F476540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 707 | 362 | 1414 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10183715|Ga0105248_101837154 |
| Length | 225 |
| Sequence | MAAAAREGNHPFLSDPGDAHIAWLPCEPLPADEIERLIALLAKLPGLGPRSARRAALALLKRRDQLLTPLSQALSDAAARVRPCSTCGALDSSDPCSVCADQSRDGALLCVVEEVGGLWALERAGAFRGRYHVLGGLLSALDGVGPQALRIEELVDRASEGEIREVILCLPATVDGQTTAHYLAERLQRSGVQVSMLARGVPVGGELDWLDDGTIAQALRARRPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 178 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 181 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 184 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 188 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 286 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 287 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 288 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 290 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 291 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 292 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 296 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 297 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 298 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 302 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 303 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 305 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 306 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 307 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 309 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 314 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 322 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 330 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 331 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 332 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 333 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 334 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 335 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 336 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 337 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 338 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 339 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 340 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 341 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 342 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 343 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 344 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 345 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 346 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 347 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 348 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 349 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 350 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 351 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 352 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 353 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 354 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 355 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 356 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 357 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 358 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 359 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 360 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 361 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 362 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0.28 |
| Isolates | 4.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.52 |
| Nodule | 0.14 |
| Rhizoplane | 2.4 |
| Rhizosphere | 67.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10183715 | 3300009177 | Bacteria | 2356 |
| 2 | JGI25151J46595_10001638 | 3300003187 | Bacteria | 14729 |
| 3 | JGI25153J46596_10029638 | 3300003215 | Bacteria | 1875 |
| 4 | JGI25153J46596_10065678 | 3300003215 | Bacteria | 963 |
| 5 | rootH2_10001948 | 3300003320 | Bacteria | 38548 |
| 6 | rootL2_10006616 | 3300003322 | Bacteria | 3279 |
| 7 | rootL2_10006617 | 3300003322 | Bacteria | 3585 |
| 8 | JGI25160J50197_1021509 | 3300003354 | Bacteria | 1915 |
| 9 | Ga0006562J51391_1111710 | 3300003578 | Bacteria | 9152 |
| 10 | Ga0006562J51391_1111713 | 3300003578 | Bacteria | 2620 |
| 11 | Ga0055536_1004559 | 3300003781 | Bacteria | 7037 |
| 12 | Ga0055536_1005300 | 3300003781 | Bacteria | 6346 |
| 13 | Ga0055528_1002367 | 3300003790 | Bacteria | 10184 |
| 14 | Ga0055530_10006066 | 3300003791 | Bacteria | 5521 |
| 15 | Ga0055530_10007826 | 3300003791 | Bacteria | 4411 |
| 16 | Ga0055531_10002677 | 3300003794 | Bacteria | 11744 |
| 17 | Ga0055531_10003745 | 3300003794 | Bacteria | 9552 |
| 18 | Ga0055531_10008281 | 3300003794 | Bacteria | 5522 |
| 19 | Ga0055531_10018482 | 3300003794 | Bacteria | 2873 |
| 20 | Ga0055531_10023037 | 3300003794 | Bacteria | 2351 |
| 21 | Ga0055543_1033105 | 3300004625 | Bacteria | 895 |
| 22 | Ga0065165_1000795 | 3300005262 | Bacteria | 42155 |
| 23 | Ga0065165_1070464 | 3300005262 | Bacteria | 931 |
| 24 | Ga0070658_10000691 | 3300005327 | Bacteria | 29223 |
| 25 | Ga0070658_10498602 | 3300005327 | Bacteria | 1052 |
| 26 | Ga0070683_100329810 | 3300005329 | Bacteria | 1453 |
| 27 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 28 | Ga0070670_100134389 | 3300005331 | Bacteria | 2137 |
| 29 | Ga0070670_100140903 | 3300005331 | Bacteria | 2085 |
| 30 | Ga0070670_100456351 | 3300005331 | Bacteria | 1133 |
| 31 | Ga0068869_100099846 | 3300005334 | Bacteria | 2194 |
| 32 | Ga0070680_100001636 | 3300005336 | Bacteria | 16368 |
| 33 | Ga0070680_100003915 | 3300005336 | Bacteria | 11132 |
| 34 | Ga0070660_100289335 | 3300005339 | Bacteria | 1342 |
| 35 | Ga0070668_100000835 | 3300005347 | Bacteria | 21310 |
| 36 | Ga0070668_100003294 | 3300005347 | Bacteria | 11919 |
| 37 | Ga0070668_100006709 | 3300005347 | Bacteria | 8530 |
| 38 | Ga0070668_100022598 | 3300005347 | Bacteria | 4756 |
| 39 | Ga0070668_100030789 | 3300005347 | Bacteria | 4082 |
| 40 | Ga0070669_100002041 | 3300005353 | Bacteria | 14610 |
| 41 | Ga0070669_100796996 | 3300005353 | Bacteria | 803 |
| 42 | Ga0070671_100002143 | 3300005355 | Bacteria | 15242 |
| 43 | Ga0070671_100333770 | 3300005355 | Bacteria | 1293 |
| 44 | Ga0070673_100203455 | 3300005364 | Bacteria | 1706 |
| 45 | Ga0070659_100000209 | 3300005366 | Bacteria | 45573 |
| 46 | Ga0070667_100000155 | 3300005367 | Bacteria | 85527 |
| 47 | Ga0070667_100012748 | 3300005367 | Bacteria | 6950 |
| 48 | Ga0070667_100052116 | 3300005367 | Bacteria | 3451 |
| 49 | Ga0070667_100591387 | 3300005367 | Bacteria | 1022 |
| 50 | Ga0070714_100294108 | 3300005435 | Bacteria | 1512 |
| 51 | Ga0070663_100621157 | 3300005455 | Bacteria | 911 |
| 52 | Ga0070678_100042562 | 3300005456 | Bacteria | 3229 |
| 53 | Ga0070662_100219619 | 3300005457 | Bacteria | 1516 |
| 54 | Ga0070681_10003919 | 3300005458 | Bacteria | 14028 |
| 55 | Ga0070681_10019999 | 3300005458 | Bacteria | 6708 |
| 56 | Ga0070679_100000920 | 3300005530 | Bacteria | 25588 |
| 57 | Ga0068853_100049207 | 3300005539 | Bacteria | 3622 |
| 58 | Ga0068853_100104064 | 3300005539 | Bacteria | 2513 |
| 59 | Ga0070665_100000837 | 3300005548 | Bacteria | 40130 |
| 60 | Ga0070665_100001961 | 3300005548 | Bacteria | 23155 |
| 61 | Ga0070665_100004749 | 3300005548 | Bacteria | 14144 |
| 62 | Ga0070665_100350930 | 3300005548 | Bacteria | 1481 |
| 63 | Ga0070665_100443676 | 3300005548 | Bacteria | 1307 |
| 64 | Ga0068855_100002736 | 3300005563 | Bacteria | 21720 |
| 65 | Ga0068855_100068121 | 3300005563 | Bacteria | 4144 |
| 66 | Ga0068855_100407262 | 3300005563 | Bacteria | 1489 |
| 67 | Ga0070664_100002660 | 3300005564 | Bacteria | 14408 |
| 68 | Ga0068854_100164781 | 3300005578 | Bacteria | 1720 |
| 69 | Ga0068856_100088014 | 3300005614 | Bacteria | 3088 |
| 70 | Ga0068859_100000930 | 3300005617 | Bacteria | 29992 |
| 71 | Ga0068859_100013364 | 3300005617 | Bacteria | 8232 |
| 72 | Ga0068859_100058614 | 3300005617 | Bacteria | 3879 |
| 73 | Ga0068864_100000067 | 3300005618 | Bacteria | 115834 |
| 74 | Ga0068864_100000128 | 3300005618 | Bacteria | 73813 |
| 75 | Ga0068864_100004938 | 3300005618 | Bacteria | 10927 |
| 76 | Ga0068864_100921093 | 3300005618 | Bacteria | 864 |
| 77 | Ga0068863_100000237 | 3300005841 | Bacteria | 58657 |
| 78 | Ga0068863_100000360 | 3300005841 | Bacteria | 46300 |
| 79 | Ga0068863_100001315 | 3300005841 | Bacteria | 24750 |
| 80 | Ga0068863_100028144 | 3300005841 | Bacteria | 5366 |
| 81 | Ga0068863_100115230 | 3300005841 | Bacteria | 2561 |
| 82 | Ga0068858_100005137 | 3300005842 | Bacteria | 12825 |
| 83 | Ga0068858_100064368 | 3300005842 | Bacteria | 3394 |
| 84 | Ga0068858_100830981 | 3300005842 | Bacteria | 902 |
