ga0496108_0054241 3300048911 Bacteria 3364
515 Ga0496112_0227562 3300048915 Bacteria 1820
516 Ga0496115_0000126 3300048918 Bacteria 69044
517 Ga0496115_0003595 3300048918 Bacteria 11143
518 Ga0496115_0013222 3300048918 Bacteria 6236
519 Ga0496115_0039144 3300048918 Bacteria 3765
520 Ga0496115_0050885 3300048918 Bacteria 3321
521 Ga0496115_0191913 3300048918 Bacteria 1688
522 Ga0496115_0679669 3300048918 Bacteria 811
523 Ga0496116_0212130 3300048919 Bacteria 1002
524 Ga0496117_0116167 3300048920 Bacteria 1654
525 Ga0496118_0031844 3300048921 Bacteria 4361
526 Ga0496119_0059930 3300048922 Bacteria 2282
527 Ga0496121_0000035 3300048924 Bacteria 374316
528 Ga0496121_0007098 3300048924 Bacteria 13597
529 Ga0496121_0139465 3300048924 Bacteria 1801
530 Ga0496121_0354203 3300048924 Bacteria 976
531 Ga0496121_0475548 3300048924 Bacteria 799
532 Ga0496122_0002454 3300048925 Bacteria 26240
533 Ga0496123_0004303 3300048926 Bacteria 15121
534 Ga0496124_0145643 3300048927 Bacteria 1864
535 Ga0496124_0389121 3300048927 Bacteria 972
536 Ga0496124_0518894 3300048927 Bacteria 794
537 Ga0496125_0047317 3300048928 Bacteria 3599
538 Ga0496125_0078633 3300048928 Bacteria 2534
539 Ga0496126_0167919 3300048929 Bacteria 1871
540 Ga0495678_000699 3300049459 Bacteria 30520
541 Ga0501033_0005322 3300049570 Bacteria 10196
542 Ga0501033_0076362 3300049570 Bacteria 2459
543 Ga0501033_0231933 3300049570 Bacteria 1311
544 Ga0501034_0013241 3300049571 Bacteria 8498
545 Ga0501034_0086368 3300049571 Bacteria 3138
546 Ga0501034_0088709 3300049571 Bacteria 3090
547 Ga0501034_0222240 3300049571 Bacteria 1841
548 Ga0501036_0013734 3300049572 Bacteria 6733
549 Ga0501037_0078237 3300049573 Bacteria 2400
550 Ga0501037_0147796 3300049573 Bacteria 1680
551 Ga0501038_0078567 3300049574 Bacteria 2784
552 Ga0501043_0593111 3300049579 Bacteria 819
553 Ga0501046_0007634 3300049580 Bacteria 9486
554 Ga0501047_0020536 3300049581 Bacteria 6340
555 Ga0501047_0232637 3300049581 Bacteria 1696
556 Ga0501048_0133585 3300049582 Bacteria 1753
557 Ga0501048_0331697 3300049582 Bacteria 1084
558 Ga0501067_0083838 3300049583 Bacteria 1768
559 Ga0501067_0199285 3300049583 Bacteria 1115
560 Ga0501068_0110266 3300049584 Bacteria 1710
561 Ga0501069_0089060 3300049585 Bacteria 1744
562 Ga0501070_0038246 3300049586 Bacteria 4003
563 Ga0501071_0205616 3300049587 Bacteria 1480
564 Ga0501072_0020753 3300049588 Bacteria 5092
565 Ga0501072_0430716 3300049588 Bacteria 1045
566 Ga0501073_0007955 3300049589 Bacteria 7867
567 Ga0501074_0013123 3300049590 Bacteria 6023
568 Ga0501076_0282774 3300049592 Bacteria 1359
569 Ga0501238_002038 3300049671 Bacteria 2374
570 Ga0501238_015871 3300049671 Bacteria 1041
571 Ga0501257_078181 3300049686 Bacteria 851
572 Ga0501079_0223183 3300049741 Bacteria 1472
573 Ga0501080_0003547 3300049742 Bacteria 13746
574 Ga0501083_0047271 3300049744 Bacteria 2908
575 Ga0501083_0061207 3300049744 Bacteria 2513
576 Ga0501083_0124013 3300049744 Bacteria 1693
577 Ga0501083_0150451 3300049744 Bacteria 1524
578 Ga0501083_0338908 3300049744 Bacteria 978
579 Ga0501035_0032673 3300049822 Bacteria 4734
580 Ga0501035_0144201 3300049822 Bacteria 2069
581 Ga0501035_0641058 3300049822 Bacteria 862
582 Ga0501044_0003542 3300049823 Bacteria 17572
583 Ga0501044_0005817 3300049823 Bacteria 13658
584 Ga0501044_0152496 3300049823 Bacteria 2292