| 85 | Ga0068860_100000047 | 3300005843 | Bacteria | 213287 |
| 86 | Ga0068860_100000226 | 3300005843 | Bacteria | 87552 |
| 87 | Ga0068860_100063847 | 3300005843 | Bacteria | 3497 |
| 88 | Ga0068860_100147841 | 3300005843 | Bacteria | 2262 |
| 89 | Ga0068860_100720602 | 3300005843 | Bacteria | 1008 |
| 90 | Ga0068862_100001031 | 3300005844 | Bacteria | 26791 |
| 91 | Ga0068862_100010926 | 3300005844 | Bacteria | 7497 |
| 92 | Ga0068862_100024798 | 3300005844 | Bacteria | 5032 |
| 93 | Ga0068862_100110357 | 3300005844 | Bacteria | 2414 |
| 94 | Ga0081455_10076737 | 3300005937 | Bacteria | 2751 |
| 95 | Ga0081455_10099108 | 3300005937 | Bacteria | 2344 |
| 96 | Ga0081539_10009430 | 3300005985 | Bacteria | 8160 |
| 97 | Ga0075365_10328677 | 3300006038 | Bacteria | 1077 |
| 98 | Ga0075363_100150220 | 3300006048 | Bacteria | 1315 |
| 99 | Ga0075364_10001761 | 3300006051 | Bacteria | 11966 |
| 100 | Ga0075362_10064516 | 3300006177 | Bacteria | 1662 |
| 101 | Ga0075367_10000883 | 3300006178 | Bacteria | 12032 |
| 102 | Ga0075367_10047761 | 3300006178 | Bacteria | 2519 |
| 103 | Ga0075369_10090610 | 3300006186 | Bacteria | 1364 |
| 104 | Ga0075370_10005916 | 3300006353 | Bacteria | 6119 |
| 105 | Ga0075370_10085789 | 3300006353 | Bacteria | 1813 |
| 106 | Ga0075370_10128855 | 3300006353 | Bacteria | 1476 |
| 107 | Ga0075370_10268917 | 3300006353 | Bacteria | 1012 |
| 108 | Ga0068871_100125155 | 3300006358 | Bacteria | 2175 |
| 109 | Ga0068865_100006112 | 3300006881 | Bacteria | 7342 |
| 110 | Ga0097620_100000930 | 3300006931 | Bacteria | 29992 |
| 111 | Ga0097620_100013364 | 3300006931 | Bacteria | 8232 |
| 112 | Ga0097620_100058614 | 3300006931 | Bacteria | 3879 |
| 113 | Ga0105240_10006042 | 3300009093 | Bacteria | 17895 |
| 114 | Ga0105240_10029450 | 3300009093 | Bacteria | 7152 |
| 115 | Ga0105240_10247609 | 3300009093 | Bacteria | 2063 |
| 116 | Ga0105240_10457353 | 3300009093 | Bacteria | 1427 |
| 117 | Ga0105240_10492270 | 3300009093 | Bacteria | 1365 |
| 118 | Ga0105245_10119836 | 3300009098 | Bacteria | 2457 |
| 119 | Ga0105245_10264801 | 3300009098 | Bacteria | 1674 |
| 120 | Ga0105245_10711432 | 3300009098 | Bacteria | 1038 |
| 121 | Ga0105245_11342609 | 3300009098 | Bacteria | 764 |
| 122 | Ga0105247_10226381 | 3300009101 | Bacteria | 1268 |
| 123 | Ga0105243_10433963 | 3300009148 | Bacteria | 1228 |
| 124 | Ga0105243_10485363 | 3300009148 | Bacteria | 1167 |
| 125 | Ga0105243_11275127 | 3300009148 | Bacteria | 751 |
| 126 | Ga0105242_10274349 | 3300009176 | Bacteria | 1529 |
| 127 | Ga0105248_10000517 | 3300009177 | Bacteria | 43853 |
| 128 | Ga0105248_10003956 | 3300009177 | Bacteria | 16383 |
| 129 | Ga0105248_10040989 | 3300009177 | Bacteria | 5192 |
| 130 | Ga0105248_10125467 | 3300009177 | Bacteria | 2896 |
| 131 | Ga0105248_10366643 | 3300009177 | Bacteria | 1622 |
| 132 | Ga0105248_10400924 | 3300009177 | Bacteria | 1544 |
| 133 | Ga0105237_10109011 | 3300009545 | Bacteria | 2760 |
| 134 | Ga0105237_10760747 | 3300009545 | Bacteria | 975 |
| 135 | Ga0105238_10032406 | 3300009551 | Bacteria | 5318 |
| 136 | Ga0105238_10139712 | 3300009551 | Bacteria | 2399 |
| 137 | Ga0105238_10173047 | 3300009551 | Bacteria | 2136 |
| 138 | Ga0105238_10203161 | 3300009551 | Bacteria | 1957 |
| 139 | Ga0105238_10437498 | 3300009551 | Bacteria | 1304 |
| 140 | Ga0105249_10001758 | 3300009553 | Bacteria | 18894 |
| 141 | Ga0105249_10127470 | 3300009553 | Bacteria | 2425 |
| 142 | Ga0105239_10184677 | 3300010375 | Bacteria | 2333 |
| 143 | Ga0105239_10324199 | 3300010375 | Bacteria | 1737 |
| 144 | Ga0157373_10001725 | 3300013100 | Bacteria | 16609 |
| 145 | Ga0157373_10004265 | 3300013100 | Bacteria | 10768 |
| 146 | Ga0157370_10017626 | 3300013104 | Bacteria | 7200 |
| 147 | Ga0157369_10940894 | 3300013105 | Bacteria | 886 |
| 148 | Ga0157369_11068307 | 3300013105 | Bacteria | 826 |
| 149 | Ga0157372_10403769 | 3300013307 | Bacteria | 1592 |
| 150 | Ga0157375_10040775 | 3300013308 | Bacteria | 4479 |
| 151 | Ga0163163_10002788 | 3300014325 | Bacteria | 14762 |
| 152 | Ga0163163_10021531 | 3300014325 | Bacteria | 6086 |
| 153 | Ga0163163_10319343 | 3300014325 | Bacteria | 1607 |
| 154 | Ga0163163_10507164 | 3300014325 | Bacteria | 1268 |
| 155 | Ga0157380_11383713 | 3300014326 | Bacteria | 754 |
| 156 | Ga0157379_10010392 | 3300014968 | Bacteria | 8109 |
| 157 | Ga0157379_10039266 | 3300014968 | Bacteria | 4223 |
| 158 | Ga0157379_10069595 | 3300014968 | Bacteria | 3148 |
| 159 | Ga0163161_10209264 | 3300017792 | Bacteria | 1506 |
| 160 | Ga0213872_10032017 | 3300021361 | Bacteria | 2410 |
| 161 | Ga0213874_10033925 | 3300021377 | Bacteria | 1491 |
| 162 | Ga0213876_10000081 | 3300021384 | Bacteria | 108997 |
| 163 | Ga0213876_10103573 | 3300021384 | Bacteria | 1509 |
| 164 | Ga0213876_10146159 | 3300021384 | Bacteria | 1257 |
| 165 | Ga0209026_1001197 | 3300025250 | Bacteria | 12016 |
| 166 | Ga0209148_1005548 | 3300025254 | Bacteria | 2877 |
| 167 | Ga0209565_1000179 | 3300025263 | Bacteria | 79300 |
| 168 | Ga0209673_1001719 | 3300025273 | Bacteria | 18427 |
| 169 | Ga0209130_1000512 | 3300025284 | Bacteria | 39134 |
| 170 | Ga0209675_1028681 | 3300025291 | Bacteria | 1350 |
| 171 | Ga0209676_1000253 | 3300025292 | Bacteria | 113412 |
| 172 | Ga0209676_1002091 | 3300025292 | Bacteria | 15424 |
| 173 | Ga0209025_1000114 | 3300025294 | Bacteria | 218921 |
| 174 | Ga0209564_1002926 | 3300025295 | Bacteria | 12410 |
| 175 | Ga0209564_1018550 | 3300025295 | Bacteria | 2645 |
| 176 | Ga0209758_1000562 | 3300025297 | Bacteria | 58446 |
| 177 | Ga0209758_1000894 | 3300025297 | Bacteria | 40579 |
| 178 | Ga0209758_1001428 | 3300025297 | Bacteria | 28251 |
| 179 | Ga0209758_1002432 | 3300025297 | Bacteria | 19004 |
| 180 | Ga0209050_1000173 | 3300025298 | Bacteria | 149800 |
| 181 | Ga0209050_1000649 | 3300025298 | Bacteria | 53856 |
| 182 | Ga0209050_1001201 | 3300025298 | Bacteria | 30402 |
| 183 | Ga0209050_1013251 | 3300025298 | Bacteria | 3681 |
| 184 | Ga0209256_1007675 | 3300025299 | Bacteria | 5241 |
| 185 | Ga0209256_1015897 | 3300025299 | Bacteria | 2602 |
| 186 | Ga0209256_1020239 | 3300025299 | Bacteria | 2084 |
| 187 | Ga0207426_1000181 | 3300025302 | Bacteria | 158308 |
| 188 | Ga0207426_1007086 | 3300025302 | Bacteria | 4741 |
| 189 | Ga0209051_1004510 | 3300025303 | Bacteria | 8546 |
| 190 | Ga0209257_1000196 | 3300025304 | Bacteria | 149656 |
| 191 | Ga0209257_1000427 | 3300025304 | Bacteria | 81007 |
| 192 | Ga0209257_1002800 | 3300025304 | Bacteria | 16403 |
| 193 | Ga0209257_1005712 | 3300025304 | Bacteria | 8542 |
| 194 | Ga0207680_10061594 | 3300025903 | Bacteria | 2289 |
| 195 | Ga0207705_10003988 | 3300025909 | Bacteria | 11228 |
| 196 | Ga0207705_10215672 | 3300025909 | Bacteria | 1456 |
| 197 | Ga0207705_10372212 | 3300025909 | Bacteria | 1103 |
| 198 | Ga0207705_10854544 | 3300025909 | Bacteria | 706 |
| 199 | Ga0207707_10000991 | 3300025912 | Bacteria | 27315 |
| 200 | Ga0207695_10000572 | 3300025913 | Bacteria | 75360 |
| 201 | Ga0207695_10007614 | 3300025913 | Bacteria | 13721 |
| 202 | Ga0207695_10013848 | 3300025913 | Bacteria | 9593 |
| 203 | Ga0207695_10014639 | 3300025913 | Bacteria | 9276 |
| 204 | Ga0207695_10463694 | 3300025913 | Bacteria | 1150 |
| 205 | Ga0207671_10177142 | 3300025914 | Bacteria | 1658 |
| 206 | Ga0207660_10005036 | 3300025917 | Bacteria | 8610 |
| 207 | Ga0207660_10007574 | 3300025917 | Bacteria | 7028 |
| 208 | Ga0207660_10281558 | 3300025917 | Bacteria | 1320 |
| 209 | Ga0207657_10136326 | 3300025919 | Bacteria | 2008 |
| 210 | Ga0207649_10400556 | 3300025920 | Bacteria | 1027 |
| 211 | Ga0207652_10003273 | 3300025921 | Bacteria | 13419 |
| 212 | Ga0207681_10003889 | 3300025923 | Bacteria | 9273 |
| 213 | Ga0207681_10691844 | 3300025923 | Bacteria | 847 |
| 214 | Ga0207694_10152430 | 3300025924 | Bacteria | 1863 |
| 215 | Ga0207694_10678058 | 3300025924 | Bacteria | 869 |
| 216 | Ga0207694_10735518 | 3300025924 | Bacteria | 832 |
| 217 | Ga0207650_10000030 | 3300025925 | Bacteria | 235824 |
| 218 | Ga0207650_10094286 | 3300025925 | Bacteria | 2293 |
| 219 | Ga0207650_10188888 | 3300025925 | Bacteria | 1645 |
| 220 | Ga0207687_10475036 | 3300025927 | Bacteria | 1040 |
| 221 | Ga0207687_10669417 | 3300025927 | Bacteria | 879 |
| 222 | Ga0207664_10207052 | 3300025929 | Bacteria | 1696 |
| 223 | Ga0207644_10000907 | 3300025931 | Bacteria | 18778 |
| 224 | Ga0207644_10157344 | 3300025931 | Bacteria | 1763 |
| 225 | Ga0207644_10183025 | 3300025931 | Bacteria | 1643 |
| 226 | Ga0207690_10000116 | 3300025932 | Bacteria | 65776 |
| 227 | Ga0207706_10117019 | 3300025933 | Bacteria | 2344 |
| 228 | Ga0207686_10197441 | 3300025934 | Bacteria | 1439 |
| 229 | Ga0207709_10284543 | 3300025935 | Bacteria | 1222 |
| 230 | Ga0207711_10000669 | 3300025941 | Bacteria | 34078 |
| 231 | Ga0207711_10001710 | 3300025941 | Bacteria | 20197 |
| 232 | Ga0207711_10002365 | 3300025941 | Bacteria | 16890 |
| 233 | Ga0207711_10035152 | 3300025941 | Bacteria | 4246 |
| 234 | Ga0207711_10078303 | 3300025941 | Bacteria | 2883 |
| 235 | Ga0207711_10149504 | 3300025941 | Bacteria | 2107 |
| 236 | Ga0207689_10054823 | 3300025942 | Bacteria | 3282 |
| 237 | Ga0207679_10004250 | 3300025945 | Bacteria | 8902 |
| 238 | Ga0207679_10142440 | 3300025945 | Bacteria | 1940 |
| 239 | Ga0207667_10003535 | 3300025949 | Bacteria | 19325 |
| 240 | Ga0207667_10060083 | 3300025949 | Bacteria | 3979 |
| 241 | Ga0207667_10079569 | 3300025949 | Bacteria | 3397 |
| 242 | Ga0207667_10095078 | 3300025949 | Bacteria | 3076 |
| 243 | Ga0207667_10504864 | 3300025949 | Bacteria | 1226 |
| 244 | Ga0207651_10189711 | 3300025960 | Bacteria | 1638 |
| 245 | Ga0207712_10000758 | 3300025961 | Bacteria | 24361 |
| 246 | Ga0207668_10000010 | 3300025972 | Bacteria | 185249 |
| 247 | Ga0207668_10000108 | 3300025972 | Bacteria | 59119 |
| 248 | Ga0207668_10002370 | 3300025972 | Bacteria | 11009 |
| 249 | Ga0207668_10010421 | 3300025972 | Bacteria | 5614 |
| 250 | Ga0207668_10024326 | 3300025972 | Bacteria | 3907 |
| 251 | Ga0207640_10345286 | 3300025981 | Bacteria | 1194 |
| 252 | Ga0207658_10000265 | 3300025986 | Bacteria | 55108 |
| 253 | Ga0207658_10044033 | 3300025986 | Bacteria | 3248 |
| 254 | Ga0207658_10072468 | 3300025986 | Bacteria | 2611 |
| 255 | Ga0207658_10086970 | 3300025986 | Bacteria | 2412 |
| 256 | Ga0207658_10596361 | 3300025986 | Bacteria | 992 |
| 257 | Ga0207677_10130839 | 3300026023 | Bacteria | 1905 |
| 258 | Ga0207677_11034575 | 3300026023 | Bacteria | 746 |
| 259 | Ga0207703_10000082 | 3300026035 | Bacteria | 110579 |
| 260 | Ga0207703_10014762 | 3300026035 | Bacteria | 6097 |
| 261 | Ga0207703_10020945 | 3300026035 | Bacteria | 5116 |
| 262 | Ga0207703_10194158 | 3300026035 | Bacteria | 1800 |
| 263 | Ga0207703_10434040 | 3300026035 | Bacteria | 1224 |
| 264 | Ga0207639_10022198 | 3300026041 | Bacteria | 4569 |
| 265 | Ga0207639_10154333 | 3300026041 | Bacteria | 1927 |
| 266 | Ga0207639_11089405 | 3300026041 | Bacteria | 749 |
| 267 | Ga0207702_10042818 | 3300026078 | Bacteria | 3800 |
| 268 | Ga0207702_10346680 | 3300026078 | Bacteria | 1420 |
| 269 | Ga0207641_10000007 | 3300026088 | Bacteria | 441443 |
| 270 | Ga0207641_10001651 | 3300026088 | Bacteria | 21777 |
| 271 | Ga0207641_10007794 | 3300026088 | Bacteria | 8898 |
| 272 | Ga0207641_10166119 | 3300026088 | Bacteria | 2010 |
| 273 | Ga0207641_10271717 | 3300026088 | Bacteria | 1591 |
| 274 | Ga0207641_10548126 | 3300026088 | Bacteria | 1127 |
| 275 | Ga0207676_10000183 | 3300026095 | Bacteria | 55220 |
| 276 | Ga0207676_10000241 | 3300026095 | Bacteria | 47707 |
| 277 | Ga0207676_10017590 | 3300026095 | Bacteria | 5183 |
| 278 | Ga0207676_10357631 | 3300026095 | Bacteria | 1352 |
| 279 | Ga0207676_11274646 | 3300026095 | Bacteria | 729 |
| 280 | Ga0207674_10158408 | 3300026116 | Bacteria | 2219 |
| 281 | Ga0207675_100107085 | 3300026118 | Bacteria | 2636 |
| 282 | Ga0207675_100656774 | 3300026118 | Bacteria | 1055 |
| 283 | Ga0207675_100721546 | 3300026118 | Bacteria | 1007 |
| 284 | Ga0207683_10015037 | 3300026121 | Bacteria | 6587 |
| 285 | Ga0207698_10213695 | 3300026142 | Bacteria | 1737 |
| 286 | Ga0207698_11287074 | 3300026142 | Bacteria | 746 |
| 287 | Ga0209281_1013891 | 3300027111 | Bacteria | 1721 |
| 288 | Ga0209813_10032610 | 3300027866 | Bacteria | 1545 |
| 289 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 290 | Ga0268266_10000656 | 3300028379 | Bacteria | 46813 |
| 291 | Ga0268266_10005366 | 3300028379 | Bacteria | 11979 |
| 292 | Ga0268266_10218545 | 3300028379 | Bacteria | 1751 |
| 293 | Ga0268266_10240639 | 3300028379 | Bacteria | 1670 |
| 294 | Ga0268266_10443235 | 3300028379 | Bacteria | 1233 |
| 295 | Ga0268265_10001171 | 3300028380 | Bacteria | 22981 |
| 296 | Ga0268265_10006429 | 3300028380 | Bacteria | 7965 |
| 297 | Ga0268265_10038568 | 3300028380 | Bacteria | 3515 |
| 298 | Ga0268265_10055110 | 3300028380 | Bacteria | 3020 |
| 299 | Ga0268265_10057571 | 3300028380 | Bacteria | 2963 |
| 300 | Ga0268265_10112329 | 3300028380 | Bacteria | 2227 |
| 301 | Ga0268265_10127299 | 3300028380 | Bacteria | 2110 |
| 302 | Ga0268265_10221228 | 3300028380 | Bacteria | 1657 |
| 303 | Ga0268264_10000110 | 3300028381 | Bacteria | 206663 |
| 304 | Ga0268264_10000125 | 3300028381 | Bacteria | 186416 |
| 305 | Ga0268264_10037317 | 3300028381 | Bacteria | 4006 |
| 306 | Ga0268264_10105324 | 3300028381 | Bacteria | 2460 |
| 307 | Ga0268264_10119463 | 3300028381 | Bacteria | 2321 |
| 308 | Ga0268264_10648218 | 3300028381 | Bacteria | 1045 |
| 309 | Ga0268264_10747980 | 3300028381 | Bacteria | 974 |
| 310 | Ga0265337_1007448 | 3300028556 | Bacteria | 4094 |
| 311 | Ga0265326_10008000 | 3300028558 | Bacteria | 3211 |
| 312 | Ga0307517_10001402 | 3300028786 | Bacteria | 40531 |
| 313 | Ga0307517_10059611 | 3300028786 | Bacteria | 3651 |
| 314 | Ga0307517_10320056 | 3300028786 | Bacteria | 859 |
| 315 | Ga0307515_10005814 | 3300028794 | Bacteria | 24897 |
| 316 | Ga0307515_10085154 | 3300028794 | Bacteria | 4049 |
| 317 | Ga0265338_10025285 | 3300028800 | Bacteria | 6031 |
| 318 | Ga0265338_10028732 | 3300028800 | Bacteria | 5537 |
| 319 | Ga0265338_10031038 | 3300028800 | Bacteria | 5247 |
| 320 | Ga0265338_10052621 | 3300028800 | Bacteria | 3651 |
| 321 | Ga0265338_10058720 | 3300028800 | Bacteria | 3393 |
| 322 | Ga0265338_10671416 | 3300028800 | Bacteria | 717 |
| 323 | Ga0265324_10081898 | 3300029957 | Bacteria | 1098 |
| 324 | Ga0265340_10243103 | 3300031247 | Bacteria | 803 |
| 325 | Ga0265327_10000130 | 3300031251 | Bacteria | 165066 |
| 326 | Ga0265327_10002013 | 3300031251 | Bacteria | 22950 |
| 327 | Ga0265327_10044047 | 3300031251 | Bacteria | 2382 |
| 328 | Ga0265316_10729134 | 3300031344 | Bacteria | 698 |
| 329 | Ga0307513_10000077 | 3300031456 | Bacteria | 134167 |
| 330 | Ga0307513_10003700 | 3300031456 | Bacteria | 20671 |
| 331 | Ga0307513_10010991 | 3300031456 | Bacteria | 11295 |
| 332 | Ga0307513_10022306 | 3300031456 | Bacteria | 7446 |
| 333 | Ga0307513_10140360 | 3300031456 | Bacteria | 2344 |
| 334 | Ga0307513_10216508 | 3300031456 | Bacteria | 1741 |
| 335 | Ga0307513_10405850 | 3300031456 | Bacteria | 1096 |
| 336 | Ga0307408_100268800 | 3300031548 | Bacteria | 1415 |
| 337 | Ga0265313_10174950 | 3300031595 | Bacteria | 905 |
| 338 | Ga0265314_10008476 | 3300031711 | Bacteria | 8799 |
| 339 | Ga0265314_10081291 | 3300031711 | Bacteria | 2136 |
| 340 | Ga0265314_10246885 | 3300031711 | Bacteria | 1027 |
| 341 | Ga0265342_10080481 | 3300031712 | Bacteria | 1882 |
| 342 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 343 | Ga0307405_10290772 | 3300031731 | Bacteria | 1235 |
| 344 | Ga0307413_10018776 | 3300031824 | Bacteria | 3636 |
| 345 | Ga0307410_10287561 | 3300031852 | Bacteria | 1293 |
| 346 | Ga0307410_10442740 | 3300031852 | Bacteria | 1058 |
| 347 | Ga0307406_10409942 | 3300031901 | Bacteria | 1077 |
| 348 | Ga0307407_10083402 | 3300031903 | Bacteria | 1939 |
| 349 | Ga0307407_10458433 | 3300031903 | Bacteria | 927 |
| 350 | Ga0307409_100020575 | 3300031995 | Bacteria | 4501 |
| 351 | Ga0307414_10512579 | 3300032004 | Bacteria | 1063 |
| 352 | Ga0307411_10147329 | 3300032005 | Bacteria | 1744 |
| 353 | Ga0307415_100741727 | 3300032126 | Bacteria | 891 |
| 354 | Ga0307510_10002396 | 3300033180 | Bacteria | 21254 |
| 355 | Ga0307510_10104784 | 3300033180 | Bacteria | 2600 |
| 356 | Ga0373944_0003544 | 3300035089 | Bacteria | 4036 |
| 357 | Ga0373936_0004632 | 3300035113 | Bacteria | 5201 |
| 358 | Ga0373941_0029632 | 3300035115 | Bacteria | 1616 |
| 359 | Ga0373960_0023318 | 3300035121 | Bacteria | 1666 |
| 360 | Ga0373942_0004841 | 3300035207 | Bacteria | 3126 |
| 361 | Ga0373927_0000472 | 3300035695 | Bacteria | 30834 |
| 362 | Ga0373933_0203689 | 3300035724 | Bacteria | 1267 |
| 363 | Ga0373947_0243254 | 3300035725 | Bacteria | 1188 |
| 364 | Ga0373937_0097527 | 3300036401 | Bacteria | 2727 |
| 365 | Ga0373937_0237520 | 3300036401 | Bacteria | 1717 |
| 366 | Ga0373925_0000003 | 3300037068 | Bacteria | 362401 |
| 367 | Ga0373925_0025075 | 3300037068 | Bacteria | 4355 |
| 368 | Ga0395899_0000016 | 3300037312 | Bacteria | 468322 |
| 369 | Ga0395899_0000498 | 3300037312 | Bacteria | 43627 |
| 370 | Ga0395899_0141846 | 3300037312 | Bacteria | 1709 |
| 371 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 372 | Ga0395900_0083540 | 3300037418 | Bacteria | 3281 |
| 373 | Ga0395900_0308438 | 3300037418 | Bacteria | 1566 |
| 374 | Ga0395900_0453618 | 3300037418 | Bacteria | 1238 |
| 375 | Ga0395898_0062872 | 3300037466 | Bacteria | 3603 |
| 376 | Ga0395898_0079926 | 3300037466 | Bacteria | 3153 |
| 377 | Ga0395905_0001355 | 3300037471 | Bacteria | 29823 |
| 378 | Ga0395905_0009683 | 3300037471 | Bacteria | 9406 |