585 Ga0501044_0182925 3300049823 Bacteria 2062
586 Ga0501044_1044678 3300049823 Bacteria 688
587 nmdc:mga03683_37218_c1 3300050489 Bacteria 1982
588 nmdc:mga00v17_13387_c1 3300050491 Bacteria 4553
589 nmdc:mga0yw44_57632_c1 3300050492 Bacteria 2370
590 nmdc:mga0k408_197815_c1 3300050493 Bacteria 1200
591 nmdc:mga06z11_10651_c1 3300050494 Bacteria 3927
592 nmdc:mga06z11_6144_c1 3300050494 Bacteria 4863
593 nmdc:mga04h51_36997_c1 3300050495 Bacteria 1574
594 nmdc:mga07m45_182729_c1 3300050496 Bacteria 1219
595 nmdc:mga07m45_2301_c1 3300050496 Bacteria 8942
596 nmdc:mga07m45_281749_c1 3300050496 Bacteria 967
597 nmdc:mga07m45_76195_c1 3300050496 Bacteria 1912
598 nmdc:mga0sz30_136302_c1 3300050516 Bacteria 1083
599 Ga0500635_0000133 3300053080 Bacteria 42884
600 Ga0500578_0000159 3300053086 Bacteria 79246
601 Ga0500643_002501 3300053087 Bacteria 9423
602 Ga0500643_005142 3300053087 Bacteria 5711
603 Ga0500643_033645 3300053087 Bacteria 1548
604 Ga0500644_0000269 3300053088 Bacteria 29380
605 Ga0500646_0076038 3300053090 Bacteria 1016
606 Ga0500647_0022880 3300053091 Bacteria 2928
607 Ga0500583_0248562 3300053092 Bacteria 878
608 Ga0500651_0095259 3300053093 Bacteria 1830
609 Ga0500566_0032049 3300053094 Bacteria 3064
610 Ga0500641_0000896 3300053096 Bacteria 10669
611 Ga0500641_0004136 3300053096 Bacteria 5121
612 Ga0500641_0013309 3300053096 Bacteria 3021
613 Ga0500641_0045274 3300053096 Bacteria 1792
614 Ga0500650_0021086 3300053098 Bacteria 2867
615 Ga0500554_001916 3300053102 Bacteria 4024
616 Ga0500555_001064 3300053103 Bacteria 9234
617 Ga0500556_0001862 3300053104 Bacteria 7599
618 Ga0500556_0006820 3300053104 Bacteria 3251
619 Ga0500562_000588 3300053108 Bacteria 8715
620 Ga0500562_001014 3300053108 Bacteria 6863
621 Ga0500562_024537 3300053108 Bacteria 1576
622 Ga0500562_032147 3300053108 Bacteria 1385
623 Ga0500572_002558 3300053111 Bacteria 4338
624 Ga0500594_0000226 3300053118 Bacteria 13704
625 Ga0500595_015445 3300053119 Bacteria 2864
626 Ga0500595_045767 3300053119 Bacteria 1380
627 Ga0500597_283832 3300053120 Bacteria 666
628 Ga0500607_035997 3300053121 Bacteria 2705
629 Ga0500608_001098 3300053122 Bacteria 9615
630 Ga0500608_082009 3300053122 Bacteria 1520
631 Ga0500614_010503 3300053123 Bacteria 1989
632 Ga0500614_046227 3300053123 Bacteria 1126
633 Ga0500618_000642 3300053125 Bacteria 20854
634 Ga0500655_064552 3300053133 Bacteria 741
635 Ga0500655_086654 3300053133 Bacteria 648
636 Ga0500658_0005773 3300053134 Bacteria 4611
637 Ga0500559_0000224 3300053136 Bacteria 45272
638 Ga0500559_0000334 3300053136 Bacteria 35292
639 Ga0500559_0023182 3300053136 Bacteria 2635
640 Ga0500559_0029080 3300053136 Bacteria 2364
641 Ga0500559_0107809 3300053136 Bacteria 1288
642 Ga0500564_001489 3300053138 Bacteria 8118
643 Ga0500564_170143 3300053138 Bacteria 916
644 Ga0500568_0117014 3300053139 Bacteria 994
645 Ga0500573_0165997 3300053140 Bacteria 1198
646 Ga0500577_0000945 3300053142 Bacteria 7520
647 Ga0500590_006941 3300053148 Bacteria 5552
648 Ga0500590_063460 3300053148 Bacteria 1852
649 Ga0500603_004616 3300053150 Bacteria 2951
650 Ga0500616_0001137 3300053153 Bacteria 27368
651 Ga0500616_0003555 3300053153 Bacteria 11807
652 Ga0500616_0141782 3300053153 Bacteria 1122
653 Ga0500619_024565 3300053154 Bacteria 1774
654 Ga0500622_0002499 3300053156 Bacteria 13230