| 379 | Ga0395905_0154768 | 3300037471 | Bacteria | 2156 |
| 380 | Ga0395905_0307066 | 3300037471 | Bacteria | 1475 |
| 381 | Ga0395905_0525428 | 3300037471 | Bacteria | 1084 |
| 382 | Ga0436364_0481903 | 3300037853 | Bacteria | 2556 |
| 383 | Ga0436364_0882847 | 3300037853 | Bacteria | 3537 |
| 384 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 385 | Ga0395901_0119434 | 3300038443 | Bacteria | 2770 |
| 386 | Ga0395901_0197473 | 3300038443 | Bacteria | 2109 |
| 387 | Ga0395901_0205575 | 3300038443 | Bacteria | 2063 |
| 388 | Ga0395901_0288213 | 3300038443 | Bacteria | 1704 |
| 389 | Ga0436365_0187494 | 3300039437 | Bacteria | 67801 |
| 390 | Ga0436365_0368117 | 3300039437 | Bacteria | 3063 |
| 391 | Ga0436365_0884483 | 3300039437 | Bacteria | 9260 |
| 392 | Ga0436365_1923138 | 3300039437 | Bacteria | 1485 |
| 393 | Ga0436360_0945988 | 3300039438 | Bacteria | 894 |
| 394 | Ga0436360_1148462 | 3300039438 | Bacteria | 2296 |
| 395 | Ga0436360_1296374 | 3300039438 | Bacteria | 1627 |
| 396 | Ga0436361_0104010 | 3300039447 | Bacteria | 17086 |
| 397 | Ga0436361_0564979 | 3300039447 | Bacteria | 1999 |
| 398 | Ga0436361_0741749 | 3300039447 | Bacteria | 2739 |
| 399 | Ga0436361_1172229 | 3300039447 | Bacteria | 3117 |
| 400 | Ga0436363_1475916 | 3300039450 | Bacteria | 4420 |
| 401 | Ga0439438_102225 | 3300041405 | Bacteria | 695 |
| 402 | Ga0439431_0076912 | 3300041997 | Bacteria | 896 |
| 403 | Ga0439446_0086344 | 3300042156 | Bacteria | 977 |
| 404 | Ga0439435_0014860 | 3300042436 | Bacteria | 1929 |
| 405 | Ga0450901_002375 | 3300042533 | Bacteria | 2037 |
| 406 | Ga0466966_0144037 | 3300044684 | Bacteria | 1455 |
| 407 | Ga0466966_0241279 | 3300044684 | Bacteria | 1090 |
| 408 | Ga0466968_0099559 | 3300044735 | Bacteria | 1296 |
| 409 | Ga0466960_0047359 | 3300044901 | Bacteria | 2062 |
| 410 | Ga0495617_053556 | 3300046452 | Bacteria | 1340 |
| 411 | Ga0495627_004929 | 3300046453 | Bacteria | 5487 |
| 412 | Ga0495590_0022517 | 3300046457 | Bacteria | 2228 |
| 413 | Ga0495629_0019869 | 3300046459 | Bacteria | 4794 |
| 414 | Ga0495638_0000530 | 3300046460 | Bacteria | 44348 |
| 415 | Ga0495638_0001235 | 3300046460 | Bacteria | 24108 |
| 416 | Ga0495638_0005396 | 3300046460 | Bacteria | 9525 |
| 417 | Ga0495638_0008848 | 3300046460 | Bacteria | 7106 |
| 418 | Ga0495638_0009539 | 3300046460 | Bacteria | 6801 |
| 419 | Ga0495638_0266893 | 3300046460 | Bacteria | 936 |
| 420 | Ga0495653_0541692 | 3300046463 | Bacteria | 721 |
| 421 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 422 | Ga0495650_0061598 | 3300046471 | Bacteria | 1502 |
| 423 | Ga0495650_0077380 | 3300046471 | Bacteria | 1291 |
| 424 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 425 | Ga0495583_0028948 | 3300046506 | Bacteria | 2716 |
| 426 | Ga0495583_0063093 | 3300046506 | Bacteria | 1648 |
| 427 | Ga0495583_0195837 | 3300046506 | Bacteria | 823 |
| 428 | Ga0495606_0038419 | 3300046507 | Bacteria | 3239 |
| 429 | Ga0495606_0083232 | 3300046507 | Bacteria | 1984 |
| 430 | Ga0495610_0000478 | 3300046512 | Bacteria | 41250 |
| 431 | Ga0495610_0000679 | 3300046512 | Bacteria | 32891 |
| 432 | Ga0495610_0007161 | 3300046512 | Bacteria | 7507 |
| 433 | Ga0495616_0000099 | 3300046513 | Bacteria | 73607 |
| 434 | Ga0495616_0028726 | 3300046513 | Bacteria | 2941 |
| 435 | Ga0495620_0027085 | 3300046515 | Bacteria | 2687 |
| 436 | Ga0495630_0318924 | 3300046517 | Bacteria | 1188 |
| 437 | Ga0495631_0007265 | 3300046518 | Bacteria | 5645 |
| 438 | Ga0495632_0005209 | 3300046519 | Bacteria | 8667 |
| 439 | Ga0495637_0003545 | 3300046520 | Bacteria | 8271 |
| 440 | Ga0495637_0073993 | 3300046520 | Bacteria | 1369 |
| 441 | Ga0495643_0006929 | 3300046522 | Bacteria | 7373 |
| 442 | Ga0495648_0000634 | 3300046524 | Bacteria | 37553 |
| 443 | Ga0495648_0157746 | 3300046524 | Bacteria | 1176 |
| 444 | Ga0495642_0219450 | 3300046528 | Bacteria | 830 |
| 445 | Ga0495652_0058471 | 3300046529 | Bacteria | 3264 |
| 446 | Ga0495654_0000135 | 3300046530 | Bacteria | 77516 |
| 447 | Ga0495654_0146032 | 3300046530 | Bacteria | 1050 |
| 448 | Ga0495654_0180499 | 3300046530 | Bacteria | 914 |
| 449 | Ga0495609_0060216 | 3300046538 | Bacteria | 1679 |
| 450 | Ga0495621_0179988 | 3300046539 | Bacteria | 843 |
| 451 | Ga0495597_0207097 | 3300046542 | Bacteria | 783 |
| 452 | Ga0495645_0057116 | 3300046543 | Bacteria | 2834 |
| 453 | Ga0495622_0000762 | 3300046557 | Bacteria | 18003 |
| 454 | Ga0495633_0000423 | 3300046558 | Bacteria | 43996 |
| 455 | Ga0495633_0117414 | 3300046558 | Bacteria | 1233 |
| 456 | Ga0495668_0000291 | 3300046616 | Bacteria | 68802 |
| 457 | Ga0495668_0005259 | 3300046616 | Bacteria | 8860 |
| 458 | Ga0495668_0019454 | 3300046616 | Bacteria | 3913 |
| 459 | Ga0495668_0021477 | 3300046616 | Bacteria | 3701 |
| 460 | Ga0495668_0039891 | 3300046616 | Bacteria | 2620 |
| 461 | Ga0495668_0093250 | 3300046616 | Bacteria | 1649 |
| 462 | Ga0495668_0115627 | 3300046616 | Bacteria | 1467 |
| 463 | Ga0495625_0001134 | 3300046660 | Bacteria | 34437 |
| 464 | Ga0495625_0003614 | 3300046660 | Bacteria | 15193 |
| 465 | Ga0495625_0010213 | 3300046660 | Bacteria | 7789 |
| 466 | Ga0495625_0031018 | 3300046660 | Bacteria | 3979 |
| 467 | Ga0495625_0040043 | 3300046660 | Bacteria | 3420 |
| 468 | Ga0495625_0070340 | 3300046660 | Bacteria | 2457 |
| 469 | Ga0495625_0191523 | 3300046660 | Bacteria | 1354 |
| 470 | Ga0495588_0266618 | 3300046674 | Bacteria | 902 |
| 471 | Ga0495669_0000044 | 3300046684 | Bacteria | 85633 |
| 472 | Ga0495669_0000152 | 3300046684 | Bacteria | 44284 |
| 473 | Ga0495669_0026139 | 3300046684 | Bacteria | 2550 |
| 474 | Ga0495669_0055181 | 3300046684 | Bacteria | 1789 |
| 475 | Ga0495669_0137431 | 3300046684 | Bacteria | 1153 |
| 476 | Ga0495613_0004090 | 3300046689 | Bacteria | 10901 |
| 477 | Ga0495613_0253042 | 3300046689 | Bacteria | 1229 |
| 478 | Ga0495624_0258863 | 3300046690 | Bacteria | 1052 |
| 479 | Ga0495671_0146783 | 3300046692 | Bacteria | 1148 |
| 480 | Ga0495671_0147930 | 3300046692 | Bacteria | 1144 |
| 481 | Ga0495671_0290240 | 3300046692 | Bacteria | 787 |
| 482 | Ga0495649_0000262 | 3300046694 | Bacteria | 46820 |
| 483 | Ga0495589_0028088 | 3300046794 | Bacteria | 2841 |
| 484 | Ga0495660_0059882 | 3300046810 | Bacteria | 2047 |
| 485 | Ga0495672_0000784 | 3300047320 | Bacteria | 34445 |
| 486 | Ga0495672_0004858 | 3300047320 | Bacteria | 10818 |
| 487 | Ga0495672_0028037 | 3300047320 | Bacteria | 3570 |
| 488 | Ga0495683_0117628 | 3300047323 | Bacteria | 1264 |
| 489 | Ga0495687_044573 | 3300047443 | Bacteria | 1927 |
| 490 | Ga0495677_0146016 | 3300047445 | Bacteria | 909 |
| 491 | Ga0495677_0207543 | 3300047445 | Bacteria | 762 |
| 492 | Ga0495679_003275 | 3300047446 | Bacteria | 7844 |
| 493 | Ga0495673_0000340 | 3300047469 | Bacteria | 59502 |
| 494 | Ga0495673_0001300 | 3300047469 | Bacteria | 20332 |
| 495 | Ga0495673_0003929 | 3300047469 | Bacteria | 9530 |
| 496 | Ga0495673_0218700 | 3300047469 | Bacteria | 706 |
| 497 | Ga0495681_0017489 | 3300047470 | Bacteria | 3978 |
| 498 | Ga0495681_0031241 | 3300047470 | Bacteria | 2699 |
| 499 | Ga0495686_0001205 | 3300047472 | Bacteria | 29808 |
| 500 | Ga0495686_0004549 | 3300047472 | Bacteria | 11369 |
| 501 | Ga0495686_0022417 | 3300047472 | Bacteria | 4180 |
| 502 | Ga0495686_0035200 | 3300047472 | Bacteria | 3221 |
| 503 | Ga0495686_0037968 | 3300047472 | Bacteria | 3084 |
| 504 | Ga0495686_0043703 | 3300047472 | Bacteria | 2839 |
| 505 | Ga0495593_0071401 | 3300047673 | Bacteria | 1803 |
| 506 | Ga0496101_0009511 | 3300048904 | Bacteria | 6388 |
| 507 | Ga0496101_0059471 | 3300048904 | Bacteria | 2770 |
| 508 | Ga0496102_0011792 | 3300048905 | Bacteria | 7543 |
| 509 | Ga0496106_0004442 | 3300048909 | Bacteria | 10395 |
| 510 | Ga0496106_0529481 | 3300048909 | Bacteria | 946 |
| 511 | Ga0496106_0553305 | 3300048909 | Bacteria | 923 |
| 512 | Ga0496107_0000987 | 3300048910 | Bacteria | 16906 |
| 513 | Ga0496107_0104495 | 3300048910 | Bacteria | 2079 |
| 514 | Ga0496108_0054241 | 3300048911 | Bacteria | 3364 |
| 515 | Ga0496112_0227562 | 3300048915 | Bacteria | 1820 |
| 516 | Ga0496115_0000126 | 3300048918 | Bacteria | 69044 |
| 517 | Ga0496115_0003595 | 3300048918 | Bacteria | 11143 |
| 518 | Ga0496115_0013222 | 3300048918 | Bacteria | 6236 |
| 519 | Ga0496115_0039144 | 3300048918 | Bacteria | 3765 |
| 520 | Ga0496115_0050885 | 3300048918 | Bacteria | 3321 |
| 521 | Ga0496115_0191913 | 3300048918 | Bacteria | 1688 |
| 522 | Ga0496115_0679669 | 3300048918 | Bacteria | 811 |
| 523 | Ga0496116_0212130 | 3300048919 | Bacteria | 1002 |
| 524 | Ga0496117_0116167 | 3300048920 | Bacteria | 1654 |
| 525 | Ga0496118_0031844 | 3300048921 | Bacteria | 4361 |
| 526 | Ga0496119_0059930 | 3300048922 | Bacteria | 2282 |
| 527 | Ga0496121_0000035 | 3300048924 | Bacteria | 374316 |