655 Ga0500622_0090082 3300053156 Bacteria 1523
656 Ga0500622_0092732 3300053156 Bacteria 1496
657 Ga0500622_0160018 3300053156 Bacteria 1056
658 Ga0500627_0018747 3300053158 Bacteria 2744
659 Ga0500639_210764 3300053163 Bacteria 823
660 Ga0500636_0018937 3300053177 Bacteria 4072
661 Ga0500625_013605 3300053729 Bacteria 3744
662 Ga0500645_002410 3300053730 Bacteria 8378
663 Ga0500645_002629 3300053730 Bacteria 7863
664 Ga0500645_006703 3300053730 Bacteria 4084
665 Ga0500645_012605 3300053730 Bacteria 2730
666 Ga0500609_001140 3300053731 Bacteria 3950
667 Ga0500596_000673 3300053735 Bacteria 6630
668 Ga0501084_0065375 3300054114 Bacteria 3043
669 Ga0501084_0115580 3300054114 Bacteria 2255
670 Ga0501082_0014678 3300060353 Bacteria 6750
671 Ga0501082_0041845 3300060353 Bacteria 3950
672 Ga0501082_0257091 3300060353 Bacteria 1519
673 2511122576 2510917020 Bacteria 5657507
674 2585148166 2582581279 Bacteria 4980720
675 2585155187 2582581280 Bacteria 5994497
676 2585194868 2582581293 Bacteria 5907401
677 2587917071 2585428106 Bacteria 5179711
678 2643747335 2643221545 Bacteria 5083237
679 2643779933 2643221552 Bacteria 5708754
680 2643922717 2643221583 Bacteria 5218014
681 2643929880 2643221584 Bacteria 5511711
682 2644001551 2643221598 Bacteria 4578346
683 2644088038 2643221614 Bacteria 4260023
684 2644223724 2643221640 Bacteria 5258820
685 2644236188 2643221642 Bacteria 5357871
686 2644344075 2643221661 Bacteria 4267604
687 2644367395 2643221666 Bacteria 4265935
688 2644507468 2643221691 Bacteria 5093099
689 2644549910 2643221699 Bacteria 5731501
690 2644551725 2643221699 Bacteria 5731501
691 2792461680 2791355048 Bacteria 5832535
692 2819538518 2818991435 Bacteria 5433759
693 2819648037 2818991454 Bacteria 5563326
694 2821449019 2821443989 Bacteria 7658172
695 2843746139 2843744320 Bacteria 5659202
696 2844538144 2844533157 Bacteria 7517899
697 2849561608 2849560528 Bacteria 5393480
698 2849574501 2849573788 Bacteria 5421256
699 2851153887 2851153111 Bacteria 5542585
700 2857506118 2857504554 Bacteria 5369913
701 2884963465 2884960567 Bacteria 5437054
702 2898330499 2898329390 Bacteria 5168154
703 2898796747 2898795034 Bacteria 4294459
704 2928534613 2928531327 Bacteria 5101314
705 2928973361 2928972540 Bacteria 3058286
706 2941486065 2941485952 Bacteria 3591484
707 2977240665 2977240413 Bacteria 3191065
708 Ga0105248_10183715
709 JGI25151J46595_10001638
710 JGI25153J46596_10029638
711 JGI25153J46596_10065678
712 rootH2_10001948
713 rootL2_10006616
714 rootL2_10006617
715 JGI25160J50197_1021509
716 Ga0006562J51391_1111710
717 Ga0006562J51391_1111713
718 Ga0055536_1004559
719 Ga0055536_1005300
720 Ga0055528_1002367
721 Ga0055530_10006066
722 Ga0055530_10007826
723 Ga0055531_10002677
724 Ga0055531_10003745
725 Ga0055531_10008281
726 Ga0055531_10018482
727 Ga0055531_10023037
728 Ga0055543_1033105
729 Ga0065165_1000795
730 Ga0065165_1070464
731 Ga0070658_10000691
732 Ga0070658_10498602
733 Ga0070683_100329810
734 Ga0070670_100000007
735 Ga0070670_100134389
736 Ga0070670_100140903
737 Ga0070670_100456351
738 Ga0068869_100099846
739 Ga0070680_100001636
740 Ga0070680_100003915
741 Ga0070660_100289335
742 Ga0070668_100000835
743 Ga0070668_100003294
744 Ga0070668_100006709
745 Ga0070668_100022598
746 Ga0070668_100030789
747 Ga0070669_100002041
748 Ga0070669_100796996