| 528 | Ga0496121_0007098 | 3300048924 | Bacteria | 13597 |
| 529 | Ga0496121_0139465 | 3300048924 | Bacteria | 1801 |
| 530 | Ga0496121_0354203 | 3300048924 | Bacteria | 976 |
| 531 | Ga0496121_0475548 | 3300048924 | Bacteria | 799 |
| 532 | Ga0496122_0002454 | 3300048925 | Bacteria | 26240 |
| 533 | Ga0496123_0004303 | 3300048926 | Bacteria | 15121 |
| 534 | Ga0496124_0145643 | 3300048927 | Bacteria | 1864 |
| 535 | Ga0496124_0389121 | 3300048927 | Bacteria | 972 |
| 536 | Ga0496124_0518894 | 3300048927 | Bacteria | 794 |
| 537 | Ga0496125_0047317 | 3300048928 | Bacteria | 3599 |
| 538 | Ga0496125_0078633 | 3300048928 | Bacteria | 2534 |
| 539 | Ga0496126_0167919 | 3300048929 | Bacteria | 1871 |
| 540 | Ga0495678_000699 | 3300049459 | Bacteria | 30520 |
| 541 | Ga0501033_0005322 | 3300049570 | Bacteria | 10196 |
| 542 | Ga0501033_0076362 | 3300049570 | Bacteria | 2459 |
| 543 | Ga0501033_0231933 | 3300049570 | Bacteria | 1311 |
| 544 | Ga0501034_0013241 | 3300049571 | Bacteria | 8498 |
| 545 | Ga0501034_0086368 | 3300049571 | Bacteria | 3138 |
| 546 | Ga0501034_0088709 | 3300049571 | Bacteria | 3090 |
| 547 | Ga0501034_0222240 | 3300049571 | Bacteria | 1841 |
| 548 | Ga0501036_0013734 | 3300049572 | Bacteria | 6733 |
| 549 | Ga0501037_0078237 | 3300049573 | Bacteria | 2400 |
| 550 | Ga0501037_0147796 | 3300049573 | Bacteria | 1680 |
| 551 | Ga0501038_0078567 | 3300049574 | Bacteria | 2784 |
| 552 | Ga0501043_0593111 | 3300049579 | Bacteria | 819 |
| 553 | Ga0501046_0007634 | 3300049580 | Bacteria | 9486 |
| 554 | Ga0501047_0020536 | 3300049581 | Bacteria | 6340 |
| 555 | Ga0501047_0232637 | 3300049581 | Bacteria | 1696 |
| 556 | Ga0501048_0133585 | 3300049582 | Bacteria | 1753 |
| 557 | Ga0501048_0331697 | 3300049582 | Bacteria | 1084 |
| 558 | Ga0501067_0083838 | 3300049583 | Bacteria | 1768 |
| 559 | Ga0501067_0199285 | 3300049583 | Bacteria | 1115 |
| 560 | Ga0501068_0110266 | 3300049584 | Bacteria | 1710 |
| 561 | Ga0501069_0089060 | 3300049585 | Bacteria | 1744 |
| 562 | Ga0501070_0038246 | 3300049586 | Bacteria | 4003 |
| 563 | Ga0501071_0205616 | 3300049587 | Bacteria | 1480 |
| 564 | Ga0501072_0020753 | 3300049588 | Bacteria | 5092 |
| 565 | Ga0501072_0430716 | 3300049588 | Bacteria | 1045 |
| 566 | Ga0501073_0007955 | 3300049589 | Bacteria | 7867 |
| 567 | Ga0501074_0013123 | 3300049590 | Bacteria | 6023 |
| 568 | Ga0501076_0282774 | 3300049592 | Bacteria | 1359 |
| 569 | Ga0501238_002038 | 3300049671 | Bacteria | 2374 |
| 570 | Ga0501238_015871 | 3300049671 | Bacteria | 1041 |
| 571 | Ga0501257_078181 | 3300049686 | Bacteria | 851 |
| 572 | Ga0501079_0223183 | 3300049741 | Bacteria | 1472 |
| 573 | Ga0501080_0003547 | 3300049742 | Bacteria | 13746 |
| 574 | Ga0501083_0047271 | 3300049744 | Bacteria | 2908 |
| 575 | Ga0501083_0061207 | 3300049744 | Bacteria | 2513 |
| 576 | Ga0501083_0124013 | 3300049744 | Bacteria | 1693 |
| 577 | Ga0501083_0150451 | 3300049744 | Bacteria | 1524 |
| 578 | Ga0501083_0338908 | 3300049744 | Bacteria | 978 |
| 579 | Ga0501035_0032673 | 3300049822 | Bacteria | 4734 |
| 580 | Ga0501035_0144201 | 3300049822 | Bacteria | 2069 |
| 581 | Ga0501035_0641058 | 3300049822 | Bacteria | 862 |
| 582 | Ga0501044_0003542 | 3300049823 | Bacteria | 17572 |
| 583 | Ga0501044_0005817 | 3300049823 | Bacteria | 13658 |
| 584 | Ga0501044_0152496 | 3300049823 | Bacteria | 2292 |
| 585 | Ga0501044_0182925 | 3300049823 | Bacteria | 2062 |
| 586 | Ga0501044_1044678 | 3300049823 | Bacteria | 688 |
| 587 | nmdc:mga03683_37218_c1 | 3300050489 | Bacteria | 1982 |
| 588 | nmdc:mga00v17_13387_c1 | 3300050491 | Bacteria | 4553 |
| 589 | nmdc:mga0yw44_57632_c1 | 3300050492 | Bacteria | 2370 |
| 590 | nmdc:mga0k408_197815_c1 | 3300050493 | Bacteria | 1200 |
| 591 | nmdc:mga06z11_10651_c1 | 3300050494 | Bacteria | 3927 |
| 592 | nmdc:mga06z11_6144_c1 | 3300050494 | Bacteria | 4863 |
| 593 | nmdc:mga04h51_36997_c1 | 3300050495 | Bacteria | 1574 |
| 594 | nmdc:mga07m45_182729_c1 | 3300050496 | Bacteria | 1219 |
| 595 | nmdc:mga07m45_2301_c1 | 3300050496 | Bacteria | 8942 |
| 596 | nmdc:mga07m45_281749_c1 | 3300050496 | Bacteria | 967 |
| 597 | nmdc:mga07m45_76195_c1 | 3300050496 | Bacteria | 1912 |
| 598 | nmdc:mga0sz30_136302_c1 | 3300050516 | Bacteria | 1083 |
| 599 | Ga0500635_0000133 | 3300053080 | Bacteria | 42884 |
| 600 | Ga0500578_0000159 | 3300053086 | Bacteria | 79246 |
| 601 | Ga0500643_002501 | 3300053087 | Bacteria | 9423 |
| 602 | Ga0500643_005142 | 3300053087 | Bacteria | 5711 |
| 603 | Ga0500643_033645 | 3300053087 | Bacteria | 1548 |
| 604 | Ga0500644_0000269 | 3300053088 | Bacteria | 29380 |
| 605 | Ga0500646_0076038 | 3300053090 | Bacteria | 1016 |
| 606 | Ga0500647_0022880 | 3300053091 | Bacteria | 2928 |
| 607 | Ga0500583_0248562 | 3300053092 | Bacteria | 878 |
| 608 | Ga0500651_0095259 | 3300053093 | Bacteria | 1830 |
| 609 | Ga0500566_0032049 | 3300053094 | Bacteria | 3064 |
| 610 | Ga0500641_0000896 | 3300053096 | Bacteria | 10669 |
| 611 | Ga0500641_0004136 | 3300053096 | Bacteria | 5121 |
| 612 | Ga0500641_0013309 | 3300053096 | Bacteria | 3021 |
| 613 | Ga0500641_0045274 | 3300053096 | Bacteria | 1792 |
| 614 | Ga0500650_0021086 | 3300053098 | Bacteria | 2867 |
| 615 | Ga0500554_001916 | 3300053102 | Bacteria | 4024 |
| 616 | Ga0500555_001064 | 3300053103 | Bacteria | 9234 |
| 617 | Ga0500556_0001862 | 3300053104 | Bacteria | 7599 |
| 618 | Ga0500556_0006820 | 3300053104 | Bacteria | 3251 |
| 619 | Ga0500562_000588 | 3300053108 | Bacteria | 8715 |
| 620 | Ga0500562_001014 | 3300053108 | Bacteria | 6863 |
| 621 | Ga0500562_024537 | 3300053108 | Bacteria | 1576 |
| 622 | Ga0500562_032147 | 3300053108 | Bacteria | 1385 |
| 623 | Ga0500572_002558 | 3300053111 | Bacteria | 4338 |
| 624 | Ga0500594_0000226 | 3300053118 | Bacteria | 13704 |
| 625 | Ga0500595_015445 | 3300053119 | Bacteria | 2864 |
| 626 | Ga0500595_045767 | 3300053119 | Bacteria | 1380 |
| 627 | Ga0500597_283832 | 3300053120 | Bacteria | 666 |
| 628 | Ga0500607_035997 | 3300053121 | Bacteria | 2705 |
| 629 | Ga0500608_001098 | 3300053122 | Bacteria | 9615 |
| 630 | Ga0500608_082009 | 3300053122 | Bacteria | 1520 |
| 631 | Ga0500614_010503 | 3300053123 | Bacteria | 1989 |
| 632 | Ga0500614_046227 | 3300053123 | Bacteria | 1126 |
| 633 | Ga0500618_000642 | 3300053125 | Bacteria | 20854 |
| 634 | Ga0500655_064552 | 3300053133 | Bacteria | 741 |
| 635 | Ga0500655_086654 | 3300053133 | Bacteria | 648 |
| 636 | Ga0500658_0005773 | 3300053134 | Bacteria | 4611 |
| 637 | Ga0500559_0000224 | 3300053136 | Bacteria | 45272 |
| 638 | Ga0500559_0000334 | 3300053136 | Bacteria | 35292 |
| 639 | Ga0500559_0023182 | 3300053136 | Bacteria | 2635 |
| 640 | Ga0500559_0029080 | 3300053136 | Bacteria | 2364 |
| 641 | Ga0500559_0107809 | 3300053136 | Bacteria | 1288 |
| 642 | Ga0500564_001489 | 3300053138 | Bacteria | 8118 |
| 643 | Ga0500564_170143 | 3300053138 | Bacteria | 916 |
| 644 | Ga0500568_0117014 | 3300053139 | Bacteria | 994 |
| 645 | Ga0500573_0165997 | 3300053140 | Bacteria | 1198 |
| 646 | Ga0500577_0000945 | 3300053142 | Bacteria | 7520 |
| 647 | Ga0500590_006941 | 3300053148 | Bacteria | 5552 |
| 648 | Ga0500590_063460 | 3300053148 | Bacteria | 1852 |
| 649 | Ga0500603_004616 | 3300053150 | Bacteria | 2951 |
| 650 | Ga0500616_0001137 | 3300053153 | Bacteria | 27368 |
| 651 | Ga0500616_0003555 | 3300053153 | Bacteria | 11807 |
| 652 | Ga0500616_0141782 | 3300053153 | Bacteria | 1122 |
| 653 | Ga0500619_024565 | 3300053154 | Bacteria | 1774 |
| 654 | Ga0500622_0002499 | 3300053156 | Bacteria | 13230 |
| 655 | Ga0500622_0090082 | 3300053156 | Bacteria | 1523 |
| 656 | Ga0500622_0092732 | 3300053156 | Bacteria | 1496 |
| 657 | Ga0500622_0160018 | 3300053156 | Bacteria | 1056 |
| 658 | Ga0500627_0018747 | 3300053158 | Bacteria | 2744 |
| 659 | Ga0500639_210764 | 3300053163 | Bacteria | 823 |
| 660 | Ga0500636_0018937 | 3300053177 | Bacteria | 4072 |
| 661 | Ga0500625_013605 | 3300053729 | Bacteria | 3744 |
| 662 | Ga0500645_002410 | 3300053730 | Bacteria | 8378 |
| 663 | Ga0500645_002629 | 3300053730 | Bacteria | 7863 |
| 664 | Ga0500645_006703 | 3300053730 | Bacteria | 4084 |
| 665 | Ga0500645_012605 | 3300053730 | Bacteria | 2730 |
| 666 | Ga0500609_001140 | 3300053731 | Bacteria | 3950 |
| 667 | Ga0500596_000673 | 3300053735 | Bacteria | 6630 |
| 668 | Ga0501084_0065375 | 3300054114 | Bacteria | 3043 |
| 669 | Ga0501084_0115580 | 3300054114 | Bacteria | 2255 |
| 670 | Ga0501082_0014678 | 3300060353 | Bacteria | 6750 |
| 671 | Ga0501082_0041845 | 3300060353 | Bacteria | 3950 |
| 672 | Ga0501082_0257091 | 3300060353 | Bacteria | 1519 |
| 673 | 2511122576 | 2510917020 | Bacteria | 5657507 |
| 674 | 2585148166 | 2582581279 | Bacteria | 4980720 |
| 675 | 2585155187 | 2582581280 | Bacteria | 5994497 |
| 676 | 2585194868 | 2582581293 | Bacteria | 5907401 |