749 Ga0070671_100002143
750 Ga0070671_100333770
751 Ga0070673_100203455
752 Ga0070659_100000209
753 Ga0070667_100000155
754 Ga0070667_100012748
755 Ga0070667_100052116
756 Ga0070667_100591387
757 Ga0070714_100294108
758 Ga0070663_100621157
759 Ga0070678_100042562
760 Ga0070662_100219619
761 Ga0070681_10003919
762 Ga0070681_10019999
763 Ga0070679_100000920
764 Ga0068853_100049207
765 Ga0068853_100104064
766 Ga0070665_100000837
767 Ga0070665_100001961
768 Ga0070665_100004749
769 Ga0070665_100350930
770 Ga0070665_100443676
771 Ga0068855_100002736
772 Ga0068855_100068121
773 Ga0068855_100407262
774 Ga0070664_100002660
775 Ga0068854_100164781
776 Ga0068856_100088014
777 Ga0068859_100000930
778 Ga0068859_100013364
779 Ga0068859_100058614
780 Ga0068864_100000067
781 Ga0068864_100000128
782 Ga0068864_100004938
783 Ga0068864_100921093
784 Ga0068863_100000237
785 Ga0068863_100000360
786 Ga0068863_100001315
787 Ga0068863_100028144
788 Ga0068863_100115230
789 Ga0068858_100005137
790 Ga0068858_100064368
791 Ga0068858_100830981
792 Ga0068860_100000047
793 Ga0068860_100000226
794 Ga0068860_100063847
795 Ga0068860_100147841
796 Ga0068860_100720602
797 Ga0068862_100001031
798 Ga0068862_100010926
799 Ga0068862_100024798
800 Ga0068862_100110357
801 Ga0081455_10076737
802 Ga0081455_10099108
803 Ga0081539_10009430
804 Ga0075365_10328677
805 Ga0075363_100150220
806 Ga0075364_10001761
807 Ga0075362_10064516
808 Ga0075367_10000883
809 Ga0075367_10047761
810 Ga0075369_10090610
811 Ga0075370_10005916
812 Ga0075370_10085789
813 Ga0075370_10128855
814 Ga0075370_10268917
815 Ga0068871_100125155
816 Ga0068865_100006112
817 Ga0097620_100000930
818 Ga0097620_100013364
819 Ga0097620_100058614
820 Ga0105240_10006042
821 Ga0105240_10029450
822 Ga0105240_10247609
823 Ga0105240_10457353
824 Ga0105240_10492270
825 Ga0105245_10119836
826 Ga0105245_10264801
827 Ga0105245_10711432
828 Ga0105245_11342609
829 Ga0105247_10226381
830 Ga0105243_10433963
831 Ga0105243_10485363
832 Ga0105243_11275127
833 Ga0105242_10274349
834 Ga0105248_10000517
835 Ga0105248_10003956
836 Ga0105248_10040989
837 Ga0105248_10125467
838 Ga0105248_10366643
839 Ga0105248_10400924
840 Ga0105237_10109011
841 Ga0105237_10760747
842 Ga0105238_10032406
843 Ga0105238_10139712
844 Ga0105238_10173047
845 Ga0105238_10203161
846 Ga0105238_10437498
847 Ga0105249_10001758
848 Ga0105249_10127470
849 Ga0105239_10184677
850 Ga0105239_10324199
851 Ga0157373_10001725
852 Ga0157373_10004265
853 Ga0157370_10017626
854 Ga0157369_10940894
855 Ga0157369_11068307
856 Ga0157372_10403769
857 Ga0157375_10040775
858 Ga0163163_10002788
859 Ga0163163_10021531
860 Ga0163163_10319343
861 Ga0163163_10507164
862 Ga0157380_11383713
863 Ga0157379_10010392
864 Ga0157379_10039266
865 Ga0157379_10069595
866 Ga0163161_10209264
867 Ga0213872_10032017
868 Ga0213874_10033925
869 Ga0213876_10000081
870 Ga0213876_10103573
871 Ga0213876_10146159
872 Ga0209026_1001197
873 Ga0209148_1005548
874 Ga0209565_1000179
875 Ga0209673_1001719
876 Ga0209130_1000512
877 Ga0209675_1028681
878 Ga0209676_1000253
879 Ga0209676_1002091
880 Ga0209025_1000114
881 Ga0209564_1002926
882 Ga0209564_1018550
883 Ga0209758_1000562
884 Ga0209758_1000894
885 Ga0209758_1001428
886 Ga0209758_1002432
887 Ga0209050_1000173
888 Ga0209050_1000649
889 Ga0209050_1001201
890 Ga0209050_1013251
891 Ga0209256_1007675
892 Ga0209256_1015897
893 Ga0209256_1020239
894 Ga0207426_1000181
895 Ga0207426_1007086
896 Ga0209051_1004510
897 Ga0209257_1000196
898 Ga0209257_1000427
899 Ga0209257_1002800
900 Ga0209257_1005712
901 Ga0207680_10061594
902 Ga0207705_10003988
903 Ga0207705_10215672
904 Ga0207705_10372212
905 Ga0207705_10854544
906 Ga0207707_10000991
907 Ga0207695_10000572
908 Ga0207695_10007614
909 Ga0207695_10013848
910 Ga0207695_10014639
911 Ga0207695_10463694
912 Ga0207671_10177142
913 Ga0207660_10005036
914 Ga0207660_10007574
915 Ga0207660_10281558
916 Ga0207657_10136326
917 Ga0207649_10400556
918 Ga0207652_10003273
919 Ga0207681_10003889
920 Ga0207681_10691844
921 Ga0207694_10152430
922 Ga0207694_10678058
923 Ga0207694_10735518
924 Ga0207650_10000030
925 Ga0207650_10094286
926 Ga0207650_10188888
927 Ga0207687_10475036
928 Ga0207687_10669417
929 Ga0207664_10207052
930 Ga0207644_10000907
931 Ga0207644_10157344
932 Ga0207644_10183025
933 Ga0207690_10000116
934 Ga0207706_10117019
935 Ga0207686_10197441
936 Ga0207709_10284543
937 Ga0207711_10000669
938 Ga0207711_10001710
939 Ga0207711_10002365
940 Ga0207711_10035152
941 Ga0207711_10078303
942 Ga0207711_10149504
943 Ga0207689_10054823
944 Ga0207679_10004250
945 Ga0207679_10142440
946 Ga0207667_10003535
947 Ga0207667_10060083
948 Ga0207667_10079569
949 Ga0207667_10095078
950 Ga0207667_10504864
951 Ga0207651_10189711
952 Ga0207712_10000758
953 Ga0207668_10000010
954 Ga0207668_10000108
955 Ga0207668_10002370
956 Ga0207668_10010421
957 Ga0207668_10024326
958 Ga0207640_10345286
959 Ga0207658_10000265
960 Ga0207658_10044033
961 Ga0207658_10072468
962 Ga0207658_10086970
963 Ga0207658_10596361
964 Ga0207677_10130839
965 Ga0207677_11034575
966 Ga0207703_10000082
967 Ga0207703_10014762
968 Ga0207703_10020945
969 Ga0207703_10194158
970 Ga0207703_10434040
971 Ga0207639_10022198
972 Ga0207639_10154333
973 Ga0207639_11089405
974 Ga0207702_10042818
975 Ga0207702_10346680
976 Ga0207641_10000007
977 Ga0207641_10001651
978 Ga0207641_10007794
979 Ga0207641_10166119
980 Ga0207641_10271717
981 Ga0207641_10548126
982 Ga0207676_10000183
983 Ga0207676_10000241
984 Ga0207676_10017590
985 Ga0207676_10357631
986 Ga0207676_11274646
987 Ga0207674_10158408
988 Ga0207675_100107085
989 Ga0207675_100656774
990 Ga0207675_100721546
991 Ga0207683_10015037
992 Ga0207698_10213695
993 Ga0207698_11287074
994 Ga0209281_1013891
995 Ga0209813_10032610
996 Ga0268266_10000003
997 Ga0268266_10000656
998 Ga0268266_10005366
999 Ga0268266_10218545
1000 Ga0268266_10240639
1001 Ga0268266_10443235
1002 Ga0268265_10001171
1003 Ga0268265_10006429
1004 Ga0268265_10038568
1005 Ga0268265_10055110
1006 Ga0268265_10057571
1007 Ga0268265_10112329
1008 Ga0268265_10127299
1009 Ga0268265_10221228
1010 Ga0268264_10000110
1011 Ga0268264_10000125
1012 Ga0268264_10037317
1013 Ga0268264_10105324
1014 Ga0268264_10119463
1015 Ga0268264_10648218
1016 Ga0268264_10747980
1017 Ga0265337_1007448
1018 Ga0265326_10008000
1019 Ga0307517_10001402
1020 Ga0307517_10059611
1021 Ga0307517_10320056
1022 Ga0307515_10005814
1023 Ga0307515_10085154
1024 Ga0265338_10025285
1025 Ga0265338_10028732
1026 Ga0265338_10031038
1027 Ga0265338_10052621
1028 Ga0265338_10058720
1029 Ga0265338_10671416
1030 Ga0265324_10081898
1031 Ga0265340_10243103
1032 Ga0265327_10000130
1033 Ga0265327_10002013
1034 Ga0265327_10044047