| 677 | 2587917071 | 2585428106 | Bacteria | 5179711 |
| 678 | 2643747335 | 2643221545 | Bacteria | 5083237 |
| 679 | 2643779933 | 2643221552 | Bacteria | 5708754 |
| 680 | 2643922717 | 2643221583 | Bacteria | 5218014 |
| 681 | 2643929880 | 2643221584 | Bacteria | 5511711 |
| 682 | 2644001551 | 2643221598 | Bacteria | 4578346 |
| 683 | 2644088038 | 2643221614 | Bacteria | 4260023 |
| 684 | 2644223724 | 2643221640 | Bacteria | 5258820 |
| 685 | 2644236188 | 2643221642 | Bacteria | 5357871 |
| 686 | 2644344075 | 2643221661 | Bacteria | 4267604 |
| 687 | 2644367395 | 2643221666 | Bacteria | 4265935 |
| 688 | 2644507468 | 2643221691 | Bacteria | 5093099 |
| 689 | 2644549910 | 2643221699 | Bacteria | 5731501 |
| 690 | 2644551725 | 2643221699 | Bacteria | 5731501 |
| 691 | 2792461680 | 2791355048 | Bacteria | 5832535 |
| 692 | 2819538518 | 2818991435 | Bacteria | 5433759 |
| 693 | 2819648037 | 2818991454 | Bacteria | 5563326 |
| 694 | 2821449019 | 2821443989 | Bacteria | 7658172 |
| 695 | 2843746139 | 2843744320 | Bacteria | 5659202 |
| 696 | 2844538144 | 2844533157 | Bacteria | 7517899 |
| 697 | 2849561608 | 2849560528 | Bacteria | 5393480 |
| 698 | 2849574501 | 2849573788 | Bacteria | 5421256 |
| 699 | 2851153887 | 2851153111 | Bacteria | 5542585 |
| 700 | 2857506118 | 2857504554 | Bacteria | 5369913 |
| 701 | 2884963465 | 2884960567 | Bacteria | 5437054 |
| 702 | 2898330499 | 2898329390 | Bacteria | 5168154 |
| 703 | 2898796747 | 2898795034 | Bacteria | 4294459 |
| 704 | 2928534613 | 2928531327 | Bacteria | 5101314 |
| 705 | 2928973361 | 2928972540 | Bacteria | 3058286 |
| 706 | 2941486065 | 2941485952 | Bacteria | 3591484 |
| 707 | 2977240665 | 2977240413 | Bacteria | 3191065 |
| 708 | Ga0105248_10183715 | |||
| 709 | JGI25151J46595_10001638 | |||
| 710 | JGI25153J46596_10029638 | |||
| 711 | JGI25153J46596_10065678 | |||
| 712 | rootH2_10001948 | |||
| 713 | rootL2_10006616 | |||
| 714 | rootL2_10006617 | |||
| 715 | JGI25160J50197_1021509 | |||
| 716 | Ga0006562J51391_1111710 | |||
| 717 | Ga0006562J51391_1111713 | |||
| 718 | Ga0055536_1004559 | |||
| 719 | Ga0055536_1005300 | |||
| 720 | Ga0055528_1002367 | |||
| 721 | Ga0055530_10006066 | |||
| 722 | Ga0055530_10007826 | |||
| 723 | Ga0055531_10002677 | |||
| 724 | Ga0055531_10003745 | |||
| 725 | Ga0055531_10008281 | |||
| 726 | Ga0055531_10018482 | |||
| 727 | Ga0055531_10023037 | |||
| 728 | Ga0055543_1033105 | |||
| 729 | Ga0065165_1000795 | |||
| 730 | Ga0065165_1070464 | |||
| 731 | Ga0070658_10000691 | |||
| 732 | Ga0070658_10498602 | |||
| 733 | Ga0070683_100329810 | |||
| 734 | Ga0070670_100000007 | |||
| 735 | Ga0070670_100134389 | |||
| 736 | Ga0070670_100140903 | |||
| 737 | Ga0070670_100456351 | |||
| 738 | Ga0068869_100099846 | |||
| 739 | Ga0070680_100001636 | |||
| 740 | Ga0070680_100003915 | |||
| 741 | Ga0070660_100289335 | |||
| 742 | Ga0070668_100000835 | |||
| 743 | Ga0070668_100003294 | |||
| 744 | Ga0070668_100006709 | |||
| 745 | Ga0070668_100022598 | |||
| 746 | Ga0070668_100030789 | |||
| 747 | Ga0070669_100002041 | |||
| 748 | Ga0070669_100796996 | |||
| 749 | Ga0070671_100002143 | |||
| 750 | Ga0070671_100333770 | |||
| 751 | Ga0070673_100203455 | |||
| 752 | Ga0070659_100000209 | |||
| 753 | Ga0070667_100000155 | |||
| 754 | Ga0070667_100012748 | |||
| 755 | Ga0070667_100052116 | |||
| 756 | Ga0070667_100591387 | |||
| 757 | Ga0070714_100294108 | |||
| 758 | Ga0070663_100621157 | |||
| 759 | Ga0070678_100042562 | |||
| 760 | Ga0070662_100219619 | |||
| 761 | Ga0070681_10003919 | |||
| 762 | Ga0070681_10019999 | |||
| 763 | Ga0070679_100000920 | |||
| 764 | Ga0068853_100049207 | |||
| 765 | Ga0068853_100104064 | |||
| 766 | Ga0070665_100000837 | |||
| 767 | Ga0070665_100001961 | |||
| 768 | Ga0070665_100004749 | |||
| 769 | Ga0070665_100350930 | |||
| 770 | Ga0070665_100443676 | |||
| 771 | Ga0068855_100002736 | |||
| 772 | Ga0068855_100068121 | |||
| 773 | Ga0068855_100407262 | |||
| 774 | Ga0070664_100002660 | |||
| 775 | Ga0068854_100164781 | |||
| 776 | Ga0068856_100088014 | |||
| 777 | Ga0068859_100000930 | |||
| 778 | Ga0068859_100013364 | |||
| 779 | Ga0068859_100058614 | |||
| 780 | Ga0068864_100000067 | |||
| 781 | Ga0068864_100000128 | |||
| 782 | Ga0068864_100004938 | |||
| 783 | Ga0068864_100921093 | |||
| 784 | Ga0068863_100000237 | |||
| 785 | Ga0068863_100000360 | |||
| 786 | Ga0068863_100001315 | |||
| 787 | Ga0068863_100028144 | |||
| 788 | Ga0068863_100115230 | |||
| 789 | Ga0068858_100005137 | |||
| 790 | Ga0068858_100064368 | |||
| 791 | Ga0068858_100830981 | |||
| 792 | Ga0068860_100000047 | |||
| 793 | Ga0068860_100000226 | |||
| 794 | Ga0068860_100063847 | |||
| 795 | Ga0068860_100147841 | |||
| 796 | Ga0068860_100720602 | |||
| 797 | Ga0068862_100001031 | |||
| 798 | Ga0068862_100010926 | |||
| 799 | Ga0068862_100024798 | |||
| 800 | Ga0068862_100110357 | |||
| 801 | Ga0081455_10076737 | |||
| 802 | Ga0081455_10099108 | |||
| 803 | Ga0081539_10009430 | |||
| 804 | Ga0075365_10328677 | |||
| 805 | Ga0075363_100150220 | |||
| 806 | Ga0075364_10001761 | |||
| 807 | Ga0075362_10064516 | |||
| 808 | Ga0075367_10000883 | |||
| 809 | Ga0075367_10047761 | |||
| 810 | Ga0075369_10090610 | |||
| 811 | Ga0075370_10005916 | |||
| 812 | Ga0075370_10085789 | |||
| 813 | Ga0075370_10128855 | |||
| 814 | Ga0075370_10268917 | |||
| 815 | Ga0068871_100125155 | |||
| 816 | Ga0068865_100006112 | |||
| 817 | Ga0097620_100000930 | |||
| 818 | Ga0097620_100013364 | |||
| 819 | Ga0097620_100058614 | |||
| 820 | Ga0105240_10006042 | |||
| 821 | Ga0105240_10029450 | |||
| 822 | Ga0105240_10247609 | |||
| 823 | Ga0105240_10457353 | |||
| 824 | Ga0105240_10492270 | |||
| 825 | Ga0105245_10119836 | |||
| 826 | Ga0105245_10264801 | |||
| 827 | Ga0105245_10711432 | |||
| 828 | Ga0105245_11342609 | |||
| 829 | Ga0105247_10226381 | |||
| 830 | Ga0105243_10433963 | |||
| 831 | Ga0105243_10485363 | |||
| 832 | Ga0105243_11275127 | |||
| 833 | Ga0105242_10274349 | |||
| 834 | Ga0105248_10000517 | |||
| 835 | Ga0105248_10003956 | |||
| 836 | Ga0105248_10040989 | |||
| 837 | Ga0105248_10125467 | |||
| 838 | Ga0105248_10366643 | |||
| 839 | Ga0105248_10400924 | |||
| 840 | Ga0105237_10109011 | |||
| 841 | Ga0105237_10760747 | |||
| 842 | Ga0105238_10032406 | |||
| 843 | Ga0105238_10139712 | |||
| 844 | Ga0105238_10173047 | |||
| 845 | Ga0105238_10203161 | |||
| 846 | Ga0105238_10437498 | |||
| 847 | Ga0105249_10001758 | |||
| 848 | Ga0105249_10127470 | |||
| 849 | Ga0105239_10184677 | |||
| 850 | Ga0105239_10324199 | |||
| 851 | Ga0157373_10001725 | |||
| 852 | Ga0157373_10004265 | |||
| 853 | Ga0157370_10017626 | |||
| 854 | Ga0157369_10940894 | |||
| 855 | Ga0157369_11068307 | |||
| 856 | Ga0157372_10403769 | |||
| 857 | Ga0157375_10040775 | |||
| 858 | Ga0163163_10002788 | |||
| 859 | Ga0163163_10021531 | |||
| 860 | Ga0163163_10319343 | |||
| 861 | Ga0163163_10507164 | |||
| 862 | Ga0157380_11383713 | |||
| 863 | Ga0157379_10010392 | |||
| 864 | Ga0157379_10039266 | |||
| 865 | Ga0157379_10069595 | |||
| 866 | Ga0163161_10209264 | |||
| 867 | Ga0213872_10032017 | |||
| 868 | Ga0213874_10033925 | |||
| 869 | Ga0213876_10000081 | |||
| 870 | Ga0213876_10103573 | |||
| 871 | Ga0213876_10146159 | |||
| 872 | Ga0209026_1001197 | |||
| 873 | Ga0209148_1005548 | |||
| 874 | Ga0209565_1000179 | |||
| 875 | Ga0209673_1001719 | |||
| 876 | Ga0209130_1000512 | |||
| 877 | Ga0209675_1028681 | |||
| 878 | Ga0209676_1000253 | |||
| 879 | Ga0209676_1002091 | |||
| 880 | Ga0209025_1000114 | |||
| 881 | Ga0209564_1002926 | |||
| 882 | Ga0209564_1018550 | |||
| 883 | Ga0209758_1000562 | |||
| 884 | Ga0209758_1000894 | |||
| 885 | Ga0209758_1001428 | |||
| 886 | Ga0209758_1002432 | |||
| 887 | Ga0209050_1000173 | |||
| 888 | Ga0209050_1000649 | |||
| 889 | Ga0209050_1001201 | |||
| 890 | Ga0209050_1013251 | |||
| 891 | Ga0209256_1007675 | |||
| 892 | Ga0209256_1015897 | |||
| 893 | Ga0209256_1020239 | |||
| 894 | Ga0207426_1000181 | |||
| 895 | Ga0207426_1007086 | |||
| 896 | Ga0209051_1004510 | |||
| 897 | Ga0209257_1000196 | |||
| 898 | Ga0209257_1000427 | |||
| 899 | Ga0209257_1002800 | |||
| 900 | Ga0209257_1005712 | |||
| 901 | Ga0207680_10061594 | |||
| 902 | Ga0207705_10003988 | |||
| 903 | Ga0207705_10215672 | |||
| 904 | Ga0207705_10372212 | |||
| 905 | Ga0207705_10854544 | |||
| 906 | Ga0207707_10000991 | |||
| 907 | Ga0207695_10000572 | |||
| 908 | Ga0207695_10007614 | |||
| 909 | Ga0207695_10013848 | |||
| 910 | Ga0207695_10014639 | |||
| 911 | Ga0207695_10463694 | |||
| 912 | Ga0207671_10177142 | |||
| 913 | Ga0207660_10005036 | |||
| 914 | Ga0207660_10007574 | |||
| 915 | Ga0207660_10281558 | |||
| 916 | Ga0207657_10136326 | |||
| 917 | Ga0207649_10400556 | |||
| 918 | Ga0207652_10003273 | |||
| 919 | Ga0207681_10003889 | |||
| 920 | Ga0207681_10691844 | |||
| 921 | Ga0207694_10152430 | |||