1035 Ga0265316_10729134
1036 Ga0307513_10000077
1037 Ga0307513_10003700
1038 Ga0307513_10010991
1039 Ga0307513_10022306
1040 Ga0307513_10140360
1041 Ga0307513_10216508
1042 Ga0307513_10405850
1043 Ga0307408_100268800
1044 Ga0265313_10174950
1045 Ga0265314_10008476
1046 Ga0265314_10081291
1047 Ga0265314_10246885
1048 Ga0265342_10080481
1049 Ga0307516_10000001
1050 Ga0307405_10290772
1051 Ga0307413_10018776
1052 Ga0307410_10287561
1053 Ga0307410_10442740
1054 Ga0307406_10409942
1055 Ga0307407_10083402
1056 Ga0307407_10458433
1057 Ga0307409_100020575
1058 Ga0307414_10512579
1059 Ga0307411_10147329
1060 Ga0307415_100741727
1061 Ga0307510_10002396
1062 Ga0307510_10104784
1063 Ga0373944_0003544
1064 Ga0373936_0004632
1065 Ga0373941_0029632
1066 Ga0373960_0023318
1067 Ga0373942_0004841
1068 Ga0373927_0000472
1069 Ga0373933_0203689
1070 Ga0373947_0243254
1071 Ga0373937_0097527
1072 Ga0373937_0237520
1073 Ga0373925_0000003
1074 Ga0373925_0025075
1075 Ga0395899_0000016
1076 Ga0395899_0000498
1077 Ga0395899_0141846
1078 Ga0395900_0000008
1079 Ga0395900_0083540
1080 Ga0395900_0308438
1081 Ga0395900_0453618
1082 Ga0395898_0062872
1083 Ga0395898_0079926
1084 Ga0395905_0001355
1085 Ga0395905_0009683
1086 Ga0395905_0154768
1087 Ga0395905_0307066
1088 Ga0395905_0525428
1089 Ga0436364_0481903
1090 Ga0436364_0882847
1091 Ga0395901_0000008
1092 Ga0395901_0119434
1093 Ga0395901_0197473
1094 Ga0395901_0205575
1095 Ga0395901_0288213
1096 Ga0436365_0187494
1097 Ga0436365_0368117
1098 Ga0436365_0884483
1099 Ga0436365_1923138
1100 Ga0436360_0945988
1101 Ga0436360_1148462
1102 Ga0436360_1296374
1103 Ga0436361_0104010
1104 Ga0436361_0564979
1105 Ga0436361_0741749
1106 Ga0436361_1172229
1107 Ga0436363_1475916
1108 Ga0439438_102225
1109 Ga0439431_0076912
1110 Ga0439446_0086344
1111 Ga0439435_0014860
1112 Ga0450901_002375
1113 Ga0466966_0144037
1114 Ga0466966_0241279
1115 Ga0466968_0099559
1116 Ga0466960_0047359
1117 Ga0495617_053556
1118 Ga0495627_004929
1119 Ga0495590_0022517
1120 Ga0495629_0019869
1121 Ga0495638_0000530
1122 Ga0495638_0001235
1123 Ga0495638_0005396
1124 Ga0495638_0008848
1125 Ga0495638_0009539
1126 Ga0495638_0266893
1127 Ga0495653_0541692
1128 Ga0495650_0000024
1129 Ga0495650_0061598
1130 Ga0495650_0077380
1131 Ga0495583_0000003
1132 Ga0495583_0028948
1133 Ga0495583_0063093
1134 Ga0495583_0195837
1135 Ga0495606_0038419
1136 Ga0495606_0083232
1137 Ga0495610_0000478
1138 Ga0495610_0000679
1139 Ga0495610_0007161
1140 Ga0495616_0000099
1141 Ga0495616_0028726
1142 Ga0495620_0027085
1143 Ga0495630_0318924
1144 Ga0495631_0007265
1145 Ga0495632_0005209
1146 Ga0495637_0003545
1147 Ga0495637_0073993
1148 Ga0495643_0006929
1149 Ga0495648_0000634
1150 Ga0495648_0157746
1151 Ga0495642_0219450
1152 Ga0495652_0058471
1153 Ga0495654_0000135
1154 Ga0495654_0146032
1155 Ga0495654_0180499
1156 Ga0495609_0060216
1157 Ga0495621_0179988
1158 Ga0495597_0207097
1159 Ga0495645_0057116
1160 Ga0495622_0000762
1161 Ga0495633_0000423
1162 Ga0495633_0117414
1163 Ga0495668_0000291
1164 Ga0495668_0005259
1165 Ga0495668_0019454
1166 Ga0495668_0021477
1167 Ga0495668_0039891
1168 Ga0495668_0093250
1169 Ga0495668_0115627
1170 Ga0495625_0001134
1171 Ga0495625_0003614
1172 Ga0495625_0010213
1173 Ga0495625_0031018
1174 Ga0495625_0040043
1175 Ga0495625_0070340
1176 Ga0495625_0191523
1177 Ga0495588_0266618
1178 Ga0495669_0000044
1179 Ga0495669_0000152
1180 Ga0495669_0026139
1181 Ga0495669_0055181
1182 Ga0495669_0137431
1183 Ga0495613_0004090
1184 Ga0495613_0253042
1185 Ga0495624_0258863
1186 Ga0495671_0146783
1187 Ga0495671_0147930
1188 Ga0495671_0290240
1189 Ga0495649_0000262
1190 Ga0495589_0028088
1191 Ga0495660_0059882
1192 Ga0495672_0000784
1193 Ga0495672_0004858
1194 Ga0495672_0028037
1195 Ga0495683_0117628
1196 Ga0495687_044573
1197 Ga0495677_0146016
1198 Ga0495677_0207543
1199 Ga0495679_003275
1200 Ga0495673_0000340
1201 Ga0495673_0001300
1202 Ga0495673_0003929
1203 Ga0495673_0218700
1204 Ga0495681_0017489
1205 Ga0495681_0031241
1206 Ga0495686_0001205
1207 Ga0495686_0004549
1208 Ga0495686_0022417
1209 Ga0495686_0035200
1210 Ga0495686_0037968
1211 Ga0495686_0043703
1212 Ga0495593_0071401
1213 Ga0496101_0009511
1214 Ga0496101_0059471
1215 Ga0496102_0011792
1216 Ga0496106_0004442
1217 Ga0496106_0529481
1218 Ga0496106_0553305
1219 Ga0496107_0000987
1220 Ga0496107_0104495
1221 Ga0496108_0054241
1222 Ga0496112_0227562
1223 Ga0496115_0000126
1224 Ga0496115_0003595
1225 Ga0496115_0013222
1226 Ga0496115_0039144
1227 Ga0496115_0050885
1228 Ga0496115_0191913
1229 Ga0496115_0679669
1230 Ga0496116_0212130
1231 Ga0496117_0116167
1232 Ga0496118_0031844
1233 Ga0496119_0059930
1234 Ga0496121_0000035
1235 Ga0496121_0007098
1236 Ga0496121_0139465
1237 Ga0496121_0354203
1238 Ga0496121_0475548
1239 Ga0496122_0002454
1240 Ga0496123_0004303
1241 Ga0496124_0145643
1242 Ga0496124_0389121
1243 Ga0496124_0518894
1244 Ga0496125_0047317
1245 Ga0496125_0078633
1246 Ga0496126_0167919
1247 Ga0495678_000699
1248 Ga0501033_0005322
1249 Ga0501033_0076362
1250 Ga0501033_0231933
1251 Ga0501034_0013241
1252 Ga0501034_0086368
1253 Ga0501034_0088709
1254 Ga0501034_0222240
1255 Ga0501036_0013734
1256 Ga0501037_0078237
1257 Ga0501037_0147796
1258 Ga0501038_0078567
1259 Ga0501043_0593111
1260 Ga0501046_0007634
1261 Ga0501047_0020536
1262 Ga0501047_0232637
1263 Ga0501048_0133585
1264 Ga0501048_0331697
1265 Ga0501067_0083838
1266 Ga0501067_0199285
1267 Ga0501068_0110266
1268 Ga0501069_0089060
1269 Ga0501070_0038246
1270 Ga0501071_0205616
1271 Ga0501072_0020753
1272 Ga0501072_0430716
1273 Ga0501073_0007955
1274 Ga0501074_0013123
1275 Ga0501076_0282774
1276 Ga0501238_002038
1277 Ga0501238_015871
1278 Ga0501257_078181
1279 Ga0501079_0223183
1280 Ga0501080_0003547
1281 Ga0501083_0047271
1282 Ga0501083_0061207
1283 Ga0501083_0124013
1284 Ga0501083_0150451
1285 Ga0501083_0338908
1286 Ga0501035_0032673
1287 Ga0501035_0144201
1288 Ga0501035_0641058
1289 Ga0501044_0003542
1290 Ga0501044_0005817
1291 Ga0501044_0152496
1292 Ga0501044_0182925
1293 Ga0501044_1044678
1294 nmdc:mga03683_37218_c1
1295 nmdc:mga00v17_13387_c1
1296 nmdc:mga0yw44_57632_c1
1297 nmdc:mga0k408_197815_c1
1298 nmdc:mga06z11_10651_c1
1299 nmdc:mga06z11_6144_c1
1300 nmdc:mga04h51_36997_c1
1301 nmdc:mga07m45_182729_c1
1302 nmdc:mga07m45_2301_c1
1303 nmdc:mga07m45_281749_c1
1304 nmdc:mga07m45_76195_c1
1305 nmdc:mga0sz30_136302_c1
1306 Ga0500635_0000133
1307 Ga0500578_0000159
1308 Ga0500643_002501
1309 Ga0500643_005142
1310 Ga0500643_033645
1311 Ga0500644_0000269
1312 Ga0500646_0076038
1313 Ga0500647_0022880
1314 Ga0500583_0248562
1315 Ga0500651_0095259
1316 Ga0500566_0032049
1317 Ga0500641_0000896
1318 Ga0500641_0004136
1319 Ga0500641_0013309
1320 Ga0500641_0045274
1321 Ga0500650_0021086
1322 Ga0500554_001916
1323 Ga0500555_001064
1324 Ga0500556_0001862
1325 Ga0500556_0006820
1326 Ga0500562_000588
1327 Ga0500562_001014
1328 Ga0500562_024537
1329 Ga0500562_032147
1330 Ga0500572_002558
1331 Ga0500594_0000226
1332 Ga0500595_015445
1333 Ga0500595_045767
1334 Ga0500597_283832
1335 Ga0500607_035997
1336 Ga0500608_001098
1337 Ga0500608_082009
1338 Ga0500614_010503
1339 Ga0500614_046227
1340 Ga0500618_000642
1341 Ga0500655_064552
1342 Ga0500655_086654
1343 Ga0500658_0005773
1344 Ga0500559_0000224
1345 Ga0500559_0000334
1346 Ga0500559_0023182
1347 Ga0500559_0029080
1348 Ga0500559_0107809
1349 Ga0500564_001489
1350 Ga0500564_170143
1351 Ga0500568_0117014
1352 Ga0500573_0165997
1353 Ga0500577_0000945
1354 Ga0500590_006941
1355 Ga0500590_063460
1356 Ga0500603_004616
1357 Ga0500616_0001137
1358 Ga0500616_0003555
1359 Ga0500616_0141782
1360 Ga0500619_024565
1361 Ga0500622_0002499
1362 Ga0500622_0090082
1363 Ga0500622_0092732
1364 Ga0500622_0160018
1365 Ga0500627_0018747
1366 Ga0500639_210764
1367 Ga0500636_0018937
1368 Ga0500625_013605
1369 Ga0500645_002410
1370 Ga0500645_002629
1371 Ga0500645_006703
1372 Ga0500645_012605
1373 Ga0500609_001140
1374 Ga0500596_000673
1375 Ga0501084_0065375
1376 Ga0501084_0115580
1377 Ga0501082_0014678
1378 Ga0501082_0041845
1379 Ga0501082_0257091
1380 2511122576
1381 2585148166
1382 2585155187
1383 2585194868
1384 2587917071
1385 2643747335
1386 2643779933
1387 2643922717
1388 2643929880
1389 2644001551
1390 2644088038
1391 2644223724
1392 2644236188
1393 2644344075
1394 2644367395
1395 2644507468
1396 2644549910
1397 2644551725
1398 2792461680
1399 2819538518
1400 2819648037
1401 2821449019
1402 2843746139
1403 2844538144
1404 2849561608
1405 2849574501
1406 2851153887
1407 2857506118
1408 2884963465
1409 2898330499
1410 2898796747
1411 2928534613
1412 2928973361
1413 2941486065
1414 2977240665

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

200

223

0.99

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

81

101

0.98

PF13662

Toprim_4

Toprim domain

107

198

0.98

PF21176

RecR_HhH

RecR, helix-hairpin-helix

34

78

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9317 69 159
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9123 69 159
1t6t-assembly1.cif.gz_1 putative protein from aquifex aeolicus 0.8381 66 155
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8305 16 186
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.8151 112 159
ID Description Score Start End Superfamily
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9659 65 186 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9582 65 186 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9487 68 158 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9372 65 158 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9276 65 158 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9596 61 161 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9241 61 161 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A6P1B0M1-F1-model_v4 deleted 0.9116 55 140
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9091 50 143 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W0GPM3-F1-model_v4 Toprim domain-containing protein 0.9009 52 146 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Map