| 922 | Ga0207694_10678058 | |||
| 923 | Ga0207694_10735518 | |||
| 924 | Ga0207650_10000030 | |||
| 925 | Ga0207650_10094286 | |||
| 926 | Ga0207650_10188888 | |||
| 927 | Ga0207687_10475036 | |||
| 928 | Ga0207687_10669417 | |||
| 929 | Ga0207664_10207052 | |||
| 930 | Ga0207644_10000907 | |||
| 931 | Ga0207644_10157344 | |||
| 932 | Ga0207644_10183025 | |||
| 933 | Ga0207690_10000116 | |||
| 934 | Ga0207706_10117019 | |||
| 935 | Ga0207686_10197441 | |||
| 936 | Ga0207709_10284543 | |||
| 937 | Ga0207711_10000669 | |||
| 938 | Ga0207711_10001710 | |||
| 939 | Ga0207711_10002365 | |||
| 940 | Ga0207711_10035152 | |||
| 941 | Ga0207711_10078303 | |||
| 942 | Ga0207711_10149504 | |||
| 943 | Ga0207689_10054823 | |||
| 944 | Ga0207679_10004250 | |||
| 945 | Ga0207679_10142440 | |||
| 946 | Ga0207667_10003535 | |||
| 947 | Ga0207667_10060083 | |||
| 948 | Ga0207667_10079569 | |||
| 949 | Ga0207667_10095078 | |||
| 950 | Ga0207667_10504864 | |||
| 951 | Ga0207651_10189711 | |||
| 952 | Ga0207712_10000758 | |||
| 953 | Ga0207668_10000010 | |||
| 954 | Ga0207668_10000108 | |||
| 955 | Ga0207668_10002370 | |||
| 956 | Ga0207668_10010421 | |||
| 957 | Ga0207668_10024326 | |||
| 958 | Ga0207640_10345286 | |||
| 959 | Ga0207658_10000265 | |||
| 960 | Ga0207658_10044033 | |||
| 961 | Ga0207658_10072468 | |||
| 962 | Ga0207658_10086970 | |||
| 963 | Ga0207658_10596361 | |||
| 964 | Ga0207677_10130839 | |||
| 965 | Ga0207677_11034575 | |||
| 966 | Ga0207703_10000082 | |||
| 967 | Ga0207703_10014762 | |||
| 968 | Ga0207703_10020945 | |||
| 969 | Ga0207703_10194158 | |||
| 970 | Ga0207703_10434040 | |||
| 971 | Ga0207639_10022198 | |||
| 972 | Ga0207639_10154333 | |||
| 973 | Ga0207639_11089405 | |||
| 974 | Ga0207702_10042818 | |||
| 975 | Ga0207702_10346680 | |||
| 976 | Ga0207641_10000007 | |||
| 977 | Ga0207641_10001651 | |||
| 978 | Ga0207641_10007794 | |||
| 979 | Ga0207641_10166119 | |||
| 980 | Ga0207641_10271717 | |||
| 981 | Ga0207641_10548126 | |||
| 982 | Ga0207676_10000183 | |||
| 983 | Ga0207676_10000241 | |||
| 984 | Ga0207676_10017590 | |||
| 985 | Ga0207676_10357631 | |||
| 986 | Ga0207676_11274646 | |||
| 987 | Ga0207674_10158408 | |||
| 988 | Ga0207675_100107085 | |||
| 989 | Ga0207675_100656774 | |||
| 990 | Ga0207675_100721546 | |||
| 991 | Ga0207683_10015037 | |||
| 992 | Ga0207698_10213695 | |||
| 993 | Ga0207698_11287074 | |||
| 994 | Ga0209281_1013891 | |||
| 995 | Ga0209813_10032610 | |||
| 996 | Ga0268266_10000003 | |||
| 997 | Ga0268266_10000656 | |||
| 998 | Ga0268266_10005366 | |||
| 999 | Ga0268266_10218545 | |||
| 1000 | Ga0268266_10240639 | |||
| 1001 | Ga0268266_10443235 | |||
| 1002 | Ga0268265_10001171 | |||
| 1003 | Ga0268265_10006429 | |||
| 1004 | Ga0268265_10038568 | |||
| 1005 | Ga0268265_10055110 | |||
| 1006 | Ga0268265_10057571 | |||
| 1007 | Ga0268265_10112329 | |||
| 1008 | Ga0268265_10127299 | |||
| 1009 | Ga0268265_10221228 | |||
| 1010 | Ga0268264_10000110 | |||
| 1011 | Ga0268264_10000125 | |||
| 1012 | Ga0268264_10037317 | |||
| 1013 | Ga0268264_10105324 | |||
| 1014 | Ga0268264_10119463 | |||
| 1015 | Ga0268264_10648218 | |||
| 1016 | Ga0268264_10747980 | |||
| 1017 | Ga0265337_1007448 | |||
| 1018 | Ga0265326_10008000 | |||
| 1019 | Ga0307517_10001402 | |||
| 1020 | Ga0307517_10059611 | |||
| 1021 | Ga0307517_10320056 | |||
| 1022 | Ga0307515_10005814 | |||
| 1023 | Ga0307515_10085154 | |||
| 1024 | Ga0265338_10025285 | |||
| 1025 | Ga0265338_10028732 | |||
| 1026 | Ga0265338_10031038 | |||
| 1027 | Ga0265338_10052621 | |||
| 1028 | Ga0265338_10058720 | |||
| 1029 | Ga0265338_10671416 | |||
| 1030 | Ga0265324_10081898 | |||
| 1031 | Ga0265340_10243103 | |||
| 1032 | Ga0265327_10000130 | |||
| 1033 | Ga0265327_10002013 | |||
| 1034 | Ga0265327_10044047 | |||
| 1035 | Ga0265316_10729134 | |||
| 1036 | Ga0307513_10000077 | |||
| 1037 | Ga0307513_10003700 | |||
| 1038 | Ga0307513_10010991 | |||
| 1039 | Ga0307513_10022306 | |||
| 1040 | Ga0307513_10140360 | |||
| 1041 | Ga0307513_10216508 | |||
| 1042 | Ga0307513_10405850 | |||
| 1043 | Ga0307408_100268800 | |||
| 1044 | Ga0265313_10174950 | |||
| 1045 | Ga0265314_10008476 | |||
| 1046 | Ga0265314_10081291 | |||
| 1047 | Ga0265314_10246885 | |||
| 1048 | Ga0265342_10080481 | |||
| 1049 | Ga0307516_10000001 | |||
| 1050 | Ga0307405_10290772 | |||
| 1051 | Ga0307413_10018776 | |||
| 1052 | Ga0307410_10287561 | |||
| 1053 | Ga0307410_10442740 | |||
| 1054 | Ga0307406_10409942 | |||
| 1055 | Ga0307407_10083402 | |||
| 1056 | Ga0307407_10458433 | |||
| 1057 | Ga0307409_100020575 | |||
| 1058 | Ga0307414_10512579 | |||
| 1059 | Ga0307411_10147329 | |||
| 1060 | Ga0307415_100741727 | |||
| 1061 | Ga0307510_10002396 | |||
| 1062 | Ga0307510_10104784 | |||
| 1063 | Ga0373944_0003544 | |||
| 1064 | Ga0373936_0004632 | |||
| 1065 | Ga0373941_0029632 | |||
| 1066 | Ga0373960_0023318 | |||
| 1067 | Ga0373942_0004841 | |||
| 1068 | Ga0373927_0000472 | |||
| 1069 | Ga0373933_0203689 | |||
| 1070 | Ga0373947_0243254 | |||
| 1071 | Ga0373937_0097527 | |||
| 1072 | Ga0373937_0237520 | |||
| 1073 | Ga0373925_0000003 | |||
| 1074 | Ga0373925_0025075 | |||
| 1075 | Ga0395899_0000016 | |||
| 1076 | Ga0395899_0000498 | |||
| 1077 | Ga0395899_0141846 | |||
| 1078 | Ga0395900_0000008 | |||
| 1079 | Ga0395900_0083540 | |||
| 1080 | Ga0395900_0308438 | |||
| 1081 | Ga0395900_0453618 | |||
| 1082 | Ga0395898_0062872 | |||
| 1083 | Ga0395898_0079926 | |||
| 1084 | Ga0395905_0001355 | |||
| 1085 | Ga0395905_0009683 | |||
| 1086 | Ga0395905_0154768 | |||
| 1087 | Ga0395905_0307066 | |||
| 1088 | Ga0395905_0525428 | |||
| 1089 | Ga0436364_0481903 | |||
| 1090 | Ga0436364_0882847 | |||
| 1091 | Ga0395901_0000008 | |||
| 1092 | Ga0395901_0119434 | |||
| 1093 | Ga0395901_0197473 | |||
| 1094 | Ga0395901_0205575 | |||
| 1095 | Ga0395901_0288213 | |||
| 1096 | Ga0436365_0187494 | |||
| 1097 | Ga0436365_0368117 | |||
| 1098 | Ga0436365_0884483 | |||
| 1099 | Ga0436365_1923138 | |||
| 1100 | Ga0436360_0945988 | |||
| 1101 | Ga0436360_1148462 | |||
| 1102 | Ga0436360_1296374 | |||
| 1103 | Ga0436361_0104010 | |||
| 1104 | Ga0436361_0564979 | |||
| 1105 | Ga0436361_0741749 | |||
| 1106 | Ga0436361_1172229 | |||
| 1107 | Ga0436363_1475916 | |||
| 1108 | Ga0439438_102225 | |||
| 1109 | Ga0439431_0076912 | |||
| 1110 | Ga0439446_0086344 | |||
| 1111 | Ga0439435_0014860 | |||
| 1112 | Ga0450901_002375 | |||
| 1113 | Ga0466966_0144037 | |||
| 1114 | Ga0466966_0241279 | |||
| 1115 | Ga0466968_0099559 | |||
| 1116 | Ga0466960_0047359 | |||
| 1117 | Ga0495617_053556 | |||
| 1118 | Ga0495627_004929 | |||
| 1119 | Ga0495590_0022517 | |||
| 1120 | Ga0495629_0019869 | |||
| 1121 | Ga0495638_0000530 | |||
| 1122 | Ga0495638_0001235 | |||
| 1123 | Ga0495638_0005396 | |||
| 1124 | Ga0495638_0008848 | |||
| 1125 | Ga0495638_0009539 | |||
| 1126 | Ga0495638_0266893 | |||
| 1127 | Ga0495653_0541692 | |||
| 1128 | Ga0495650_0000024 | |||
| 1129 | Ga0495650_0061598 | |||
| 1130 | Ga0495650_0077380 | |||
| 1131 | Ga0495583_0000003 | |||
| 1132 | Ga0495583_0028948 | |||
| 1133 | Ga0495583_0063093 | |||
| 1134 | Ga0495583_0195837 | |||
| 1135 | Ga0495606_0038419 | |||
| 1136 | Ga0495606_0083232 | |||
| 1137 | Ga0495610_0000478 | |||
| 1138 | Ga0495610_0000679 | |||
| 1139 | Ga0495610_0007161 | |||
| 1140 | Ga0495616_0000099 | |||
| 1141 | Ga0495616_0028726 | |||
| 1142 | Ga0495620_0027085 | |||
| 1143 | Ga0495630_0318924 | |||
| 1144 | Ga0495631_0007265 | |||
| 1145 | Ga0495632_0005209 | |||
| 1146 | Ga0495637_0003545 | |||
| 1147 | Ga0495637_0073993 | |||
| 1148 | Ga0495643_0006929 | |||
| 1149 | Ga0495648_0000634 | |||
| 1150 | Ga0495648_0157746 | |||
| 1151 | Ga0495642_0219450 | |||
| 1152 | Ga0495652_0058471 | |||
| 1153 | Ga0495654_0000135 | |||
| 1154 | Ga0495654_0146032 | |||
| 1155 | Ga0495654_0180499 | |||
| 1156 | Ga0495609_0060216 | |||
| 1157 | Ga0495621_0179988 | |||
| 1158 | Ga0495597_0207097 | |||
| 1159 | Ga0495645_0057116 | |||
| 1160 | Ga0495622_0000762 | |||
| 1161 | Ga0495633_0000423 | |||
| 1162 | Ga0495633_0117414 | |||
| 1163 | Ga0495668_0000291 | |||
| 1164 | Ga0495668_0005259 | |||
| 1165 | Ga0495668_0019454 | |||
| 1166 | Ga0495668_0021477 | |||
| 1167 | Ga0495668_0039891 | |||
| 1168 | Ga0495668_0093250 | |||
| 1169 | Ga0495668_0115627 | |||
| 1170 | Ga0495625_0001134 | |||
| 1171 | Ga0495625_0003614 | |||
| 1172 | Ga0495625_0010213 | |||
| 1173 | Ga0495625_0031018 | |||
| 1174 | Ga0495625_0040043 | |||
| 1175 | Ga0495625_0070340 | |||
| 1176 | Ga0495625_0191523 | |||
| 1177 | Ga0495588_0266618 | |||
| 1178 | Ga0495669_0000044 | |||
| 1179 | Ga0495669_0000152 | |||
| 1180 | Ga0495669_0026139 | |||
| 1181 | Ga0495669_0055181 | |||
| 1182 | Ga0495669_0137431 | |||
| 1183 | Ga0495613_0004090 | |||
| 1184 | Ga0495613_0253042 | |||
| 1185 | Ga0495624_0258863 | |||
| 1186 | Ga0495671_0146783 | |||
| 1187 | Ga0495671_0147930 | |||
| 1188 | Ga0495671_0290240 | |||
| 1189 | Ga0495649_0000262 | |||
| 1190 | Ga0495589_0028088 | |||
| 1191 | Ga0495660_0059882 | |||
| 1192 | Ga0495672_0000784 | |||
| 1193 | Ga0495672_0004858 | |||
| 1194 | Ga0495672_0028037 | |||
| 1195 | Ga0495683_0117628 | |||
| 1196 | Ga0495687_044573 | |||
| 1197 | Ga0495677_0146016 | |||
| 1198 | Ga0495677_0207543 | |||
| 1199 | Ga0495679_003275 | |||
| 1200 | Ga0495673_0000340 | |||
| 1201 | Ga0495673_0001300 | |||
| 1202 | Ga0495673_0003929 | |||
| 1203 | Ga0495673_0218700 | |||
| 1204 | Ga0495681_0017489 | |||
| 1205 | Ga0495681_0031241 | |||
| 1206 | Ga0495686_0001205 | |||
| 1207 | Ga0495686_0004549 | |||
| 1208 | Ga0495686_0022417 | |||
| 1209 | Ga0495686_0035200 | |||
| 1210 | Ga0495686_0037968 | |||
| 1211 | Ga0495686_0043703 | |||
| 1212 | Ga0495593_0071401 | |||
| 1213 | Ga0496101_0009511 | |||
| 1214 | Ga0496101_0059471 | |||
| 1215 | Ga0496102_0011792 | |||
| 1216 | Ga0496106_0004442 | |||
| 1217 | Ga0496106_0529481 | |||
| 1218 | Ga0496106_0553305 | |||
| 1219 | Ga0496107_0000987 | |||
| 1220 | Ga0496107_0104495 | |||
| 1221 | Ga0496108_0054241 | |||
| 1222 | Ga0496112_0227562 | |||
| 1223 | Ga0496115_0000126 | |||
| 1224 | Ga0496115_0003595 | |||
| 1225 | Ga0496115_0013222 | |||
| 1226 | Ga0496115_0039144 | |||
| 1227 | Ga0496115_0050885 | |||
| 1228 | Ga0496115_0191913 | |||
| 1229 | Ga0496115_0679669 | |||
| 1230 | Ga0496116_0212130 | |||
| 1231 | Ga0496117_0116167 | |||
| 1232 | Ga0496118_0031844 | |||
| 1233 | Ga0496119_0059930 | |||
| 1234 | Ga0496121_0000035 | |||
| 1235 | Ga0496121_0007098 | |||
| 1236 | Ga0496121_0139465 | |||
| 1237 | Ga0496121_0354203 | |||
| 1238 | Ga0496121_0475548 | |||
| 1239 | Ga0496122_0002454 | |||
| 1240 | Ga0496123_0004303 | |||
| 1241 | Ga0496124_0145643 | |||
| 1242 | Ga0496124_0389121 | |||
| 1243 | Ga0496124_0518894 | |||
| 1244 | Ga0496125_0047317 | |||
| 1245 | Ga0496125_0078633 | |||
| 1246 | Ga0496126_0167919 | |||
| 1247 | Ga0495678_000699 | |||
| 1248 | Ga0501033_0005322 | |||
| 1249 | Ga0501033_0076362 | |||
| 1250 | Ga0501033_0231933 | |||
| 1251 | Ga0501034_0013241 | |||
| 1252 | Ga0501034_0086368 | |||
| 1253 | Ga0501034_0088709 | |||
| 1254 | Ga0501034_0222240 | |||
| 1255 | Ga0501036_0013734 | |||
| 1256 | Ga0501037_0078237 | |||
| 1257 | Ga0501037_0147796 | |||
| 1258 | Ga0501038_0078567 | |||
| 1259 | Ga0501043_0593111 | |||
| 1260 | Ga0501046_0007634 | |||
| 1261 | Ga0501047_0020536 | |||
| 1262 | Ga0501047_0232637 | |||
| 1263 | Ga0501048_0133585 | |||
| 1264 | Ga0501048_0331697 | |||
| 1265 | Ga0501067_0083838 | |||
| 1266 | Ga0501067_0199285 | |||
| 1267 | Ga0501068_0110266 | |||
| 1268 | Ga0501069_0089060 | |||
| 1269 | Ga0501070_0038246 | |||
| 1270 | Ga0501071_0205616 | |||
| 1271 | Ga0501072_0020753 | |||
| 1272 | Ga0501072_0430716 | |||
| 1273 | Ga0501073_0007955 | |||
| 1274 | Ga0501074_0013123 | |||
| 1275 | Ga0501076_0282774 | |||
| 1276 | Ga0501238_002038 | |||
| 1277 | Ga0501238_015871 | |||
| 1278 | Ga0501257_078181 | |||
| 1279 | Ga0501079_0223183 | |||
| 1280 | Ga0501080_0003547 | |||
| 1281 | Ga0501083_0047271 | |||
| 1282 | Ga0501083_0061207 | |||
| 1283 | Ga0501083_0124013 | |||
| 1284 | Ga0501083_0150451 | |||
| 1285 | Ga0501083_0338908 | |||
| 1286 | Ga0501035_0032673 | |||
| 1287 | Ga0501035_0144201 | |||
| 1288 | Ga0501035_0641058 | |||
| 1289 | Ga0501044_0003542 | |||
| 1290 | Ga0501044_0005817 | |||
| 1291 | Ga0501044_0152496 | |||
| 1292 | Ga0501044_0182925 | |||
| 1293 | Ga0501044_1044678 | |||
| 1294 | nmdc:mga03683_37218_c1 | |||
| 1295 | nmdc:mga00v17_13387_c1 | |||
| 1296 | nmdc:mga0yw44_57632_c1 | |||
| 1297 | nmdc:mga0k408_197815_c1 | |||
| 1298 | nmdc:mga06z11_10651_c1 | |||
| 1299 | nmdc:mga06z11_6144_c1 | |||
| 1300 | nmdc:mga04h51_36997_c1 | |||
| 1301 | nmdc:mga07m45_182729_c1 | |||
| 1302 | nmdc:mga07m45_2301_c1 | |||
| 1303 | nmdc:mga07m45_281749_c1 | |||
| 1304 | nmdc:mga07m45_76195_c1 | |||
| 1305 | nmdc:mga0sz30_136302_c1 | |||
| 1306 | Ga0500635_0000133 | |||
| 1307 | Ga0500578_0000159 | |||
| 1308 | Ga0500643_002501 | |||
| 1309 | Ga0500643_005142 | |||
| 1310 | Ga0500643_033645 | |||
| 1311 | Ga0500644_0000269 | |||
| 1312 | Ga0500646_0076038 | |||
| 1313 | Ga0500647_0022880 | |||
| 1314 | Ga0500583_0248562 | |||
| 1315 | Ga0500651_0095259 | |||
| 1316 | Ga0500566_0032049 | |||
| 1317 | Ga0500641_0000896 | |||
| 1318 | Ga0500641_0004136 | |||
| 1319 | Ga0500641_0013309 | |||
| 1320 | Ga0500641_0045274 | |||
| 1321 | Ga0500650_0021086 | |||
| 1322 | Ga0500554_001916 | |||
| 1323 | Ga0500555_001064 | |||
| 1324 | Ga0500556_0001862 | |||
| 1325 | Ga0500556_0006820 | |||
| 1326 | Ga0500562_000588 | |||
| 1327 | Ga0500562_001014 | |||
| 1328 | Ga0500562_024537 | |||
| 1329 | Ga0500562_032147 | |||
| 1330 | Ga0500572_002558 | |||
| 1331 | Ga0500594_0000226 | |||
| 1332 | Ga0500595_015445 | |||
| 1333 | Ga0500595_045767 | |||
| 1334 | Ga0500597_283832 | |||
| 1335 | Ga0500607_035997 | |||
| 1336 | Ga0500608_001098 | |||
| 1337 | Ga0500608_082009 | |||
| 1338 | Ga0500614_010503 | |||
| 1339 | Ga0500614_046227 | |||
| 1340 | Ga0500618_000642 | |||
| 1341 | Ga0500655_064552 | |||
| 1342 | Ga0500655_086654 | |||
| 1343 | Ga0500658_0005773 | |||
| 1344 | Ga0500559_0000224 | |||
| 1345 | Ga0500559_0000334 | |||
| 1346 | Ga0500559_0023182 | |||
| 1347 | Ga0500559_0029080 | |||
| 1348 | Ga0500559_0107809 | |||
| 1349 | Ga0500564_001489 | |||
| 1350 | Ga0500564_170143 | |||
| 1351 | Ga0500568_0117014 | |||
| 1352 | Ga0500573_0165997 | |||
| 1353 | Ga0500577_0000945 | |||
| 1354 | Ga0500590_006941 | |||
| 1355 | Ga0500590_063460 | |||
| 1356 | Ga0500603_004616 | |||
| 1357 | Ga0500616_0001137 | |||
| 1358 | Ga0500616_0003555 | |||
| 1359 | Ga0500616_0141782 | |||
| 1360 | Ga0500619_024565 | |||
| 1361 | Ga0500622_0002499 | |||
| 1362 | Ga0500622_0090082 | |||
| 1363 | Ga0500622_0092732 | |||
| 1364 | Ga0500622_0160018 | |||
| 1365 | Ga0500627_0018747 | |||
| 1366 | Ga0500639_210764 | |||
| 1367 | Ga0500636_0018937 | |||
| 1368 | Ga0500625_013605 | |||
| 1369 | Ga0500645_002410 | |||
| 1370 | Ga0500645_002629 | |||
| 1371 | Ga0500645_006703 | |||
| 1372 | Ga0500645_012605 | |||
| 1373 | Ga0500609_001140 | |||
| 1374 | Ga0500596_000673 | |||
| 1375 | Ga0501084_0065375 | |||
| 1376 | Ga0501084_0115580 | |||
| 1377 | Ga0501082_0014678 | |||
| 1378 | Ga0501082_0041845 | |||
| 1379 | Ga0501082_0257091 | |||
| 1380 | 2511122576 | |||
| 1381 | 2585148166 | |||
| 1382 | 2585155187 | |||
| 1383 | 2585194868 | |||
| 1384 | 2587917071 | |||
| 1385 | 2643747335 | |||
| 1386 | 2643779933 | |||
| 1387 | 2643922717 | |||
| 1388 | 2643929880 | |||
| 1389 | 2644001551 | |||
| 1390 | 2644088038 | |||
| 1391 | 2644223724 | |||
| 1392 | 2644236188 | |||
| 1393 | 2644344075 | |||
| 1394 | 2644367395 | |||
| 1395 | 2644507468 | |||
| 1396 | 2644549910 | |||
| 1397 | 2644551725 | |||
| 1398 | 2792461680 | |||
| 1399 | 2819538518 | |||
| 1400 | 2819648037 | |||
| 1401 | 2821449019 | |||
| 1402 | 2843746139 | |||
| 1403 | 2844538144 | |||
| 1404 | 2849561608 | |||
| 1405 | 2849574501 | |||
| 1406 | 2851153887 | |||
| 1407 | 2857506118 | |||
| 1408 | 2884963465 | |||
| 1409 | 2898330499 | |||
| 1410 | 2898796747 | |||
| 1411 | 2928534613 | |||
| 1412 | 2928973361 | |||
| 1413 | 2941486065 | |||
| 1414 | 2977240665 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9317 | 69 | 159 |
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9123 | 69 | 159 |
| 1t6t-assembly1.cif.gz_1 | putative protein from aquifex aeolicus | 0.8381 | 66 | 155 |
| 3ve5-assembly1.cif.gz_A | structure of recombination mediator protein recr16-196 deletion mutant | 0.8305 | 16 | 186 |
| 1dxe-assembly1.cif.gz_A | 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli | 0.8151 | 112 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9659 | 65 | 186 | 3.40.1360.10 |
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9582 | 65 | 186 | 3.40.1360.10 |
| af_P0A7H6_77_171_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9487 | 68 | 158 | 3.40.1360.10 |
| 1vddC03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9372 | 65 | 158 | 3.40.1360.10 |
| 1vddC03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9276 | 65 | 158 | 3.40.1360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A268RH89-F1-model_v4 | Recombination protein RecR | 0.9596 | 61 | 161 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A268RH89-F1-model_v4 | Recombination protein RecR | 0.9241 | 61 | 161 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A6P1B0M1-F1-model_v4 | deleted | 0.9116 | 55 | 140 |
|
| AF-A0A3B9BGG3-F1-model_v4 | Recombination protein RecR | 0.9091 | 50 | 143 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-W0GPM3-F1-model_v4 | Toprim domain-containing protein | 0.9009 | 52 | 146 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |