F476544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 707 | 260 | 707 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10102496|Ga0157372_101024962 |
| Length | 387 |
| Sequence | MATDLAALRDGTRAPLVREVAHTVSPGLWTLAWRRLRADGVGMVSLVIVVAFIVMMILSATGLIAADWNREVGVNYAPPTFLGVEAPAAAQAEAKMAEGSGPTPATHYESKIVDPIGDVIAALRAGKAAQGEALAAVMADIRAGKGVGAEVKPQERKATLPFGGDKWGRDVLKKTIKGSETSIFVGLASAALATFLGTVFGAVAGYFGKWVDDAFNWFYSVFSSIPYLLLILAVAAVLQQKGTLTIILILGLTGWTGVFRLMRAEYLKHKSREYVQAADAIGASNARRMFMHIFPNVSHVVLVQLSILVVAFIKSEVILSFLGFGVPVDVVSWGSMLNEAQNELILGKWWQLVAAGTAMALLVTAFSLFTDALRDALDPKLKGRLGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 3.68 |
| Rhizosphere | 96.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10001094 | 3300001991 | Bacteria | 3613 |
| 2 | Ga0065712_10071001 | 3300005290 | Bacteria | 5547 |
| 3 | Ga0070658_10007612 | 3300005327 | Bacteria | 8735 |
| 4 | Ga0070658_10050650 | 3300005327 | Bacteria | 3366 |
| 5 | Ga0070658_10103060 | 3300005327 | Bacteria | 2360 |
| 6 | Ga0070658_10113961 | 3300005327 | Bacteria | 2242 |
| 7 | Ga0070658_10189575 | 3300005327 | Bacteria | 1733 |
| 8 | Ga0070676_10000977 | 3300005328 | Bacteria | 14208 |
| 9 | Ga0070676_10003806 | 3300005328 | Bacteria | 7916 |
| 10 | Ga0070676_10004000 | 3300005328 | Bacteria | 7735 |
| 11 | Ga0070676_10037330 | 3300005328 | Bacteria | 2802 |
| 12 | Ga0070683_100001922 | 3300005329 | Bacteria | 16259 |
| 13 | Ga0070690_100022040 | 3300005330 | Bacteria | 3895 |
| 14 | Ga0070690_100044584 | 3300005330 | Bacteria | 2815 |
| 15 | Ga0070670_100000710 | 3300005331 | Bacteria | 25832 |
| 16 | Ga0070670_100004701 | 3300005331 | Bacteria | 11460 |
| 17 | Ga0070670_100041841 | 3300005331 | Bacteria | 3938 |
| 18 | Ga0070670_100043266 | 3300005331 | Bacteria | 3872 |
| 19 | Ga0070670_100097972 | 3300005331 | Bacteria | 2523 |
| 20 | Ga0070677_10000299 | 3300005333 | Bacteria | 17436 |
| 21 | Ga0070677_10000465 | 3300005333 | Bacteria | 13899 |
| 22 | Ga0070677_10002248 | 3300005333 | Bacteria | 6159 |
| 23 | Ga0068869_100002962 | 3300005334 | Bacteria | 10311 |
| 24 | Ga0068869_100010531 | 3300005334 | Bacteria | 6034 |
| 25 | Ga0068869_100021406 | 3300005334 | Bacteria | 4448 |
| 26 | Ga0068869_100030564 | 3300005334 | Bacteria | 3782 |
| 27 | Ga0068869_100105795 | 3300005334 | Bacteria | 2134 |
| 28 | Ga0068869_100136116 | 3300005334 | Bacteria | 1893 |
| 29 | Ga0070666_10000561 | 3300005335 | Bacteria | 22469 |
| 30 | Ga0070666_10002728 | 3300005335 | Bacteria | 10670 |
| 31 | Ga0070666_10006815 | 3300005335 | Bacteria | 7039 |
| 32 | Ga0070666_10010489 | 3300005335 | Bacteria | 5797 |
| 33 | Ga0070666_10064548 | 3300005335 | Bacteria | 2483 |
| 34 | Ga0070680_100036398 | 3300005336 | Bacteria | 3976 |
| 35 | Ga0070680_100094648 | 3300005336 | Bacteria | 2476 |
| 36 | Ga0068868_100000336 | 3300005338 | Bacteria | 31703 |
| 37 | Ga0068868_100005127 | 3300005338 | Bacteria | 9201 |
| 38 | Ga0068868_100005492 | 3300005338 | Bacteria | 8916 |
| 39 | Ga0068868_100017422 | 3300005338 | Bacteria | 5353 |
| 40 | Ga0070660_100000928 | 3300005339 | Bacteria | 19545 |
| 41 | Ga0070660_100048288 | 3300005339 | Bacteria | 3269 |
| 42 | Ga0070660_100065441 | 3300005339 | Bacteria | 2829 |
| 43 | Ga0070689_100048443 | 3300005340 | Bacteria | 3277 |
| 44 | Ga0070689_100138055 | 3300005340 | Bacteria | 1959 |
| 45 | Ga0070689_100151732 | 3300005340 | Bacteria | 1869 |
| 46 | Ga0070689_100282612 | 3300005340 | Bacteria | 1377 |
| 47 | Ga0070687_100015593 | 3300005343 | Bacteria | 3441 |
| 48 | Ga0070661_100000654 | 3300005344 | Bacteria | 25469 |
| 49 | Ga0070661_100001915 | 3300005344 | Bacteria | 14406 |
| 50 | Ga0070661_100004134 | 3300005344 | Bacteria | 10007 |
| 51 | Ga0070661_100010870 | 3300005344 | Bacteria | 6340 |
| 52 | Ga0070661_100024446 | 3300005344 | Bacteria | 4333 |
| 53 | Ga0070692_10123067 | 3300005345 | Bacteria | 1449 |
| 54 | Ga0070692_10189011 | 3300005345 | Bacteria | 1198 |
| 55 | Ga0070668_100001025 | 3300005347 | Bacteria | 19580 |
| 56 | Ga0070668_100007181 | 3300005347 | Bacteria | 8260 |
| 57 | Ga0070668_100033495 | 3300005347 | Bacteria | 3912 |
| 58 | Ga0070668_100148703 | 3300005347 | Bacteria | 1892 |
| 59 | Ga0070669_100007724 | 3300005353 | Bacteria | 7687 |
| 60 | Ga0070669_100157836 | 3300005353 | Bacteria | 1760 |
| 61 | Ga0070675_100000564 | 3300005354 | Bacteria | 25558 |
| 62 | Ga0070675_100007361 | 3300005354 | Bacteria | 8501 |
| 63 | Ga0070675_100011829 | 3300005354 | Bacteria | 6838 |
| 64 | Ga0070671_100002136 | 3300005355 | Bacteria | 15253 |
| 65 | Ga0070671_100003077 | 3300005355 | Bacteria | 12974 |
| 66 | Ga0070671_100005765 | 3300005355 | Bacteria | 9866 |
| 67 | Ga0070671_100010477 | 3300005355 | Bacteria | 7439 |
| 68 | Ga0070671_100011336 | 3300005355 | Bacteria | 7165 |
| 69 | Ga0070671_100032404 | 3300005355 | Bacteria | 4321 |
| 70 | Ga0070671_100094437 | 3300005355 | Bacteria | 2507 |
| 71 | Ga0070671_100127855 | 3300005355 | Bacteria | 2139 |
| 72 | Ga0070674_100000659 | 3300005356 | Bacteria | 17432 |
| 73 | Ga0070674_100034653 | 3300005356 | Bacteria | 3373 |
| 74 | Ga0070674_100051026 | 3300005356 | Bacteria | 2849 |
| 75 | Ga0070674_100106213 | 3300005356 | Bacteria | 2054 |
| 76 | Ga0070673_100000093 | 3300005364 | Bacteria | 39643 |
| 77 | Ga0070673_100000471 | 3300005364 | Bacteria | 21412 |
| 78 | Ga0070673_100011176 | 3300005364 | Bacteria | 6122 |
| 79 | Ga0070673_100011276 | 3300005364 | Bacteria | 6095 |
| 80 | Ga0070673_100014836 | 3300005364 | Bacteria | 5449 |
| 81 | Ga0070688_100000489 | 3300005365 | Bacteria | 20048 |
| 82 | Ga0070688_100004308 | 3300005365 | Bacteria | 7403 |
| 83 | Ga0070688_100120809 | 3300005365 | Bacteria | 1755 |
| 84 | Ga0070659_100006152 | 3300005366 | Bacteria | 8664 |
| 85 | Ga0070659_100055875 | 3300005366 | Bacteria | 3112 |
| 86 | Ga0070667_100002945 | 3300005367 | Bacteria | 14630 |
| 87 | Ga0070667_100004079 | 3300005367 | Bacteria | 12355 |
| 88 | Ga0070667_100009474 | 3300005367 | Bacteria | 8078 |
| 89 | Ga0070667_100081625 | 3300005367 | Bacteria | 2767 |
| 90 | Ga0070667_100136411 | 3300005367 | Bacteria | 2145 |
| 91 | Ga0070714_100014686 | 3300005435 | Bacteria | 6293 |
| 92 | Ga0070713_100000090 | 3300005436 | Bacteria | 57703 |
| 93 | Ga0070710_10016487 | 3300005437 | Bacteria | 3761 |
| 94 | Ga0070711_100001719 | 3300005439 | Bacteria | 12147 |
| 95 | Ga0070705_100013431 | 3300005440 | Bacteria | 4190 |
| 96 | Ga0070705_100048850 | 3300005440 | Bacteria | 2454 |
| 97 | Ga0070700_100071681 | 3300005441 | Bacteria | 2213 |
| 98 | Ga0070694_100131362 | 3300005444 | Bacteria | 1809 |
| 99 | Ga0070694_100132031 | 3300005444 | Bacteria | 1805 |
| 100 | Ga0070708_100008392 | 3300005445 | Bacteria | 8293 |
| 101 | Ga0070663_100004712 | 3300005455 | Bacteria | 8044 |
| 102 | Ga0070663_100020273 | 3300005455 | Bacteria | 4399 |
| 103 | Ga0070663_100137298 | 3300005455 | Bacteria | 1863 |
| 104 | Ga0070678_100000836 | 3300005456 | Bacteria | 15615 |
| 105 | Ga0070678_100002367 | 3300005456 | Bacteria | 10304 |
| 106 | Ga0070678_100014194 | 3300005456 | Bacteria | 5018 |
| 107 | Ga0070678_100018213 | 3300005456 | Bacteria | 4548 |
| 108 | Ga0070662_100000211 | 3300005457 | Bacteria | 34047 |
| 109 | Ga0070662_100038681 | 3300005457 | Bacteria | 3389 |
| 110 | Ga0070681_10001301 | 3300005458 | Bacteria | 21770 |
| 111 | Ga0070681_10012004 | 3300005458 | Bacteria | 8588 |
| 112 | Ga0070681_10120183 | 3300005458 | Bacteria | 2563 |
| 113 | Ga0070681_10212027 | 3300005458 | Bacteria | 1853 |
| 114 | Ga0068867_100003879 | 3300005459 | Bacteria | 10523 |
| 115 | Ga0068867_100004748 | 3300005459 | Bacteria | 9565 |
| 116 | Ga0068867_100006608 | 3300005459 | Bacteria | 8199 |
| 117 | Ga0068867_100011329 | 3300005459 | Bacteria | 6292 |
| 118 | Ga0070685_10005415 | 3300005466 | Bacteria | 6464 |
| 119 | Ga0070685_10014295 | 3300005466 | Bacteria | 4201 |
| 120 | Ga0070706_100006279 | 3300005467 | Bacteria | 11241 |
| 121 | Ga0070698_100013247 | 3300005471 | Bacteria | 8725 |
| 122 | Ga0070698_100099088 | 3300005471 | Bacteria | 2888 |
| 123 | Ga0070699_100248580 | 3300005518 | Bacteria | 1589 |
| 124 | Ga0070679_100021405 | 3300005530 | Bacteria | 6312 |
| 125 | Ga0070679_100060269 | 3300005530 | Bacteria | 3782 |
| 126 | Ga0070684_100000644 | 3300005535 | Bacteria | 24028 |
| 127 | Ga0070684_100037355 | 3300005535 | Bacteria | 4166 |
| 128 | Ga0070684_100341377 | 3300005535 | Bacteria | 1377 |
| 129 | Ga0068853_100006389 | 3300005539 | Bacteria | 9361 |
| 130 | Ga0068853_100021430 | 3300005539 | Bacteria | 5389 |
| 131 | Ga0068853_100024169 | 3300005539 | Bacteria | 5093 |
| 132 | Ga0068853_100051635 | 3300005539 | Bacteria | 3539 |
| 133 | Ga0068853_100084918 | 3300005539 | Bacteria | 2774 |
| 134 | Ga0070672_100006613 | 3300005543 | Bacteria | 7806 |
| 135 | Ga0070672_100024926 | 3300005543 | Bacteria | 4428 |
| 136 | Ga0070672_100150503 | 3300005543 | Bacteria | 1925 |
| 137 | Ga0070686_100006716 | 3300005544 | Bacteria | 6404 |
| 138 | Ga0070696_100048476 | 3300005546 | Bacteria | 2949 |
| 139 | Ga0070696_100157581 | 3300005546 | Bacteria | 1671 |
| 140 | Ga0070665_100001592 | 3300005548 | Bacteria | 26145 |
| 141 | Ga0070665_100007579 | 3300005548 | Bacteria | 11036 |
| 142 | Ga0070665_100019006 | 3300005548 | Bacteria | 6892 |
| 143 | Ga0070665_100029957 | 3300005548 | Bacteria | 5477 |
| 144 | Ga0068855_100006495 | 3300005563 | Bacteria | 14217 |
| 145 | Ga0068855_100019498 | 3300005563 | Bacteria | 8150 |
| 146 | Ga0068855_100038671 | 3300005563 | Bacteria | 5668 |
| 147 | Ga0068855_100048112 | 3300005563 | Bacteria | 5035 |
| 148 | Ga0068855_100048585 | 3300005563 | Bacteria | 5007 |
| 149 | Ga0068855_100144798 | 3300005563 | Bacteria | 2706 |
| 150 | Ga0068855_100243410 | 3300005563 | Bacteria | 2009 |
| 151 | Ga0070664_100000511 | 3300005564 | Bacteria | 29475 |
| 152 | Ga0070664_100000805 | 3300005564 | Bacteria | 24106 |
| 153 | Ga0070664_100054705 | 3300005564 | Bacteria | 3387 |
| 154 | Ga0070664_100073844 | 3300005564 | Bacteria | 2927 |
| 155 | Ga0068857_100006967 | 3300005577 | Bacteria | 9727 |
| 156 | Ga0068857_100089144 | 3300005577 | Bacteria | 2760 |
| 157 | Ga0068857_100146202 | 3300005577 | Bacteria | 2139 |
| 158 | Ga0068857_100255390 | 3300005577 | Bacteria | 1607 |
| 159 | Ga0068857_100357482 | 3300005577 | Bacteria | 1353 |
| 160 | Ga0068854_100012235 | 3300005578 | Bacteria | 5616 |
| 161 | Ga0068854_100149648 | 3300005578 | Bacteria | 1799 |
| 162 | Ga0068856_100002324 | 3300005614 | Bacteria | 19584 |
| 163 | Ga0068856_100026012 | 3300005614 | Bacteria | 5707 |
| 164 | Ga0068856_100033808 | 3300005614 | Bacteria | 5007 |
| 165 | Ga0068856_100080716 | 3300005614 | Bacteria | 3226 |
| 166 | Ga0068856_100105783 | 3300005614 | Bacteria | 2808 |
| 167 | Ga0068856_100257735 | 3300005614 | Bacteria | 1759 |
| 168 | Ga0068856_100297650 | 3300005614 | Bacteria | 1631 |
| 169 | Ga0070702_100003661 | 3300005615 | Bacteria | 6919 |
| 170 | Ga0068852_100000411 | 3300005616 | Bacteria | 28617 |
| 171 | Ga0068852_100001437 | 3300005616 | Bacteria | 16064 |
| 172 | Ga0068852_100001928 | 3300005616 | Bacteria | 14140 |
| 173 | Ga0068852_100010177 | 3300005616 | Bacteria | 7008 |
| 174 | Ga0068852_100207325 | 3300005616 | Bacteria | 1858 |
| 175 | Ga0068859_100002390 | 3300005617 | Bacteria | 19102 |
| 176 | Ga0068859_100004790 | 3300005617 | Bacteria | 13767 |
| 177 | Ga0068859_100023342 | 3300005617 | Bacteria | 6209 |
| 178 | Ga0068859_100073193 | 3300005617 | Bacteria | 3464 |
| 179 | Ga0068864_100001045 | 3300005618 | Bacteria | 23232 |
| 180 | Ga0068864_100005508 | 3300005618 | Bacteria | 10374 |
| 181 | Ga0068864_100015587 | 3300005618 | Bacteria | 6321 |
| 182 | Ga0068864_100059725 | 3300005618 | Bacteria | 3299 |
| 183 | Ga0068864_100074624 | 3300005618 | Bacteria | 2959 |
| 184 | Ga0068864_100112518 | 3300005618 | Bacteria | 2426 |
| 185 | Ga0068864_100218800 | 3300005618 | Bacteria | 1756 |
| 186 | Ga0068866_10003584 | 3300005718 | Bacteria | 6357 |
| 187 | Ga0068866_10015918 | 3300005718 | Bacteria | 3351 |
| 188 | Ga0068866_10100012 | 3300005718 | Bacteria | 1598 |
| 189 | Ga0068861_100000716 | 3300005719 | Bacteria | 19819 |
| 190 | Ga0068861_100007083 | 3300005719 | Bacteria | 7672 |
| 191 | Ga0068861_100045641 | 3300005719 | Bacteria | 3301 |
| 192 | Ga0068861_100146329 | 3300005719 | Bacteria | 1934 |
| 193 | Ga0068851_10000721 | 3300005834 | Bacteria | 14117 |
| 194 | Ga0068851_10003672 | 3300005834 | Bacteria | 6849 |
| 195 | Ga0068851_10008426 | 3300005834 | Bacteria | 4765 |
| 196 | Ga0068870_10003956 | 3300005840 | Bacteria | 6329 |
| 197 | Ga0068870_10036992 | 3300005840 | Bacteria | 2514 |
| 198 | Ga0068870_10053644 | 3300005840 | Bacteria | 2142 |
| 199 | Ga0068870_10116918 | 3300005840 | Bacteria | 1530 |
| 200 | Ga0068870_10142086 | 3300005840 | Bacteria | 1406 |
| 201 | Ga0068863_100001612 | 3300005841 | Bacteria | 22307 |
| 202 | Ga0068863_100003250 | 3300005841 | Bacteria | 16067 |
| 203 | Ga0068863_100005268 | 3300005841 | Bacteria | 12764 |
| 204 | Ga0068863_100015142 | 3300005841 | Bacteria | 7408 |
| 205 | Ga0068863_100020933 | 3300005841 | Bacteria | 6247 |
| 206 | Ga0068863_100050231 | 3300005841 | Bacteria | 3954 |
| 207 | Ga0068863_100131623 | 3300005841 | Bacteria | 2388 |
| 208 | Ga0068863_100209169 | 3300005841 | Bacteria | 1878 |
| 209 | Ga0068858_100003533 | 3300005842 | Bacteria | 15479 |
| 210 | Ga0068858_100003887 | 3300005842 | Bacteria | 14756 |
| 211 | Ga0068858_100005326 | 3300005842 | Bacteria | 12619 |
| 212 | Ga0068858_100035108 | 3300005842 | Bacteria | 4650 |
| 213 | Ga0068858_100036635 | 3300005842 | Bacteria | 4548 |
| 214 | Ga0068858_100052595 | 3300005842 | Bacteria | 3768 |
| 215 | Ga0068858_100085482 | 3300005842 | Bacteria | 2935 |
| 216 | Ga0068858_100205175 | 3300005842 | Bacteria | 1865 |
| 217 | Ga0068860_100003693 | 3300005843 | Bacteria | 15764 |
| 218 | Ga0068860_100019364 | 3300005843 | Bacteria | 6602 |
| 219 | Ga0068860_100034735 | 3300005843 | Bacteria | 4837 |
| 220 | Ga0068860_100034774 | 3300005843 | Bacteria | 4834 |
| 221 | Ga0068860_100035986 | 3300005843 | Bacteria | 4746 |
| 222 | Ga0068860_100108330 | 3300005843 | Bacteria | 2655 |
| 223 | Ga0068860_100134945 | 3300005843 | Bacteria | 2370 |
| 224 | Ga0068860_100231243 | 3300005843 | Bacteria | 1797 |
| 225 | Ga0068862_100005308 | 3300005844 | Bacteria | 10795 |
| 226 | Ga0068862_100047313 | 3300005844 | Bacteria | 3670 |
| 227 | Ga0068862_100127085 | 3300005844 | Bacteria | 2252 |
| 228 | Ga0070715_10007587 | 3300006163 | Bacteria | 3741 |
| 229 | Ga0070712_100000497 | 3300006175 | Bacteria | 22503 |
| 230 | Ga0097621_100000527 | 3300006237 | Bacteria | 26821 |
| 231 | Ga0097621_100009651 | 3300006237 | Bacteria | 7016 |
| 232 | Ga0097621_100009949 | 3300006237 | Bacteria | 6931 |
| 233 | Ga0097621_100036849 | 3300006237 | Bacteria | 3914 |
| 234 | Ga0097621_100078593 | 3300006237 | Bacteria | 2741 |
| 235 | Ga0068871_100000363 | 3300006358 | Bacteria | 31624 |
| 236 | Ga0068871_100008893 | 3300006358 | Bacteria | 7244 |
| 237 | Ga0068871_100018530 | 3300006358 | Bacteria | 5293 |
| 238 | Ga0068871_100033495 | 3300006358 | Bacteria | 4068 |
| 239 | Ga0068871_100056150 | 3300006358 | Bacteria | 3199 |
| 240 | Ga0068871_100117797 | 3300006358 | Bacteria | 2240 |
| 241 | Ga0075428_100004041 | 3300006844 | Bacteria | 16122 |
| 242 | Ga0075428_100025953 | 3300006844 | Bacteria | 6488 |
| 243 | Ga0075428_100078585 | 3300006844 | Bacteria | 3601 |
| 244 | Ga0075428_100171973 | 3300006844 | Bacteria | 2348 |
| 245 | Ga0075430_100006367 | 3300006846 | Bacteria | 9954 |
| 246 | Ga0075431_100023257 | 3300006847 | Bacteria | 6339 |
| 247 | Ga0075431_100060609 | 3300006847 | Bacteria | 3904 |
| 248 | Ga0075433_10157659 | 3300006852 | Bacteria | 2020 |
| 249 | Ga0075434_100146138 | 3300006871 | Bacteria | 2385 |
| 250 | Ga0075429_100002566 | 3300006880 | Bacteria | 15312 |
| 251 | Ga0068865_100001893 | 3300006881 | Bacteria | 12305 |
| 252 | Ga0068865_100078760 | 3300006881 | Bacteria | 2358 |
| 253 | Ga0068865_100159571 | 3300006881 | Bacteria | 1719 |
| 254 | Ga0068865_100181988 | 3300006881 | Bacteria | 1619 |
| 255 | Ga0075436_100009240 | 3300006914 | Bacteria | 6747 |
| 256 | Ga0075436_100065149 | 3300006914 | Bacteria | 2519 |
| 257 | Ga0097620_100002390 | 3300006931 | Bacteria | 19102 |
| 258 | Ga0097620_100004790 | 3300006931 | Bacteria | 13767 |
| 259 | Ga0097620_100023343 | 3300006931 | Bacteria | 6209 |
| 260 | Ga0097620_100073199 | 3300006931 | Bacteria | 3464 |
| 261 | Ga0075435_100025839 | 3300007076 | Bacteria | 4575 |
| 262 | Ga0075435_100062384 | 3300007076 | Bacteria | 3025 |
| 263 | Ga0099794_10023557 | 3300007265 | Bacteria | 2818 |
| 264 | Ga0099794_10107793 | 3300007265 | Bacteria | 1394 |
| 265 | Ga0105240_10002849 | 3300009093 | Bacteria | 27324 |
| 266 | Ga0105240_10014238 | 3300009093 | Bacteria | 10866 |
| 267 | Ga0105240_10050674 | 3300009093 | Bacteria | 5232 |
| 268 | Ga0111539_10001932 | 3300009094 | Bacteria | 27627 |
| 269 | Ga0105245_10016920 | 3300009098 | Bacteria | 6366 |
| 270 | Ga0114129_10000300 | 3300009147 | Bacteria | 57502 |
| 271 | Ga0114129_10315496 | 3300009147 | Bacteria | 2080 |
| 272 | Ga0114129_10393759 | 3300009147 | Bacteria | 1827 |
| 273 | Ga0105243_10037207 | 3300009148 | Bacteria | 3780 |
| 274 | Ga0105243_10145491 | 3300009148 | Bacteria | 2027 |
| 275 | Ga0105241_10010305 | 3300009174 | Bacteria | 6862 |
| 276 | Ga0105242_10012394 | 3300009176 | Bacteria | 6562 |
| 277 | Ga0105248_10004440 | 3300009177 | Bacteria | 15538 |
| 278 | Ga0105248_10017427 | 3300009177 | Bacteria | 7919 |
| 279 | Ga0105248_10040025 | 3300009177 | Bacteria | 5253 |
| 280 | Ga0105248_10074239 | 3300009177 | Bacteria | 3822 |
| 281 | Ga0105248_10075126 | 3300009177 | Bacteria | 3799 |
| 282 | Ga0105248_10109475 | 3300009177 | Bacteria | 3115 |
| 283 | Ga0105237_10107208 | 3300009545 | Bacteria | 2785 |
| 284 | Ga0105237_10116038 | 3300009545 | Bacteria | 2671 |
| 285 | Ga0105238_10012690 | 3300009551 | Bacteria | 8503 |
| 286 | Ga0105239_10155381 | 3300010375 | Bacteria | 2554 |
| 287 | Ga0105239_10242681 | 3300010375 | Bacteria | 2022 |
| 288 | Ga0157373_10009720 | 3300013100 | Bacteria | 7098 |
| 289 | Ga0157373_10084061 | 3300013100 | Bacteria | 2243 |
| 290 | Ga0157371_10000446 | 3300013102 | Bacteria | 50636 |
| 291 | Ga0157371_10121250 | 3300013102 | Bacteria | 1859 |
| 292 | Ga0157370_10015916 | 3300013104 | Bacteria | 7630 |
| 293 | Ga0157370_10056881 | 3300013104 | Bacteria | 3722 |
| 294 | Ga0157370_10080301 | 3300013104 | Bacteria | 3070 |
| 295 | Ga0157370_10087723 | 3300013104 | Bacteria | 2922 |
| 296 | Ga0157370_10109488 | 3300013104 | Bacteria | 2582 |
| 297 | Ga0157370_10231399 | 3300013104 | Bacteria | 1711 |
| 298 | Ga0157369_10013259 | 3300013105 | Bacteria | 9327 |
| 299 | Ga0157369_10124451 | 3300013105 | Bacteria | 2734 |
| 300 | Ga0157369_10288852 | 3300013105 | Bacteria | 1707 |
| 301 | Ga0157374_10000101 | 3300013296 | Bacteria | 79331 |
| 302 | Ga0157374_10019956 | 3300013296 | Bacteria | 5941 |
| 303 | Ga0157374_10073756 | 3300013296 | Bacteria | 3221 |
| 304 | Ga0157378_10003518 | 3300013297 | Bacteria | 13892 |
| 305 | Ga0157378_10015273 | 3300013297 | Bacteria | 6724 |
| 306 | Ga0157378_10062638 | 3300013297 | Bacteria | 3321 |
| 307 | Ga0157378_10186954 | 3300013297 | Bacteria | 1952 |
| 308 | Ga0157378_10369257 | 3300013297 | Bacteria | 1406 |
| 309 | Ga0163162_10002363 | 3300013306 | Bacteria | 17730 |
| 310 | Ga0163162_10026614 | 3300013306 | Bacteria | 5718 |
| 311 | Ga0163162_10040015 | 3300013306 | Bacteria | 4686 |
| 312 | Ga0163162_10150156 | 3300013306 | Bacteria | 2447 |
| 313 | Ga0163162_10164743 | 3300013306 | Bacteria | 2340 |
| 314 | Ga0163162_10165240 | 3300013306 | Bacteria | 2337 |
| 315 | Ga0157372_10000523 | 3300013307 | Bacteria | 42408 |
| 316 | Ga0157372_10004276 | 3300013307 | Bacteria | 15270 |
| 317 | Ga0157372_10026658 | 3300013307 | Bacteria | 6289 |
| 318 | Ga0157372_10074577 | 3300013307 | Bacteria | 3826 |
| 319 | Ga0157372_10102496 | 3300013307 | Bacteria | 3269 |
| 320 | Ga0157372_10197243 | 3300013307 | Bacteria | 2332 |
| 321 | Ga0157372_10286715 | 3300013307 | Bacteria | 1915 |
| 322 | Ga0157375_10001161 | 3300013308 | Bacteria | 22758 |
| 323 | Ga0157375_10004313 | 3300013308 | Bacteria | 12341 |
| 324 | Ga0157375_10008181 | 3300013308 | Bacteria | 9156 |
| 325 | Ga0157375_10010351 | 3300013308 | Bacteria | 8211 |
| 326 | Ga0157375_10048440 | 3300013308 | Bacteria | 4157 |
| 327 | Ga0157375_10385494 | 3300013308 | Bacteria | 1568 |
| 328 | Ga0163163_10003259 | 3300014325 | Bacteria | 13764 |
| 329 | Ga0163163_10036264 | 3300014325 | Bacteria | 4790 |
| 330 | Ga0163163_10096073 | 3300014325 | Bacteria | 2983 |
| 331 | Ga0163163_10239246 | 3300014325 | Bacteria | 1865 |
| 332 | Ga0157380_10021866 | 3300014326 | Bacteria | 4803 |
| 333 | Ga0157377_10045147 | 3300014745 | Bacteria | 2460 |
| 334 | Ga0157379_10009541 | 3300014968 | Bacteria | 8450 |
| 335 | Ga0157379_10016518 | 3300014968 | Bacteria | 6493 |
| 336 | Ga0157379_10018464 | 3300014968 | Bacteria | 6151 |
| 337 | Ga0157379_10074558 | 3300014968 | Bacteria | 3038 |
| 338 | Ga0157379_10185247 | 3300014968 | Bacteria | 1881 |
| 339 | Ga0157376_10048337 | 3300014969 | Bacteria | 3517 |
| 340 | Ga0157376_10058553 | 3300014969 | Bacteria | 3227 |
| 341 | Ga0157376_10067580 | 3300014969 | Bacteria | 3024 |
| 342 | Ga0163161_10008051 | 3300017792 | Bacteria | 7291 |
| 343 | Ga0163161_10046142 | 3300017792 | Bacteria | 3143 |
| 344 | Ga0163161_10051198 | 3300017792 | Bacteria | 2991 |
| 345 | Ga0163161_10058240 | 3300017792 | Bacteria | 2808 |
| 346 | Ga0207697_10007842 | 3300025315 | Bacteria | 4721 |
| 347 | Ga0207697_10008404 | 3300025315 | Bacteria | 4518 |
| 348 | Ga0207656_10001954 | 3300025321 | Bacteria | 6854 |
| 349 | Ga0207656_10007320 | 3300025321 | Bacteria | 4012 |
| 350 | Ga0207656_10007695 | 3300025321 | Bacteria | 3939 |
| 351 | Ga0207656_10009625 | 3300025321 | Bacteria | 3591 |
| 352 | Ga0207682_10000082 | 3300025893 | Bacteria | 42307 |
| 353 | Ga0207682_10003309 | 3300025893 | Bacteria | 7038 |
| 354 | Ga0207682_10006659 | 3300025893 | Bacteria | 4643 |
| 355 | Ga0207642_10011624 | 3300025899 | Bacteria | 3149 |
| 356 | Ga0207642_10030019 | 3300025899 | Bacteria | 2259 |
| 357 | Ga0207688_10028403 | 3300025901 | Bacteria | 3077 |
| 358 | Ga0207688_10117544 | 3300025901 | Bacteria | 1549 |
| 359 | Ga0207680_10001256 | 3300025903 | Bacteria | 11993 |
| 360 | Ga0207680_10007237 | 3300025903 | Bacteria | 5396 |
| 361 | Ga0207680_10017438 | 3300025903 | Bacteria | 3794 |
| 362 | Ga0207647_10051155 | 3300025904 | Bacteria | 2555 |
| 363 | Ga0207699_10033923 | 3300025906 | Bacteria | 2889 |
| 364 | Ga0207645_10000519 | 3300025907 | Bacteria | 31964 |
| 365 | Ga0207645_10001388 | 3300025907 | Bacteria | 19868 |
| 366 | Ga0207645_10007446 | 3300025907 | Bacteria | 7730 |
| 367 | Ga0207645_10046019 | 3300025907 | Bacteria | 2788 |
| 368 | Ga0207643_10004535 | 3300025908 | Bacteria | 7466 |
| 369 | Ga0207643_10034477 | 3300025908 | Bacteria | 2835 |
| 370 | Ga0207643_10038296 | 3300025908 | Bacteria | 2693 |
| 371 | Ga0207643_10070704 | 3300025908 | Bacteria | 2008 |
| 372 | Ga0207705_10061025 | 3300025909 | Bacteria | 2724 |
| 373 | Ga0207705_10227141 | 3300025909 | Bacteria | 1419 |
| 374 | Ga0207684_10007676 | 3300025910 | Bacteria | 9675 |
| 375 | Ga0207654_10013143 | 3300025911 | Bacteria | 4253 |
| 376 | Ga0207707_10004960 | 3300025912 | Bacteria | 11694 |
| 377 | Ga0207707_10060664 | 3300025912 | Bacteria | 3290 |
| 378 | Ga0207707_10103030 | 3300025912 | Bacteria | 2495 |
| 379 | Ga0207707_10283237 | 3300025912 | Bacteria | 1435 |
| 380 | Ga0207695_10018798 | 3300025913 | Bacteria | 7974 |
| 381 | Ga0207695_10021329 | 3300025913 | Bacteria | 7394 |
| 382 | Ga0207695_10035870 | 3300025913 | Bacteria | 5368 |
| 383 | Ga0207671_10032024 | 3300025914 | Bacteria | 3914 |
| 384 | Ga0207693_10000069 | 3300025915 | Bacteria | 90103 |
| 385 | Ga0207693_10178182 | 3300025915 | Bacteria | 1672 |
| 386 | Ga0207663_10002011 | 3300025916 | Bacteria | 9653 |
| 387 | Ga0207663_10141440 | 3300025916 | Bacteria | 1677 |
| 388 | Ga0207660_10003678 | 3300025917 | Bacteria | 9994 |
| 389 | Ga0207660_10123181 | 3300025917 | Bacteria | 1966 |
| 390 | Ga0207662_10089507 | 3300025918 | Bacteria | 1891 |
| 391 | Ga0207657_10000229 | 3300025919 | Bacteria | 58709 |
| 392 | Ga0207657_10000901 | 3300025919 | Bacteria | 31375 |
| 393 | Ga0207657_10052292 | 3300025919 | Bacteria | 3546 |
| 394 | Ga0207657_10073335 | 3300025919 | Bacteria | 2893 |
| 395 | Ga0207649_10005226 | 3300025920 | Bacteria | 7010 |
| 396 | Ga0207649_10009435 | 3300025920 | Bacteria | 5338 |
| 397 | Ga0207649_10019843 | 3300025920 | Bacteria | 3847 |
| 398 | Ga0207649_10025075 | 3300025920 | Bacteria | 3473 |
| 399 | Ga0207649_10028795 | 3300025920 | Bacteria | 3274 |
| 400 | Ga0207649_10042577 | 3300025920 | Bacteria | 2770 |
| 401 | Ga0207649_10066510 | 3300025920 | Bacteria | 2285 |
| 402 | Ga0207652_10029496 | 3300025921 | Bacteria | 4588 |
| 403 | Ga0207652_10072278 | 3300025921 | Bacteria | 3000 |
| 404 | Ga0207681_10004557 | 3300025923 | Bacteria | 8526 |
| 405 | Ga0207681_10021602 | 3300025923 | Bacteria | 4094 |
| 406 | Ga0207681_10048105 | 3300025923 | Bacteria | 2877 |
| 407 | Ga0207681_10050090 | 3300025923 | Bacteria | 2825 |
| 408 | Ga0207681_10085568 | 3300025923 | Bacteria | 2238 |
| 409 | Ga0207681_10131783 | 3300025923 | Bacteria | 1849 |
| 410 | Ga0207681_10147826 | 3300025923 | Bacteria | 1757 |
| 411 | Ga0207694_10004898 | 3300025924 | Bacteria | 10395 |
| 412 | Ga0207694_10006690 | 3300025924 | Bacteria | 8761 |
| 413 | Ga0207650_10002371 | 3300025925 | Bacteria | 13104 |
| 414 | Ga0207650_10025907 | 3300025925 | Bacteria | 4180 |
| 415 | Ga0207650_10055270 | 3300025925 | Bacteria | 2947 |
| 416 | Ga0207650_10107076 | 3300025925 | Bacteria | 2159 |
| 417 | Ga0207650_10108935 | 3300025925 | Bacteria | 2142 |
| 418 | Ga0207659_10000462 | 3300025926 | Bacteria | 24409 |
| 419 | Ga0207659_10002639 | 3300025926 | Bacteria | 10676 |
| 420 | Ga0207659_10023120 | 3300025926 | Bacteria | 4145 |
| 421 | Ga0207687_10000293 | 3300025927 | Bacteria | 34325 |
| 422 | Ga0207700_10000065 | 3300025928 | Bacteria | 65305 |
| 423 | Ga0207700_10063430 | 3300025928 | Bacteria | 2810 |
| 424 | Ga0207664_10001879 | 3300025929 | Bacteria | 13810 |
| 425 | Ga0207664_10015140 | 3300025929 | Bacteria | 5588 |
| 426 | Ga0207644_10001799 | 3300025931 | Bacteria | 13904 |
| 427 | Ga0207644_10002291 | 3300025931 | Bacteria | 12422 |
| 428 | Ga0207644_10004167 | 3300025931 | Bacteria | 9376 |
| 429 | Ga0207644_10006359 | 3300025931 | Bacteria | 7692 |
| 430 | Ga0207644_10029072 | 3300025931 | Bacteria | 3831 |
| 431 | Ga0207644_10088897 | 3300025931 | Bacteria | 2298 |
| 432 | Ga0207644_10237375 | 3300025931 | Bacteria | 1450 |
| 433 | Ga0207690_10006829 | 3300025932 | Bacteria | 6768 |
| 434 | Ga0207706_10000045 | 3300025933 | Bacteria | 120758 |
| 435 | Ga0207706_10037597 | 3300025933 | Bacteria | 4297 |
| 436 | Ga0207706_10044995 | 3300025933 | Bacteria | 3911 |
| 437 | Ga0207669_10005613 | 3300025937 | Bacteria | 5648 |
| 438 | Ga0207669_10057413 | 3300025937 | Bacteria | 2369 |
| 439 | Ga0207669_10069792 | 3300025937 | Bacteria | 2200 |
| 440 | Ga0207704_10004989 | 3300025938 | Bacteria | 6104 |
| 441 | Ga0207704_10010294 | 3300025938 | Bacteria | 4555 |
| 442 | Ga0207691_10000338 | 3300025940 | Bacteria | 47065 |
| 443 | Ga0207691_10000513 | 3300025940 | Bacteria | 38489 |
| 444 | Ga0207691_10001034 | 3300025940 | Bacteria | 27579 |
| 445 | Ga0207691_10002302 | 3300025940 | Bacteria | 18712 |
| 446 | Ga0207691_10052037 | 3300025940 | Bacteria | 3741 |
| 447 | Ga0207691_10073262 | 3300025940 | Bacteria | 3089 |
| 448 | Ga0207691_10079105 | 3300025940 | Bacteria | 2959 |
| 449 | Ga0207691_10103048 | 3300025940 | Bacteria | 2545 |
| 450 | Ga0207691_10130706 | 3300025940 | Bacteria | 2218 |
| 451 | Ga0207691_10151108 | 3300025940 | Bacteria | 2042 |
| 452 | Ga0207711_10000164 | 3300025941 | Bacteria | 71542 |
| 453 | Ga0207711_10002873 | 3300025941 | Bacteria | 15098 |
| 454 | Ga0207711_10016997 | 3300025941 | Bacteria | 6043 |
| 455 | Ga0207711_10045406 | 3300025941 | Bacteria | 3755 |
| 456 | Ga0207711_10077753 | 3300025941 | Bacteria | 2893 |
| 457 | Ga0207689_10000889 | 3300025942 | Bacteria | 28731 |
| 458 | Ga0207689_10004297 | 3300025942 | Bacteria | 12968 |
| 459 | Ga0207689_10004723 | 3300025942 | Bacteria | 12295 |
| 460 | Ga0207689_10023939 | 3300025942 | Bacteria | 5122 |
| 461 | Ga0207661_10001393 | 3300025944 | Bacteria | 16247 |
| 462 | Ga0207661_10021471 | 3300025944 | Bacteria | 4837 |
| 463 | Ga0207661_10025560 | 3300025944 | Bacteria | 4490 |
| 464 | Ga0207661_10026906 | 3300025944 | Bacteria | 4389 |
| 465 | Ga0207679_10003134 | 3300025945 | Bacteria | 10212 |
| 466 | Ga0207679_10013489 | 3300025945 | Bacteria | 5358 |
| 467 | Ga0207679_10170052 | 3300025945 | Bacteria | 1793 |
| 468 | Ga0207667_10002323 | 3300025949 | Bacteria | 23821 |
| 469 | Ga0207667_10003521 | 3300025949 | Bacteria | 19357 |
| 470 | Ga0207667_10014791 | 3300025949 | Bacteria | 8879 |
| 471 | Ga0207667_10016547 | 3300025949 | Bacteria | 8330 |
| 472 | Ga0207667_10059754 | 3300025949 | Bacteria | 3991 |
| 473 | Ga0207667_10172981 | 3300025949 | Bacteria | 2220 |
| 474 | Ga0207667_10230411 | 3300025949 | Bacteria | 1897 |
| 475 | Ga0207651_10000934 | 3300025960 | Bacteria | 12881 |
| 476 | Ga0207651_10001517 | 3300025960 | Bacteria | 10596 |
| 477 | Ga0207651_10002669 | 3300025960 | Bacteria | 8536 |
| 478 | Ga0207651_10020725 | 3300025960 | Bacteria | 3976 |
| 479 | Ga0207651_10026244 | 3300025960 | Bacteria | 3635 |
| 480 | Ga0207651_10033917 | 3300025960 | Bacteria | 3298 |
| 481 | Ga0207651_10035742 | 3300025960 | Bacteria | 3235 |
| 482 | Ga0207651_10149365 | 3300025960 | Bacteria | 1817 |
| 483 | Ga0207651_10327231 | 3300025960 | Bacteria | 1283 |
| 484 | Ga0207668_10001546 | 3300025972 | Bacteria | 13465 |
| 485 | Ga0207668_10002871 | 3300025972 | Bacteria | 10107 |
| 486 | Ga0207668_10004344 | 3300025972 | Bacteria | 8323 |
| 487 | Ga0207668_10050299 | 3300025972 | Bacteria | 2871 |
| 488 | Ga0207668_10127096 | 3300025972 | Bacteria | 1940 |
| 489 | Ga0207668_10148058 | 3300025972 | Bacteria | 1814 |
| 490 | Ga0207668_10345220 | 3300025972 | Bacteria | 1243 |
| 491 | Ga0207640_10001436 | 3300025981 | Bacteria | 12896 |
| 492 | Ga0207640_10055673 | 3300025981 | Bacteria | 2592 |
| 493 | Ga0207658_10001490 | 3300025986 | Bacteria | 18193 |
| 494 | Ga0207658_10005249 | 3300025986 | Bacteria | 8910 |
| 495 | Ga0207658_10034687 | 3300025986 | Bacteria | 3607 |
| 496 | Ga0207658_10037748 | 3300025986 | Bacteria | 3474 |
| 497 | Ga0207658_10161322 | 3300025986 | Bacteria | 1838 |
| 498 | Ga0207677_10000092 | 3300026023 | Bacteria | 73792 |
| 499 | Ga0207677_10000494 | 3300026023 | Bacteria | 25605 |
| 500 | Ga0207677_10001029 | 3300026023 | Bacteria | 15352 |
| 501 | Ga0207677_10254324 | 3300026023 | Bacteria | 1428 |
| 502 | Ga0207703_10000506 | 3300026035 | Bacteria | 40394 |
| 503 | Ga0207703_10010581 | 3300026035 | Bacteria | 7209 |
| 504 | Ga0207703_10017986 | 3300026035 | Bacteria | 5519 |
| 505 | Ga0207703_10038736 | 3300026035 | Bacteria | 3807 |
| 506 | Ga0207703_10052930 | 3300026035 | Bacteria | 3298 |
| 507 | Ga0207703_10177186 | 3300026035 | Bacteria | 1879 |
| 508 | Ga0207639_10030344 | 3300026041 | Bacteria | 3965 |
| 509 | Ga0207639_10292323 | 3300026041 | Bacteria | 1437 |
| 510 | Ga0207678_10005717 | 3300026067 | Bacteria | 11098 |
| 511 | Ga0207678_10020795 | 3300026067 | Bacteria | 5752 |
| 512 | Ga0207678_10038495 | 3300026067 | Bacteria | 4155 |
| 513 | Ga0207678_10041888 | 3300026067 | Bacteria | 3969 |
| 514 | Ga0207678_10058404 | 3300026067 | Bacteria | 3319 |
| 515 | Ga0207678_10067069 | 3300026067 | Bacteria | 3080 |
| 516 | Ga0207708_10001315 | 3300026075 | Bacteria | 18686 |
| 517 | Ga0207702_10004090 | 3300026078 | Bacteria | 13086 |
| 518 | Ga0207702_10011074 | 3300026078 | Bacteria | 7529 |
| 519 | Ga0207702_10031606 | 3300026078 | Bacteria | 4412 |
| 520 | Ga0207702_10086602 | 3300026078 | Bacteria | 2732 |
| 521 | Ga0207702_10155438 | 3300026078 | Bacteria | 2085 |
| 522 | Ga0207641_10022936 | 3300026088 | Bacteria | 5141 |
| 523 | Ga0207641_10026453 | 3300026088 | Bacteria | 4788 |
| 524 | Ga0207641_10030082 | 3300026088 | Bacteria | 4496 |
| 525 | Ga0207641_10043769 | 3300026088 | Bacteria | 3762 |
| 526 | Ga0207641_10045274 | 3300026088 | Bacteria | 3704 |
| 527 | Ga0207641_10208651 | 3300026088 | Bacteria | 1805 |
| 528 | Ga0207648_10002230 | 3300026089 | Bacteria | 20980 |
| 529 | Ga0207648_10002591 | 3300026089 | Bacteria | 19359 |
| 530 | Ga0207648_10004777 | 3300026089 | Bacteria | 13839 |
| 531 | Ga0207648_10006304 | 3300026089 | Bacteria | 11797 |
| 532 | Ga0207648_10007295 | 3300026089 | Bacteria | 10898 |
| 533 | Ga0207648_10008950 | 3300026089 | Bacteria | 9630 |
| 534 | Ga0207648_10019441 | 3300026089 | Bacteria | 6131 |
| 535 | Ga0207648_10082246 | 3300026089 | Bacteria | 2808 |
| 536 | Ga0207676_10003075 | 3300026095 | Bacteria | 11909 |
| 537 | Ga0207676_10008460 | 3300026095 | Bacteria | 7317 |
| 538 | Ga0207676_10012927 | 3300026095 | Bacteria | 5996 |
| 539 | Ga0207676_10013032 | 3300026095 | Bacteria | 5971 |
| 540 | Ga0207676_10296485 | 3300026095 | Bacteria | 1474 |
| 541 | Ga0207674_10000225 | 3300026116 | Bacteria | 70648 |
| 542 | Ga0207674_10001745 | 3300026116 | Bacteria | 27816 |
| 543 | Ga0207674_10003637 | 3300026116 | Bacteria | 18800 |
| 544 | Ga0207674_10013104 | 3300026116 | Bacteria | 9228 |
| 545 | Ga0207674_10021384 | 3300026116 | Bacteria | 6968 |
| 546 | Ga0207674_10105142 | 3300026116 | Bacteria | 2802 |
| 547 | Ga0207675_100000855 | 3300026118 | Bacteria | 30355 |
| 548 | Ga0207675_100009307 | 3300026118 | Bacteria | 9215 |
| 549 | Ga0207675_100021383 | 3300026118 | Bacteria | 6027 |
| 550 | Ga0207675_100068026 | 3300026118 | Bacteria | 3330 |
| 551 | Ga0207675_100071099 | 3300026118 | Bacteria | 3253 |
| 552 | Ga0207675_100150647 | 3300026118 | Bacteria | 2213 |
| 553 | Ga0207683_10000121 | 3300026121 | Bacteria | 64376 |
| 554 | Ga0207683_10000673 | 3300026121 | Bacteria | 31320 |
| 555 | Ga0207683_10004272 | 3300026121 | Bacteria | 12334 |
| 556 | Ga0207683_10006759 | 3300026121 | Bacteria | 9812 |
| 557 | Ga0207698_10008721 | 3300026142 | Bacteria | 6429 |
| 558 | Ga0207698_10009730 | 3300026142 | Bacteria | 6139 |
| 559 | Ga0207698_10066446 | 3300026142 | Bacteria | 2838 |
| 560 | Ga0207698_10088645 | 3300026142 | Bacteria | 2524 |
| 561 | Ga0209995_1004473 | 3300027471 | Bacteria | 2234 |
| 562 | Ga0209983_1012042 | 3300027665 | Bacteria | 1773 |
| 563 | Ga0209971_1011786 | 3300027682 | Bacteria | 2071 |
| 564 | Ga0209974_10000048 | 3300027876 | Bacteria | 30134 |
| 565 | Ga0207428_10002616 | 3300027907 | Bacteria | 17962 |
| 566 | Ga0268266_10003685 | 3300028379 | Bacteria | 15120 |
| 567 | Ga0268266_10007213 | 3300028379 | Bacteria | 10054 |
| 568 | Ga0268265_10016033 | 3300028380 | Bacteria | 5142 |
| 569 | Ga0268265_10019252 | 3300028380 | Bacteria | 4740 |
| 570 | Ga0268265_10036186 | 3300028380 | Bacteria | 3614 |
| 571 | Ga0268265_10089864 | 3300028380 | Bacteria | 2452 |
| 572 | Ga0268265_10103612 | 3300028380 | Bacteria | 2304 |
| 573 | Ga0268265_10173943 | 3300028380 | Bacteria | 1843 |
| 574 | Ga0268264_10003879 | 3300028381 | Bacteria | 12824 |
| 575 | Ga0268264_10028580 | 3300028381 | Bacteria | 4562 |
| 576 | Ga0268264_10044409 | 3300028381 | Bacteria | 3686 |
| 577 | Ga0268264_10049994 | 3300028381 | Bacteria | 3480 |
| 578 | Ga0268264_10226897 | 3300028381 | Bacteria | 1722 |
| 579 | Ga0265332_10000015 | 3300031238 | Bacteria | 243944 |
| 580 | Ga0265331_10001011 | 3300031250 | Bacteria | 21974 |
| 581 | Ga0307405_10003121 | 3300031731 | Bacteria | 7531 |
| 582 | Ga0307413_10001092 | 3300031824 | Bacteria | 9915 |
| 583 | Ga0307410_10019546 | 3300031852 | Bacteria | 4124 |
| 584 | Ga0307410_10032155 | 3300031852 | Bacteria | 3373 |
| 585 | Ga0307406_10002290 | 3300031901 | Bacteria | 10419 |
| 586 | Ga0307406_10133797 | 3300031901 | Bacteria | 1744 |
| 587 | Ga0307407_10002024 | 3300031903 | Bacteria | 7729 |
| 588 | Ga0307409_100010788 | 3300031995 | Bacteria | 5711 |
| 589 | Ga0307409_100014397 | 3300031995 | Bacteria | 5144 |
| 590 | Ga0307416_100019997 | 3300032002 | Bacteria | 4763 |
| 591 | Ga0307416_100029161 | 3300032002 | Bacteria | 4118 |
| 592 | Ga0307416_100298109 | 3300032002 | Bacteria | 1600 |
| 593 | Ga0307411_10008263 | 3300032005 | Bacteria | 5376 |
| 594 | Ga0307415_100001418 | 3300032126 | Bacteria | 11457 |
| 595 | Ga0373926_0000576 | 3300035083 | Bacteria | 9898 |
| 596 | Ga0373934_0013807 | 3300035086 | Bacteria | 3056 |
| 597 | Ga0373923_0003720 | 3300035111 | Bacteria | 4941 |
| 598 | Ga0373954_0004105 | 3300035118 | Bacteria | 6243 |
| 599 | Ga0373956_0006971 | 3300035119 | Bacteria | 4542 |
| 600 | Ga0373956_0054177 | 3300035119 | Bacteria | 1807 |
| 601 | Ga0373943_0010451 | 3300035170 | Bacteria | 4158 |
| 602 | Ga0373943_0024069 | 3300035170 | Bacteria | 2837 |
| 603 | Ga0373946_0000954 | 3300035171 | Bacteria | 9905 |
| 604 | Ga0373955_0019234 | 3300035172 | Bacteria | 3409 |
| 605 | Ga0373924_0016835 | 3300035410 | Bacteria | 2797 |
| 606 | Ga0373924_0048956 | 3300035410 | Bacteria | 1747 |
| 607 | Ga0373935_0020897 | 3300035692 | Bacteria | 4004 |
| 608 | Ga0373935_0050623 | 3300035692 | Bacteria | 2636 |
| 609 | Ga0373927_0002452 | 3300035695 | Bacteria | 13529 |
| 610 | Ga0373927_0073839 | 3300035695 | Bacteria | 2208 |
| 611 | Ga0373933_0010830 | 3300035724 | Bacteria | 5003 |
| 612 | Ga0373933_0057327 | 3300035724 | Bacteria | 2341 |
| 613 | Ga0373947_0008960 | 3300035725 | Bacteria | 5750 |
| 614 | Ga0373937_0039305 | 3300036401 | Bacteria | 4311 |
| 615 | Ga0373937_0060216 | 3300036401 | Bacteria | 3489 |
| 616 | Ga0373925_0007825 | 3300037068 | Bacteria | 7784 |
| 617 | Ga0373925_0011881 | 3300037068 | Bacteria | 6301 |
| 618 | Ga0373925_0239892 | 3300037068 | Bacteria | 1451 |
| 619 | Ga0395900_0034857 | 3300037418 | Bacteria | 5185 |
| 620 | Ga0395900_0137950 | 3300037418 | Bacteria | 2499 |
| 621 | Ga0395905_0000290 | 3300037471 | Bacteria | 73649 |
| 622 | Ga0395905_0042761 | 3300037471 | Bacteria | 4250 |
| 623 | Ga0395905_0227573 | 3300037471 | Bacteria | 1744 |
| 624 | Ga0395901_0012426 | 3300038443 | Bacteria | 8639 |
| 625 | Ga0395901_0057048 | 3300038443 | Bacteria | 4062 |
| 626 | Ga0451577_0174756 | 3300042876 | Bacteria | 1936 |
| 627 | Ga0466969_0019356 | 3300044656 | Bacteria | 3540 |
| 628 | Ga0451576_0115675 | 3300045051 | Bacteria | 2792 |
| 629 | Ga0495603_0011366 | 3300046455 | Bacteria | 5391 |
| 630 | Ga0495603_0064435 | 3300046455 | Bacteria | 2161 |
| 631 | Ga0495629_0073197 | 3300046459 | Bacteria | 2393 |
| 632 | Ga0495638_0064631 | 3300046460 | Bacteria | 2254 |
| 633 | Ga0495653_0107736 | 3300046463 | Bacteria | 2008 |
| 634 | Ga0495650_0000619 | 3300046471 | Bacteria | 48090 |
| 635 | Ga0495580_0013460 | 3300046472 | Bacteria | 6239 |
| 636 | Ga0495580_0143767 | 3300046472 | Bacteria | 1653 |
| 637 | Ga0495639_0007246 | 3300046475 | Bacteria | 4761 |
| 638 | Ga0495662_0029624 | 3300046476 | Bacteria | 2642 |
| 639 | Ga0495628_0103627 | 3300046516 | Bacteria | 2194 |
| 640 | Ga0495666_0035379 | 3300046526 | Bacteria | 2435 |
| 641 | Ga0495665_0014205 | 3300046531 | Bacteria | 4296 |
| 642 | Ga0495586_0014237 | 3300046535 | Bacteria | 4227 |
| 643 | Ga0495621_0032382 | 3300046539 | Bacteria | 1797 |
| 644 | Ga0495647_0000700 | 3300046681 | Bacteria | 9991 |
| 645 | Ga0495647_0007603 | 3300046681 | Bacteria | 3636 |
| 646 | Ga0495658_0009042 | 3300046683 | Bacteria | 4953 |
| 647 | Ga0495658_0031146 | 3300046683 | Bacteria | 2902 |
| 648 | Ga0495613_0122629 | 3300046689 | Bacteria | 1865 |
| 649 | Ga0495581_0099802 | 3300047315 | Bacteria | 1686 |
| 650 | Ga0495680_0028095 | 3300047322 | Bacteria | 4615 |
| 651 | Ga0495683_0012997 | 3300047323 | Bacteria | 4361 |
| 652 | Ga0495677_0011479 | 3300047445 | Bacteria | 3241 |
| 653 | Ga0495679_029676 | 3300047446 | Bacteria | 1782 |
| 654 | Ga0496100_0068321 | 3300048903 | Bacteria | 2363 |
| 655 | Ga0496101_0045793 | 3300048904 | Bacteria | 3135 |
| 656 | Ga0496101_0081300 | 3300048904 | Bacteria | 2396 |
| 657 | Ga0496102_0030829 | 3300048905 | Bacteria | 4802 |
| 658 | Ga0496102_0206995 | 3300048905 | Bacteria | 1849 |
| 659 | Ga0496104_0000858 | 3300048907 | Bacteria | 26186 |
| 660 | Ga0496104_0023107 | 3300048907 | Bacteria | 5715 |
| 661 | Ga0496105_0031562 | 3300048908 | Bacteria | 4343 |
| 662 | Ga0496105_0191739 | 3300048908 | Bacteria | 1671 |
| 663 | Ga0496106_0008041 | 3300048909 | Bacteria | 7790 |
| 664 | Ga0496106_0044172 | 3300048909 | Bacteria | 3344 |
| 665 | Ga0496108_0026112 | 3300048911 | Bacteria | 4817 |
| 666 | Ga0496108_0064732 | 3300048911 | Bacteria | 3081 |
| 667 | Ga0496108_0104093 | 3300048911 | Bacteria | 2422 |
| 668 | Ga0496109_0001737 | 3300048912 | Bacteria | 18195 |
| 669 | Ga0496109_0052662 | 3300048912 | Bacteria | 3710 |
| 670 | Ga0496110_0002719 | 3300048913 | Bacteria | 13359 |
| 671 | Ga0496110_0275162 | 3300048913 | Bacteria | 1533 |
| 672 | Ga0496111_0150698 | 3300048914 | Bacteria | 1725 |
| 673 | Ga0496112_0001078 | 3300048915 | Bacteria | 20180 |
| 674 | Ga0496112_0023392 | 3300048915 | Bacteria | 5903 |
| 675 | Ga0496112_0233408 | 3300048915 | Bacteria | 1794 |
| 676 | Ga0496112_0252901 | 3300048915 | Bacteria | 1713 |
| 677 | Ga0496114_0059484 | 3300048917 | Bacteria | 3192 |
| 678 | Ga0496114_0072310 | 3300048917 | Bacteria | 2900 |
| 679 | Ga0496114_0130635 | 3300048917 | Bacteria | 2169 |
| 680 | Ga0501034_0151461 | 3300049571 | Bacteria | 2295 |
| 681 | Ga0501036_0177245 | 3300049572 | Bacteria | 1795 |
| 682 | Ga0501038_0125597 | 3300049574 | Bacteria | 2112 |
| 683 | Ga0501040_0007048 | 3300049576 | Bacteria | 7285 |
| 684 | Ga0501042_0004359 | 3300049578 | Bacteria | 9027 |
| 685 | Ga0501046_0159229 | 3300049580 | Bacteria | 1699 |
| 686 | Ga0501048_0078418 | 3300049582 | Bacteria | 2331 |
| 687 | Ga0501072_0013113 | 3300049588 | Bacteria | 6344 |
| 688 | Ga0501080_0008848 | 3300049742 | Bacteria | 9154 |
| 689 | Ga0501083_0003863 | 3300049744 | Bacteria | 10525 |
| 690 | nmdc:mga05p37_248600_c1 | 3300050507 | Bacteria | 2134 |
| 691 | nmdc:mga05p37_3736_c1 | 3300050507 | Bacteria | 17814 |
| 692 | nmdc:mga09592_426350_c1 | 3300050508 | Bacteria | 1145 |
| 693 | nmdc:mga09592_488_c1 | 3300050508 | Bacteria | 29700 |
| 694 | nmdc:mga0qj67_50559_c1 | 3300050509 | Bacteria | 3287 |
| 695 | nmdc:mga06r32_2186_c1 | 3300050510 | Bacteria | 17525 |
| 696 | nmdc:mga08y16_160517_c1 | 3300050511 | Bacteria | 2336 |
| 697 | nmdc:mga08y16_5779_c1 | 3300050511 | Bacteria | 12956 |
| 698 | nmdc:mga0n895_131509_c1 | 3300050512 | Bacteria | 2527 |
| 699 | nmdc:mga0n895_131591_c1 | 3300050512 | Bacteria | 2527 |
| 700 | nmdc:mga0n895_458450_c1 | 3300050512 | Bacteria | 1287 |
| 701 | nmdc:mga0rr50_5421_c1 | 3300050513 | Bacteria | 2787 |
| 702 | nmdc:mga0rr50_60082_c1 | 3300050513 | Bacteria | 2858 |
| 703 | nmdc:mga08x19_15664_c1 | 3300050514 | Bacteria | 4614 |
| 704 | nmdc:mga08x19_52072_c1 | 3300050514 | Bacteria | 2631 |
| 705 | nmdc:mga0a205_372595_c1 | 3300050515 | Bacteria | 1293 |
| 706 | Ga0495619_0015242 | 3300053085 | Bacteria | 4860 |
| 707 | Ga0500586_000640 | 3300053145 | Bacteria | 7127 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0151461 | Ga0501034_0151461_15_1073 | 255 |
| 2 | 3300009147 | Ga0114129_10393759 | Ga0114129_103937592 | 274 |
| 3 | 3300005617 | Ga0068859_100073193 | Ga0068859_1000731932 | 277 |
| 4 | 3300006931 | Ga0097620_100073199 | Ga0097620_1000731993 | 277 |
| 5 | 3300009093 | Ga0105240_10014238 | Ga0105240_100142382 | 286 |
| 6 | 3300025913 | Ga0207695_10035870 | Ga0207695_100358702 | 286 |
| 7 | 3300037471 | Ga0395905_0000290 | Ga0395905_0000290_15431_16522 | 289 |
| 8 | 3300013104 | Ga0157370_10231399 | Ga0157370_102313992 | 290 |
| 9 | 3300035083 | Ga0373926_0000576 | Ga0373926_0000576_1677_2678 | 290 |
| 10 | 3300035170 | Ga0373943_0010451 | Ga0373943_0010451_1771_2772 | 290 |
| 11 | 3300035171 | Ga0373946_0000954 | Ga0373946_0000954_7743_8744 | 290 |
| 12 | 3300035692 | Ga0373935_0020897 | Ga0373935_0020897_791_1792 | 290 |
| 13 | 3300035695 | Ga0373927_0002452 | Ga0373927_0002452_10704_11705 | 290 |
| 14 | 3300035725 | Ga0373947_0008960 | Ga0373947_0008960_791_1792 | 290 |
| 15 | 3300037068 | Ga0373925_0011881 | Ga0373925_0011881_2346_3347 | 290 |
| 16 | 3300046455 | Ga0495603_0011366 | Ga0495603_0011366_3176_4177 | 290 |
| 17 | 3300046460 | Ga0495638_0064631 | Ga0495638_0064631_788_1771 | 290 |
| 18 | 3300046471 | Ga0495650_0000619 | Ga0495650_0000619_4904_5887 | 290 |
| 19 | 3300046472 | Ga0495580_0013460 | Ga0495580_0013460_2213_3214 | 290 |
| 20 | 3300046475 | Ga0495639_0007246 | Ga0495639_0007246_281_1282 | 290 |
| 21 | 3300046526 | Ga0495666_0035379 | Ga0495666_0035379_367_1368 | 290 |
| 22 | 3300046531 | Ga0495665_0014205 | Ga0495665_0014205_1587_2588 | 290 |
| 23 | 3300046535 | Ga0495586_0014237 | Ga0495586_0014237_844_1845 | 290 |
| 24 | 3300046681 | Ga0495647_0000700 | Ga0495647_0000700_5525_6526 | 290 |
| 25 | 3300046683 | Ga0495658_0009042 | Ga0495658_0009042_647_1648 | 290 |
| 26 | 3300047323 | Ga0495683_0012997 | Ga0495683_0012997_1619_2602 | 290 |
| 27 | 3300047446 | Ga0495679_029676 | Ga0495679_029676_209_1192 | 290 |
| 28 | 3300053145 | Ga0500586_000640 | Ga0500586_000640_3478_4461 | 290 |
| 29 | 3300005336 | Ga0070680_100036398 | Ga0070680_1000363983 | 291 |
| 30 | 3300005444 | Ga0070694_100132031 | Ga0070694_1001320312 | 291 |
| 31 | 3300006914 | Ga0075436_100009240 | Ga0075436_1000092403 | 291 |
| 32 | 3300007076 | Ga0075435_100025839 | Ga0075435_1000258392 | 291 |
| 33 | 3300009147 | Ga0114129_10315496 | Ga0114129_103154962 | 291 |
| 34 | 3300050513 | nmdc:mga0rr50_60082_c1 | nmdc:mga0rr50_60082_c1_46_1098 | 291 |
| 35 | 3300050514 | nmdc:mga08x19_15664_c1 | nmdc:mga08x19_15664_c1_3409_4416 | 291 |
| 36 | 3300031238 | Ga0265332_10000015 | Ga0265332_1000001598 | 292 |
| 37 | 3300050512 | nmdc:mga0n895_131591_c1 | nmdc:mga0n895_131591_c1_553_1557 | 293 |
| 38 | 3300050512 | nmdc:mga0n895_458450_c1 | nmdc:mga0n895_458450_c1_12_1016 | 293 |
| 39 | 3300050513 | nmdc:mga0rr50_5421_c1 | nmdc:mga0rr50_5421_c1_814_1818 | 293 |
| 40 | 3300005334 | Ga0068869_100105795 | Ga0068869_1001057952 | 294 |
| 41 | 3300005471 | Ga0070698_100013247 | Ga0070698_1000132475 | 295 |
| 42 | 3300006844 | Ga0075428_100025953 | Ga0075428_1000259533 | 295 |
| 43 | 3300006847 | Ga0075431_100023257 | Ga0075431_1000232572 | 295 |
| 44 | 3300006852 | Ga0075433_10157659 | Ga0075433_101576592 | 295 |
| 45 | 3300006880 | Ga0075429_100002566 | Ga0075429_1000025662 | 295 |
| 46 | 3300009147 | Ga0114129_10000300 | Ga0114129_1000030011 | 295 |
| 47 | 3300050507 | nmdc:mga05p37_3736_c1 | nmdc:mga05p37_3736_c1_15210_16265 | 295 |
| 48 | 3300050508 | nmdc:mga09592_488_c1 | nmdc:mga09592_488_c1_13238_14293 | 295 |
| 49 | 3300050510 | nmdc:mga06r32_2186_c1 | nmdc:mga06r32_2186_c1_2319_3374 | 295 |
| 50 | 3300050515 | nmdc:mga0a205_372595_c1 | nmdc:mga0a205_372595_c1_47_1102 | 295 |
| 51 | 3300014325 | Ga0163163_10239246 | Ga0163163_102392462 | 296 |
| 52 | 3300026035 | Ga0207703_10052930 | Ga0207703_100529303 | 296 |
| 53 | 3300050511 | nmdc:mga08y16_160517_c1 | nmdc:mga08y16_160517_c1_895_1950 | 296 |
| 54 | 3300005471 | Ga0070698_100099088 | Ga0070698_1000990883 | 297 |
| 55 | 3300005718 | Ga0068866_10100012 | Ga0068866_101000122 | 297 |
| 56 | 3300005577 | Ga0068857_100357482 | Ga0068857_1003574821 | 298 |
| 57 | 3300005614 | Ga0068856_100257735 | Ga0068856_1002577352 | 298 |
| 58 | 3300026078 | Ga0207702_10086602 | Ga0207702_100866023 | 298 |
| 59 | 3300026116 | Ga0207674_10013104 | Ga0207674_100131047 | 298 |
| 60 | 3300013297 | Ga0157378_10369257 | Ga0157378_103692572 | 299 |
| 61 | 3300025915 | Ga0207693_10178182 | Ga0207693_101781822 | 299 |
| 62 | 3300025929 | Ga0207664_10001879 | Ga0207664_100018799 | 299 |
| 63 | 3300037471 | Ga0395905_0042761 | Ga0395905_0042761_2415_3524 | 299 |
| 64 | 3300038443 | Ga0395901_0057048 | Ga0395901_0057048_921_2030 | 299 |
| 65 | 3300005355 | Ga0070671_100002136 | Ga0070671_1000021369 | 300 |
| 66 | 3300005444 | Ga0070694_100131362 | Ga0070694_1001313622 | 300 |
| 67 | 3300005458 | Ga0070681_10001301 | Ga0070681_1000130118 | 300 |
| 68 | 3300005467 | Ga0070706_100006279 | Ga0070706_1000062795 | 300 |
| 69 | 3300005546 | Ga0070696_100157581 | Ga0070696_1001575812 | 300 |
| 70 | 3300025910 | Ga0207684_10007676 | Ga0207684_100076765 | 300 |
| 71 | 3300045051 | Ga0451576_0115675 | Ga0451576_0115675_587_1591 | 300 |
| 72 | 3300048911 | Ga0496108_0064732 | Ga0496108_0064732_1431_2489 | 300 |
| 73 | 3300005290 | Ga0065712_10071001 | Ga0065712_100710013 | 301 |
| 74 | 3300005327 | Ga0070658_10050650 | Ga0070658_100506501 | 301 |
| 75 | 3300005331 | Ga0070670_100000710 | Ga0070670_10000071015 | 301 |
| 76 | 3300005333 | Ga0070677_10002248 | Ga0070677_100022484 | 301 |
| 77 | 3300005354 | Ga0070675_100000564 | Ga0070675_10000056414 | 301 |
| 78 | 3300005355 | Ga0070671_100003077 | Ga0070671_1000030774 | 301 |
| 79 | 3300005356 | Ga0070674_100051026 | Ga0070674_1000510262 | 301 |
| 80 | 3300005364 | Ga0070673_100011276 | Ga0070673_1000112763 | 301 |
| 81 | 3300005535 | Ga0070684_100037355 | Ga0070684_1000373552 | 301 |
| 82 | 3300005618 | Ga0068864_100015587 | Ga0068864_1000155872 | 301 |
| 83 | 3300005834 | Ga0068851_10003672 | Ga0068851_100036723 | 301 |
| 84 | 3300005840 | Ga0068870_10142086 | Ga0068870_101420862 | 301 |
| 85 | 3300006237 | Ga0097621_100000527 | Ga0097621_10000052710 | 301 |
| 86 | 3300006358 | Ga0068871_100000363 | Ga0068871_10000036314 | 301 |
| 87 | 3300007265 | Ga0099794_10023557 | Ga0099794_100235572 | 301 |
| 88 | 3300013296 | Ga0157374_10019956 | Ga0157374_100199565 | 301 |
| 89 | 3300014745 | Ga0157377_10045147 | Ga0157377_100451472 | 301 |
| 90 | 3300025321 | Ga0207656_10001954 | Ga0207656_100019545 | 301 |
| 91 | 3300025893 | Ga0207682_10003309 | Ga0207682_100033093 | 301 |
| 92 | 3300025909 | Ga0207705_10227141 | Ga0207705_102271412 | 301 |
| 93 | 3300025925 | Ga0207650_10002371 | Ga0207650_100023713 | 301 |
| 94 | 3300025926 | Ga0207659_10000462 | Ga0207659_100004626 | 301 |
| 95 | 3300025931 | Ga0207644_10002291 | Ga0207644_100022919 | 301 |
| 96 | 3300025933 | Ga0207706_10044995 | Ga0207706_100449952 | 301 |
| 97 | 3300025937 | Ga0207669_10069792 | Ga0207669_100697922 | 301 |
| 98 | 3300026095 | Ga0207676_10013032 | Ga0207676_100130325 | 301 |
| 99 | 3300026121 | Ga0207683_10000673 | Ga0207683_1000067317 | 301 |
| 100 | 3300005329 | Ga0070683_100001922 | Ga0070683_1000019228 | 302 |
| 101 | 3300005335 | Ga0070666_10064548 | Ga0070666_100645482 | 302 |
| 102 | 3300005338 | Ga0068868_100000336 | Ga0068868_10000033625 | 302 |
| 103 | 3300005344 | Ga0070661_100001915 | Ga0070661_10000191513 | 302 |
| 104 | 3300005345 | Ga0070692_10189011 | Ga0070692_101890112 | 302 |
| 105 | 3300005367 | Ga0070667_100081625 | Ga0070667_1000816253 | 302 |
| 106 | 3300005440 | Ga0070705_100048850 | Ga0070705_1000488502 | 302 |
| 107 | 3300005456 | Ga0070678_100002367 | Ga0070678_1000023674 | 302 |
| 108 | 3300005459 | Ga0068867_100004748 | Ga0068867_1000047485 | 302 |
| 109 | 3300005543 | Ga0070672_100024926 | Ga0070672_1000249262 | 302 |
| 110 | 3300005578 | Ga0068854_100012235 | Ga0068854_1000122354 | 302 |
| 111 | 3300005616 | Ga0068852_100000411 | Ga0068852_10000041130 | 302 |
| 112 | 3300009177 | Ga0105248_10075126 | Ga0105248_100751262 | 302 |
| 113 | 3300013297 | Ga0157378_10015273 | Ga0157378_100152733 | 302 |
| 114 | 3300013308 | Ga0157375_10001161 | Ga0157375_1000116115 | 302 |
| 115 | 3300025920 | Ga0207649_10028795 | Ga0207649_100287952 | 302 |
| 116 | 3300025940 | Ga0207691_10000513 | Ga0207691_1000051314 | 302 |
| 117 | 3300025944 | Ga0207661_10001393 | Ga0207661_100013935 | 302 |
| 118 | 3300025960 | Ga0207651_10002669 | Ga0207651_100026697 | 302 |
| 119 | 3300025981 | Ga0207640_10001436 | Ga0207640_100014364 | 302 |
| 120 | 3300025986 | Ga0207658_10037748 | Ga0207658_100377482 | 302 |
| 121 | 3300026023 | Ga0207677_10000494 | Ga0207677_1000049419 | 302 |
| 122 | 3300026089 | Ga0207648_10008950 | Ga0207648_100089505 | 302 |
| 123 | 3300035410 | Ga0373924_0016835 | Ga0373924_0016835_30_1202 | 302 |
| 124 | 3300048904 | Ga0496101_0045793 | Ga0496101_0045793_349_1485 | 302 |
| 125 | 3300048911 | Ga0496108_0026112 | Ga0496108_0026112_2973_4109 | 302 |
| 126 | 3300048912 | Ga0496109_0001737 | Ga0496109_0001737_11781_12917 | 302 |
| 127 | 3300048913 | Ga0496110_0002719 | Ga0496110_0002719_10171_11307 | 302 |
| 128 | 3300048917 | Ga0496114_0072310 | Ga0496114_0072310_632_1768 | 302 |
| 129 | 3300049572 | Ga0501036_0177245 | Ga0501036_0177245_68_1081 | 302 |
| 130 | 3300049574 | Ga0501038_0125597 | Ga0501038_0125597_274_1287 | 302 |
| 131 | 3300049576 | Ga0501040_0007048 | Ga0501040_0007048_4179_5192 | 302 |
| 132 | 3300049578 | Ga0501042_0004359 | Ga0501042_0004359_1856_2869 | 302 |
| 133 | 3300049580 | Ga0501046_0159229 | Ga0501046_0159229_169_1182 | 302 |
| 134 | 3300049582 | Ga0501048_0078418 | Ga0501048_0078418_1007_2020 | 302 |
| 135 | 3300006844 | Ga0075428_100171973 | Ga0075428_1001719732 | 303 |
| 136 | 3300017792 | Ga0163161_10058240 | Ga0163161_100582402 | 303 |
| 137 | 3300050509 | nmdc:mga0qj67_50559_c1 | nmdc:mga0qj67_50559_c1_1011_2102 | 303 |
| 138 | 3300017792 | Ga0163161_10046142 | Ga0163161_100461422 | 304 |
| 139 | 3300025938 | Ga0207704_10010294 | Ga0207704_100102942 | 304 |
| 140 | 3300031731 | Ga0307405_10003121 | Ga0307405_100031216 | 304 |
| 141 | 3300031824 | Ga0307413_10001092 | Ga0307413_100010927 | 304 |
| 142 | 3300031852 | Ga0307410_10032155 | Ga0307410_100321552 | 304 |
| 143 | 3300031901 | Ga0307406_10002290 | Ga0307406_100022906 | 304 |
| 144 | 3300031903 | Ga0307407_10002024 | Ga0307407_100020241 | 304 |
| 145 | 3300031995 | Ga0307409_100010788 | Ga0307409_1000107882 | 304 |
| 146 | 3300032002 | Ga0307416_100019997 | Ga0307416_1000199973 | 304 |
| 147 | 3300032005 | Ga0307411_10008263 | Ga0307411_100082632 | 304 |
| 148 | 3300032126 | Ga0307415_100001418 | Ga0307415_1000014184 | 304 |
| 149 | 3300050508 | nmdc:mga09592_426350_c1 | nmdc:mga09592_426350_c1_15_1115 | 304 |
| 150 | 3300005335 | Ga0070666_10010489 | Ga0070666_100104895 | 305 |
| 151 | 3300005355 | Ga0070671_100032404 | Ga0070671_1000324045 | 305 |
| 152 | 3300005842 | Ga0068858_100036635 | Ga0068858_1000366353 | 305 |
| 153 | 3300013297 | Ga0157378_10003518 | Ga0157378_1000351810 | 305 |
| 154 | 3300013306 | Ga0163162_10026614 | Ga0163162_100266144 | 305 |
| 155 | 3300013306 | Ga0163162_10150156 | Ga0163162_101501562 | 305 |
| 156 | 3300025931 | Ga0207644_10004167 | Ga0207644_100041676 | 305 |
| 157 | 3300026035 | Ga0207703_10010581 | Ga0207703_100105814 | 305 |
| 158 | 3300037471 | Ga0395905_0227573 | Ga0395905_0227573_615_1718 | 305 |
| 159 | 3300005842 | Ga0068858_100003533 | Ga0068858_1000035337 | 306 |
| 160 | 3300014968 | Ga0157379_10018464 | Ga0157379_100184643 | 306 |
| 161 | 3300026067 | Ga0207678_10041888 | Ga0207678_100418882 | 306 |
| 162 | 3300044656 | Ga0466969_0019356 | Ga0466969_0019356_1168_2268 | 306 |
| 163 | 3300047445 | Ga0495677_0011479 | Ga0495677_0011479_222_1325 | 306 |
| 164 | 3300049588 | Ga0501072_0013113 | Ga0501072_0013113_4835_6046 | 306 |
| 165 | 3300049742 | Ga0501080_0008848 | Ga0501080_0008848_1904_3115 | 306 |
| 166 | 3300005328 | Ga0070676_10004000 | Ga0070676_100040004 | 307 |
| 167 | 3300005330 | Ga0070690_100044584 | Ga0070690_1000445842 | 307 |
| 168 | 3300005334 | Ga0068869_100002962 | Ga0068869_1000029624 | 307 |
| 169 | 3300005335 | Ga0070666_10006815 | Ga0070666_100068152 | 307 |
| 170 | 3300005338 | Ga0068868_100005127 | Ga0068868_1000051277 | 307 |
| 171 | 3300005340 | Ga0070689_100151732 | Ga0070689_1001517322 | 307 |
| 172 | 3300005347 | Ga0070668_100007181 | Ga0070668_1000071814 | 307 |
| 173 | 3300005354 | Ga0070675_100011829 | Ga0070675_1000118293 | 307 |
| 174 | 3300005356 | Ga0070674_100034653 | Ga0070674_1000346532 | 307 |
| 175 | 3300005364 | Ga0070673_100011176 | Ga0070673_1000111764 | 307 |
| 176 | 3300005367 | Ga0070667_100002945 | Ga0070667_1000029454 | 307 |
| 177 | 3300005456 | Ga0070678_100014194 | Ga0070678_1000141942 | 307 |
| 178 | 3300005459 | Ga0068867_100003879 | Ga0068867_1000038792 | 307 |
| 179 | 3300005548 | Ga0070665_100007579 | Ga0070665_1000075794 | 307 |
| 180 | 3300005617 | Ga0068859_100023342 | Ga0068859_1000233422 | 307 |
| 181 | 3300005841 | Ga0068863_100020933 | Ga0068863_1000209333 | 307 |
| 182 | 3300005842 | Ga0068858_100035108 | Ga0068858_1000351082 | 307 |
| 183 | 3300005843 | Ga0068860_100035986 | Ga0068860_1000359863 | 307 |
| 184 | 3300006237 | Ga0097621_100009949 | Ga0097621_1000099495 | 307 |
| 185 | 3300006358 | Ga0068871_100018530 | Ga0068871_1000185303 | 307 |
| 186 | 3300006881 | Ga0068865_100001893 | Ga0068865_1000018937 | 307 |
| 187 | 3300006931 | Ga0097620_100023343 | Ga0097620_1000233432 | 307 |
| 188 | 3300009177 | Ga0105248_10004440 | Ga0105248_100044405 | 307 |
| 189 | 3300013297 | Ga0157378_10186954 | Ga0157378_101869542 | 307 |
| 190 | 3300013306 | Ga0163162_10002363 | Ga0163162_100023639 | 307 |
| 191 | 3300014968 | Ga0157379_10009541 | Ga0157379_100095415 | 307 |
| 192 | 3300025315 | Ga0207697_10008404 | Ga0207697_100084043 | 307 |
| 193 | 3300025903 | Ga0207680_10007237 | Ga0207680_100072372 | 307 |
| 194 | 3300025907 | Ga0207645_10000519 | Ga0207645_100005194 | 307 |
| 195 | 3300025923 | Ga0207681_10004557 | Ga0207681_100045576 | 307 |
| 196 | 3300025926 | Ga0207659_10023120 | Ga0207659_100231202 | 307 |
| 197 | 3300025940 | Ga0207691_10002302 | Ga0207691_1000230211 | 307 |
| 198 | 3300025986 | Ga0207658_10005249 | Ga0207658_100052495 | 307 |
| 199 | 3300026023 | Ga0207677_10254324 | Ga0207677_102543242 | 307 |
| 200 | 3300026035 | Ga0207703_10017986 | Ga0207703_100179863 | 307 |
| 201 | 3300026088 | Ga0207641_10026453 | Ga0207641_100264533 | 307 |
| 202 | 3300026089 | Ga0207648_10002591 | Ga0207648_100025916 | 307 |
| 203 | 3300026118 | Ga0207675_100021383 | Ga0207675_1000213832 | 307 |
| 204 | 3300026121 | Ga0207683_10004272 | Ga0207683_100042726 | 307 |
| 205 | 3300028381 | Ga0268264_10028580 | Ga0268264_100285802 | 307 |
| 206 | 3300048911 | Ga0496108_0104093 | Ga0496108_0104093_1056_2261 | 307 |
| 207 | 3300048914 | Ga0496111_0150698 | Ga0496111_0150698_416_1621 | 307 |
| 208 | 3300048917 | Ga0496114_0130635 | Ga0496114_0130635_934_2139 | 307 |
| 209 | 3300050514 | nmdc:mga08x19_52072_c1 | nmdc:mga08x19_52072_c1_1449_2564 | 307 |
| 210 | 3300006846 | Ga0075430_100006367 | Ga0075430_1000063675 | 308 |
| 211 | 3300006847 | Ga0075431_100060609 | Ga0075431_1000606093 | 308 |
| 212 | 3300010375 | Ga0105239_10155381 | Ga0105239_101553812 | 308 |
| 213 | 3300026095 | Ga0207676_10012927 | Ga0207676_100129273 | 308 |
| 214 | 3300035692 | Ga0373935_0050623 | Ga0373935_0050623_755_1894 | 308 |
| 215 | 3300035695 | Ga0373927_0073839 | Ga0373927_0073839_1056_2195 | 308 |
| 216 | 3300036401 | Ga0373937_0060216 | Ga0373937_0060216_565_1704 | 308 |
| 217 | 3300037068 | Ga0373925_0239892 | Ga0373925_0239892_206_1345 | 308 |
| 218 | 3300046455 | Ga0495603_0064435 | Ga0495603_0064435_352_1491 | 308 |
| 219 | 3300046463 | Ga0495653_0107736 | Ga0495653_0107736_757_1896 | 308 |
| 220 | 3300046476 | Ga0495662_0029624 | Ga0495662_0029624_1108_2247 | 308 |
| 221 | 3300046681 | Ga0495647_0007603 | Ga0495647_0007603_2182_3321 | 308 |
| 222 | 3300046683 | Ga0495658_0031146 | Ga0495658_0031146_1070_2209 | 308 |
| 223 | 3300046689 | Ga0495613_0122629 | Ga0495613_0122629_633_1772 | 308 |
| 224 | 3300047315 | Ga0495581_0099802 | Ga0495581_0099802_333_1472 | 308 |
| 225 | 3300047322 | Ga0495680_0028095 | Ga0495680_0028095_2036_3175 | 308 |
| 226 | 3300053085 | Ga0495619_0015242 | Ga0495619_0015242_489_1628 | 308 |
| 227 | 3300005331 | Ga0070670_100043266 | Ga0070670_1000432662 | 309 |
| 228 | 3300005615 | Ga0070702_100003661 | Ga0070702_1000036612 | 309 |
| 229 | 3300005719 | Ga0068861_100146329 | Ga0068861_1001463291 | 309 |
| 230 | 3300006881 | Ga0068865_100181988 | Ga0068865_1001819882 | 309 |
| 231 | 3300014326 | Ga0157380_10021866 | Ga0157380_100218663 | 309 |
| 232 | 3300025925 | Ga0207650_10025907 | Ga0207650_100259073 | 309 |
| 233 | 3300025972 | Ga0207668_10001546 | Ga0207668_100015463 | 309 |
| 234 | 3300026118 | Ga0207675_100150647 | Ga0207675_1001506472 | 309 |
| 235 | 3300028380 | Ga0268265_10173943 | Ga0268265_101739432 | 309 |
| 236 | 3300005347 | Ga0070668_100148703 | Ga0070668_1001487032 | 310 |
| 237 | 3300005539 | Ga0068853_100084918 | Ga0068853_1000849182 | 310 |
| 238 | 3300025940 | Ga0207691_10130706 | Ga0207691_101307062 | 310 |
| 239 | 3300025940 | Ga0207691_10151108 | Ga0207691_101511082 | 310 |
| 240 | 3300049744 | Ga0501083_0003863 | Ga0501083_0003863_1795_3000 | 310 |
| 241 | 3300005328 | Ga0070676_10000977 | Ga0070676_1000097715 | 311 |
| 242 | 3300005333 | Ga0070677_10000299 | Ga0070677_1000029912 | 311 |
| 243 | 3300005334 | Ga0068869_100136116 | Ga0068869_1001361162 | 311 |
| 244 | 3300005335 | Ga0070666_10000561 | Ga0070666_1000056112 | 311 |
| 245 | 3300005338 | Ga0068868_100017422 | Ga0068868_1000174222 | 311 |
| 246 | 3300005347 | Ga0070668_100001025 | Ga0070668_10000102518 | 311 |
| 247 | 3300005353 | Ga0070669_100157836 | Ga0070669_1001578361 | 311 |
| 248 | 3300005354 | Ga0070675_100007361 | Ga0070675_1000073612 | 311 |
| 249 | 3300005356 | Ga0070674_100000659 | Ga0070674_1000006592 | 311 |
| 250 | 3300005364 | Ga0070673_100000471 | Ga0070673_1000004716 | 311 |
| 251 | 3300005455 | Ga0070663_100004712 | Ga0070663_1000047125 | 311 |
| 252 | 3300005456 | Ga0070678_100000836 | Ga0070678_10000083611 | 311 |
| 253 | 3300005548 | Ga0070665_100001592 | Ga0070665_10000159210 | 311 |
| 254 | 3300005616 | Ga0068852_100001928 | Ga0068852_10000192813 | 311 |
| 255 | 3300005618 | Ga0068864_100112518 | Ga0068864_1001125182 | 311 |
| 256 | 3300005834 | Ga0068851_10000721 | Ga0068851_100007214 | 311 |
| 257 | 3300005840 | Ga0068870_10036992 | Ga0068870_100369923 | 311 |
| 258 | 3300006237 | Ga0097621_100009651 | Ga0097621_1000096514 | 311 |
| 259 | 3300006358 | Ga0068871_100008893 | Ga0068871_1000088937 | 311 |
| 260 | 3300006881 | Ga0068865_100159571 | Ga0068865_1001595712 | 311 |
| 261 | 3300007265 | Ga0099794_10107793 | Ga0099794_101077932 | 311 |
| 262 | 3300013102 | Ga0157371_10121250 | Ga0157371_101212502 | 311 |
| 263 | 3300013296 | Ga0157374_10073756 | Ga0157374_100737561 | 311 |
| 264 | 3300025321 | Ga0207656_10007320 | Ga0207656_100073203 | 311 |
| 265 | 3300025893 | Ga0207682_10000082 | Ga0207682_100000822 | 311 |
| 266 | 3300025903 | Ga0207680_10001256 | Ga0207680_100012567 | 311 |
| 267 | 3300025907 | Ga0207645_10001388 | Ga0207645_1000138816 | 311 |
| 268 | 3300025908 | Ga0207643_10038296 | Ga0207643_100382962 | 311 |
| 269 | 3300025923 | Ga0207681_10147826 | Ga0207681_101478262 | 311 |
| 270 | 3300025926 | Ga0207659_10002639 | Ga0207659_100026397 | 311 |
| 271 | 3300025931 | Ga0207644_10001799 | Ga0207644_100017996 | 311 |
| 272 | 3300025937 | Ga0207669_10005613 | Ga0207669_100056133 | 311 |
| 273 | 3300025940 | Ga0207691_10000338 | Ga0207691_1000033836 | 311 |
| 274 | 3300025941 | Ga0207711_10045406 | Ga0207711_100454063 | 311 |
| 275 | 3300025960 | Ga0207651_10001517 | Ga0207651_100015172 | 311 |
| 276 | 3300025972 | Ga0207668_10004344 | Ga0207668_100043444 | 311 |
| 277 | 3300025986 | Ga0207658_10001490 | Ga0207658_100014904 | 311 |
| 278 | 3300026023 | Ga0207677_10001029 | Ga0207677_100010294 | 311 |
| 279 | 3300026067 | Ga0207678_10067069 | Ga0207678_100670692 | 311 |
| 280 | 3300026088 | Ga0207641_10045274 | Ga0207641_100452743 | 311 |
| 281 | 3300026089 | Ga0207648_10019441 | Ga0207648_100194414 | 311 |
| 282 | 3300026095 | Ga0207676_10008460 | Ga0207676_100084605 | 311 |
| 283 | 3300026121 | Ga0207683_10000121 | Ga0207683_1000012142 | 311 |
| 284 | 3300026142 | Ga0207698_10008721 | Ga0207698_100087212 | 311 |
| 285 | 3300028379 | Ga0268266_10003685 | Ga0268266_1000368510 | 311 |
| 286 | 3300048905 | Ga0496102_0206995 | Ga0496102_0206995_24_1133 | 311 |
| 287 | 3300005331 | Ga0070670_100004701 | Ga0070670_1000047018 | 313 |
| 288 | 3300005436 | Ga0070713_100000090 | Ga0070713_10000009041 | 313 |
| 289 | 3300006844 | Ga0075428_100004041 | Ga0075428_1000040412 | 313 |
| 290 | 3300009094 | Ga0111539_10001932 | Ga0111539_100019322 | 313 |
| 291 | 3300013308 | Ga0157375_10010351 | Ga0157375_100103513 | 313 |
| 292 | 3300025928 | Ga0207700_10000065 | Ga0207700_100000656 | 313 |
| 293 | 3300027907 | Ga0207428_10002616 | Ga0207428_1000261616 | 313 |
| 294 | 3300048915 | Ga0496112_0023392 | Ga0496112_0023392_4448_5656 | 313 |
| 295 | 3300050507 | nmdc:mga05p37_248600_c1 | nmdc:mga05p37_248600_c1_470_1519 | 313 |
| 296 | 3300050511 | nmdc:mga08y16_5779_c1 | nmdc:mga08y16_5779_c1_1444_2493 | 313 |
| 297 | 3300005563 | Ga0068855_100243410 | Ga0068855_1002434102 | 315 |
| 298 | 3300025912 | Ga0207707_10283237 | Ga0207707_102832372 | 315 |
| 299 | 3300005328 | Ga0070676_10037330 | Ga0070676_100373303 | 316 |
| 300 | 3300005340 | Ga0070689_100282612 | Ga0070689_1002826121 | 316 |
| 301 | 3300005353 | Ga0070669_100007724 | Ga0070669_1000077244 | 316 |
| 302 | 3300005355 | Ga0070671_100094437 | Ga0070671_1000944371 | 316 |
| 303 | 3300005441 | Ga0070700_100071681 | Ga0070700_1000716811 | 316 |
| 304 | 3300005843 | Ga0068860_100231243 | Ga0068860_1002312431 | 316 |
| 305 | 3300013308 | Ga0157375_10385494 | Ga0157375_103854942 | 316 |
| 306 | 3300025907 | Ga0207645_10046019 | Ga0207645_100460193 | 316 |
| 307 | 3300025923 | Ga0207681_10050090 | Ga0207681_100500901 | 316 |
| 308 | 3300025940 | Ga0207691_10103048 | Ga0207691_101030482 | 316 |
| 309 | 3300025960 | Ga0207651_10020725 | Ga0207651_100207252 | 316 |
| 310 | 3300026089 | Ga0207648_10082246 | Ga0207648_100822462 | 316 |
| 311 | 3300026118 | Ga0207675_100068026 | Ga0207675_1000680262 | 316 |
| 312 | 3300025923 | Ga0207681_10085568 | Ga0207681_100855682 | 317 |
| 313 | 3300028380 | Ga0268265_10089864 | Ga0268265_100898642 | 317 |
| 314 | 3300028381 | Ga0268264_10226897 | Ga0268264_102268972 | 317 |
| 315 | 3300009177 | Ga0105248_10109475 | Ga0105248_101094752 | 318 |
| 316 | 3300025972 | Ga0207668_10002871 | Ga0207668_100028711 | 318 |
| 317 | 3300032002 | Ga0307416_100029161 | Ga0307416_1000291613 | 318 |
| 318 | 3300042876 | Ga0451577_0174756 | Ga0451577_0174756_431_1516 | 318 |
| 319 | 3300048908 | Ga0496105_0191739 | Ga0496105_0191739_244_1497 | 318 |
| 320 | 3300005335 | Ga0070666_10002728 | Ga0070666_100027284 | 319 |
| 321 | 3300005338 | Ga0068868_100005492 | Ga0068868_1000054924 | 319 |
| 322 | 3300005355 | Ga0070671_100010477 | Ga0070671_1000104774 | 319 |
| 323 | 3300005364 | Ga0070673_100000093 | Ga0070673_10000009319 | 319 |
| 324 | 3300005365 | Ga0070688_100000489 | Ga0070688_1000004892 | 319 |
| 325 | 3300005367 | Ga0070667_100009474 | Ga0070667_1000094742 | 319 |
| 326 | 3300005439 | Ga0070711_100001719 | Ga0070711_1000017198 | 319 |
| 327 | 3300005466 | Ga0070685_10005415 | Ga0070685_100054154 | 319 |
| 328 | 3300005548 | Ga0070665_100019006 | Ga0070665_1000190062 | 319 |
| 329 | 3300005614 | Ga0068856_100105783 | Ga0068856_1001057832 | 319 |
| 330 | 3300005616 | Ga0068852_100207325 | Ga0068852_1002073252 | 319 |
| 331 | 3300005617 | Ga0068859_100002390 | Ga0068859_1000023909 | 319 |
| 332 | 3300005840 | Ga0068870_10053644 | Ga0068870_100536442 | 319 |
| 333 | 3300005841 | Ga0068863_100001612 | Ga0068863_10000161217 | 319 |
| 334 | 3300005842 | Ga0068858_100003887 | Ga0068858_1000038875 | 319 |
| 335 | 3300005843 | Ga0068860_100034774 | Ga0068860_1000347742 | 319 |
| 336 | 3300006163 | Ga0070715_10007587 | Ga0070715_100075873 | 319 |
| 337 | 3300006175 | Ga0070712_100000497 | Ga0070712_1000004979 | 319 |
| 338 | 3300006237 | Ga0097621_100036849 | Ga0097621_1000368492 | 319 |
| 339 | 3300006931 | Ga0097620_100002390 | Ga0097620_1000023906 | 319 |
| 340 | 3300007076 | Ga0075435_100062384 | Ga0075435_1000623843 | 319 |
| 341 | 3300009098 | Ga0105245_10016920 | Ga0105245_100169204 | 319 |
| 342 | 3300009177 | Ga0105248_10040025 | Ga0105248_100400253 | 319 |
| 343 | 3300009545 | Ga0105237_10116038 | Ga0105237_101160382 | 319 |
| 344 | 3300013296 | Ga0157374_10000101 | Ga0157374_1000010153 | 319 |
| 345 | 3300013306 | Ga0163162_10040015 | Ga0163162_100400154 | 319 |
| 346 | 3300013308 | Ga0157375_10004313 | Ga0157375_1000431310 | 319 |
| 347 | 3300013308 | Ga0157375_10008181 | Ga0157375_100081814 | 319 |
| 348 | 3300014325 | Ga0163163_10003259 | Ga0163163_100032594 | 319 |
| 349 | 3300014969 | Ga0157376_10048337 | Ga0157376_100483372 | 319 |
| 350 | 3300017792 | Ga0163161_10051198 | Ga0163161_100511982 | 319 |
| 351 | 3300025903 | Ga0207680_10017438 | Ga0207680_100174383 | 319 |
| 352 | 3300025908 | Ga0207643_10070704 | Ga0207643_100707042 | 319 |
| 353 | 3300025915 | Ga0207693_10000069 | Ga0207693_1000006937 | 319 |
| 354 | 3300025916 | Ga0207663_10002011 | Ga0207663_100020113 | 319 |
| 355 | 3300025925 | Ga0207650_10107076 | Ga0207650_101070762 | 319 |
| 356 | 3300025927 | Ga0207687_10000293 | Ga0207687_100002934 | 319 |
| 357 | 3300025928 | Ga0207700_10063430 | Ga0207700_100634302 | 319 |
| 358 | 3300025940 | Ga0207691_10001034 | Ga0207691_1000103412 | 319 |
| 359 | 3300025941 | Ga0207711_10000164 | Ga0207711_1000016447 | 319 |
| 360 | 3300025942 | Ga0207689_10023939 | Ga0207689_100239393 | 319 |
| 361 | 3300025960 | Ga0207651_10000934 | Ga0207651_100009349 | 319 |
| 362 | 3300026023 | Ga0207677_10000092 | Ga0207677_1000009223 | 319 |
| 363 | 3300026035 | Ga0207703_10000506 | Ga0207703_1000050617 | 319 |
| 364 | 3300026078 | Ga0207702_10155438 | Ga0207702_101554382 | 319 |
| 365 | 3300026088 | Ga0207641_10022936 | Ga0207641_100229362 | 319 |
| 366 | 3300026095 | Ga0207676_10003075 | Ga0207676_100030758 | 319 |
| 367 | 3300026142 | Ga0207698_10088645 | Ga0207698_100886452 | 319 |
| 368 | 3300028379 | Ga0268266_10007213 | Ga0268266_100072134 | 319 |
| 369 | 3300035086 | Ga0373934_0013807 | Ga0373934_0013807_1125_2267 | 319 |
| 370 | 3300035111 | Ga0373923_0003720 | Ga0373923_0003720_2088_3230 | 319 |
| 371 | 3300035118 | Ga0373954_0004105 | Ga0373954_0004105_1705_2847 | 319 |
| 372 | 3300035119 | Ga0373956_0006971 | Ga0373956_0006971_2007_3149 | 319 |
| 373 | 3300035170 | Ga0373943_0024069 | Ga0373943_0024069_282_1424 | 319 |
| 374 | 3300035172 | Ga0373955_0019234 | Ga0373955_0019234_601_1743 | 319 |
| 375 | 3300035410 | Ga0373924_0048956 | Ga0373924_0048956_280_1422 | 319 |
| 376 | 3300035724 | Ga0373933_0010830 | Ga0373933_0010830_2741_3883 | 319 |
| 377 | 3300036401 | Ga0373937_0039305 | Ga0373937_0039305_616_1758 | 319 |
| 378 | 3300046516 | Ga0495628_0103627 | Ga0495628_0103627_555_1697 | 319 |
| 379 | 3300048904 | Ga0496101_0081300 | Ga0496101_0081300_319_1461 | 319 |
| 380 | 3300048907 | Ga0496104_0000858 | Ga0496104_0000858_7502_8644 | 319 |
| 381 | 3300048915 | Ga0496112_0001078 | Ga0496112_0001078_11389_12531 | 319 |
| 382 | 3300005618 | Ga0068864_100005508 | Ga0068864_1000055089 | 320 |
| 383 | 3300005841 | Ga0068863_100015142 | Ga0068863_1000151426 | 320 |
| 384 | 3300014325 | Ga0163163_10036264 | Ga0163163_100362644 | 320 |
| 385 | 3300026088 | Ga0207641_10043769 | Ga0207641_100437693 | 320 |
| 386 | 3300048915 | Ga0496112_0233408 | Ga0496112_0233408_212_1426 | 320 |
| 387 | 3300025960 | Ga0207651_10327231 | Ga0207651_103272311 | 321 |
| 388 | 3300027471 | Ga0209995_1004473 | Ga0209995_10044732 | 322 |
| 389 | 3300027876 | Ga0209974_10000048 | Ga0209974_1000004821 | 322 |
| 390 | 3300005367 | Ga0070667_100136411 | Ga0070667_1001364112 | 323 |
| 391 | 3300006844 | Ga0075428_100078585 | Ga0075428_1000785852 | 323 |
| 392 | 3300025972 | Ga0207668_10148058 | Ga0207668_101480581 | 323 |
| 393 | 3300025972 | Ga0207668_10345220 | Ga0207668_103452201 | 323 |
| 394 | 3300027665 | Ga0209983_1012042 | Ga0209983_10120422 | 323 |
| 395 | 3300005435 | Ga0070714_100014686 | Ga0070714_1000146864 | 324 |
| 396 | 3300005563 | Ga0068855_100048112 | Ga0068855_1000481124 | 324 |
| 397 | 3300013307 | Ga0157372_10026658 | Ga0157372_100266585 | 324 |
| 398 | 3300025929 | Ga0207664_10015140 | Ga0207664_100151405 | 324 |
| 399 | 3300025949 | Ga0207667_10059754 | Ga0207667_100597543 | 324 |
| 400 | 3300005616 | Ga0068852_100001437 | Ga0068852_1000014377 | 326 |
| 401 | 3300009093 | Ga0105240_10002849 | Ga0105240_1000284920 | 326 |
| 402 | 3300009551 | Ga0105238_10012690 | Ga0105238_100126903 | 326 |
| 403 | 3300005327 | Ga0070658_10103060 | Ga0070658_101030602 | 327 |
| 404 | 3300005344 | Ga0070661_100004134 | Ga0070661_1000041342 | 327 |
| 405 | 3300005458 | Ga0070681_10120183 | Ga0070681_101201832 | 327 |
| 406 | 3300005535 | Ga0070684_100341377 | Ga0070684_1003413771 | 327 |
| 407 | 3300005563 | Ga0068855_100048585 | Ga0068855_1000485852 | 327 |
| 408 | 3300005564 | Ga0070664_100000805 | Ga0070664_1000008053 | 327 |
| 409 | 3300005577 | Ga0068857_100006967 | Ga0068857_1000069673 | 327 |
| 410 | 3300005578 | Ga0068854_100149648 | Ga0068854_1001496482 | 327 |
| 411 | 3300005614 | Ga0068856_100033808 | Ga0068856_1000338083 | 327 |
| 412 | 3300005841 | Ga0068863_100209169 | Ga0068863_1002091692 | 327 |
| 413 | 3300013100 | Ga0157373_10084061 | Ga0157373_100840612 | 327 |
| 414 | 3300013105 | Ga0157369_10013259 | Ga0157369_100132593 | 327 |
| 415 | 3300013306 | Ga0163162_10164743 | Ga0163162_101647432 | 327 |
| 416 | 3300013307 | Ga0157372_10004276 | Ga0157372_100042767 | 327 |
| 417 | 3300025909 | Ga0207705_10061025 | Ga0207705_100610252 | 327 |
| 418 | 3300025912 | Ga0207707_10103030 | Ga0207707_101030302 | 327 |
| 419 | 3300025913 | Ga0207695_10018798 | Ga0207695_100187986 | 327 |
| 420 | 3300025920 | Ga0207649_10019843 | Ga0207649_100198433 | 327 |
| 421 | 3300025924 | Ga0207694_10006690 | Ga0207694_100066907 | 327 |
| 422 | 3300025944 | Ga0207661_10025560 | Ga0207661_100255603 | 327 |
| 423 | 3300025945 | Ga0207679_10003134 | Ga0207679_100031343 | 327 |
| 424 | 3300025949 | Ga0207667_10014791 | Ga0207667_100147913 | 327 |
| 425 | 3300025981 | Ga0207640_10055673 | Ga0207640_100556732 | 327 |
| 426 | 3300026078 | Ga0207702_10031606 | Ga0207702_100316063 | 327 |
| 427 | 3300026116 | Ga0207674_10001745 | Ga0207674_1000174513 | 327 |
| 428 | 3300031250 | Ga0265331_10001011 | Ga0265331_1000101111 | 327 |
| 429 | 3300037068 | Ga0373925_0007825 | Ga0373925_0007825_3402_4544 | 327 |
| 430 | 3300048915 | Ga0496112_0252901 | Ga0496112_0252901_375_1580 | 327 |
| 431 | 3300005344 | Ga0070661_100010870 | Ga0070661_1000108704 | 328 |
| 432 | 3300005458 | Ga0070681_10012004 | Ga0070681_100120048 | 328 |
| 433 | 3300005539 | Ga0068853_100021430 | Ga0068853_1000214304 | 328 |
| 434 | 3300013104 | Ga0157370_10109488 | Ga0157370_101094882 | 328 |
| 435 | 3300013307 | Ga0157372_10197243 | Ga0157372_101972432 | 328 |
| 436 | 3300025920 | Ga0207649_10025075 | Ga0207649_100250752 | 328 |
| 437 | 3300026041 | Ga0207639_10292323 | Ga0207639_102923232 | 328 |
| 438 | 3300028381 | Ga0268264_10049994 | Ga0268264_100499942 | 328 |
| 439 | 3300005340 | Ga0070689_100138055 | Ga0070689_1001380552 | 329 |
| 440 | 3300005563 | Ga0068855_100144798 | Ga0068855_1001447983 | 329 |
| 441 | 3300005843 | Ga0068860_100034735 | Ga0068860_1000347352 | 329 |
| 442 | 3300005844 | Ga0068862_100047313 | Ga0068862_1000473132 | 329 |
| 443 | 3300028380 | Ga0268265_10036186 | Ga0268265_100361863 | 329 |
| 444 | 3300005548 | Ga0070665_100029957 | Ga0070665_1000299572 | 330 |
| 445 | 3300005618 | Ga0068864_100218800 | Ga0068864_1002188001 | 330 |
| 446 | 3300006871 | Ga0075434_100146138 | Ga0075434_1001461382 | 330 |
| 447 | 3300005355 | Ga0070671_100127855 | Ga0070671_1001278552 | 331 |
| 448 | 3300005841 | Ga0068863_100050231 | Ga0068863_1000502312 | 331 |
| 449 | 3300005843 | Ga0068860_100134945 | Ga0068860_1001349452 | 331 |
| 450 | 3300025931 | Ga0207644_10237375 | Ga0207644_102373752 | 331 |
| 451 | 3300005355 | Ga0070671_100011336 | Ga0070671_1000113364 | 333 |
| 452 | 3300005842 | Ga0068858_100205175 | Ga0068858_1002051752 | 333 |
| 453 | 3300009177 | Ga0105248_10017427 | Ga0105248_100174272 | 333 |
| 454 | 3300013308 | Ga0157375_10048440 | Ga0157375_100484403 | 333 |
| 455 | 3300025923 | Ga0207681_10048105 | Ga0207681_100481052 | 333 |
| 456 | 3300025931 | Ga0207644_10029072 | Ga0207644_100290722 | 333 |
| 457 | 3300025941 | Ga0207711_10002873 | Ga0207711_100028739 | 333 |
| 458 | 3300025986 | Ga0207658_10161322 | Ga0207658_101613221 | 333 |
| 459 | 3300026035 | Ga0207703_10177186 | Ga0207703_101771861 | 333 |
| 460 | 3300031852 | Ga0307410_10019546 | Ga0307410_100195462 | 333 |
| 461 | 3300005347 | Ga0070668_100033495 | Ga0070668_1000334953 | 334 |
| 462 | 3300005367 | Ga0070667_100004079 | Ga0070667_1000040792 | 334 |
| 463 | 3300005455 | Ga0070663_100137298 | Ga0070663_1001372981 | 334 |
| 464 | 3300005459 | Ga0068867_100006608 | Ga0068867_1000066082 | 334 |
| 465 | 3300005617 | Ga0068859_100004790 | Ga0068859_10000479012 | 334 |
| 466 | 3300005618 | Ga0068864_100001045 | Ga0068864_10000104516 | 334 |
| 467 | 3300005719 | Ga0068861_100000716 | Ga0068861_1000007166 | 334 |
| 468 | 3300005841 | Ga0068863_100003250 | Ga0068863_1000032502 | 334 |
| 469 | 3300005842 | Ga0068858_100005326 | Ga0068858_1000053262 | 334 |
| 470 | 3300005843 | Ga0068860_100003693 | Ga0068860_1000036938 | 334 |
| 471 | 3300005844 | Ga0068862_100005308 | Ga0068862_10000530810 | 334 |
| 472 | 3300006931 | Ga0097620_100004790 | Ga0097620_1000047902 | 334 |
| 473 | 3300025940 | Ga0207691_10073262 | Ga0207691_100732622 | 334 |
| 474 | 3300025941 | Ga0207711_10016997 | Ga0207711_100169975 | 334 |
| 475 | 3300025942 | Ga0207689_10000889 | Ga0207689_1000088917 | 334 |
| 476 | 3300025972 | Ga0207668_10050299 | Ga0207668_100502993 | 334 |
| 477 | 3300026088 | Ga0207641_10030082 | Ga0207641_100300822 | 334 |
| 478 | 3300026089 | Ga0207648_10002230 | Ga0207648_100022308 | 334 |
| 479 | 3300026116 | Ga0207674_10021384 | Ga0207674_100213842 | 334 |
| 480 | 3300026118 | Ga0207675_100000855 | Ga0207675_10000085516 | 334 |
| 481 | 3300028381 | Ga0268264_10003879 | Ga0268264_100038793 | 334 |
| 482 | 3300026088 | Ga0207641_10208651 | Ga0207641_102086512 | 335 |
| 483 | 3300005331 | Ga0070670_100097972 | Ga0070670_1000979722 | 338 |
| 484 | 3300005334 | Ga0068869_100030564 | Ga0068869_1000305642 | 338 |
| 485 | 3300005356 | Ga0070674_100106213 | Ga0070674_1001062132 | 338 |
| 486 | 3300005577 | Ga0068857_100089144 | Ga0068857_1000891442 | 338 |
| 487 | 3300013297 | Ga0157378_10062638 | Ga0157378_100626383 | 338 |
| 488 | 3300014968 | Ga0157379_10185247 | Ga0157379_101852472 | 338 |
| 489 | 3300025925 | Ga0207650_10108935 | Ga0207650_101089352 | 338 |
| 490 | 3300025960 | Ga0207651_10035742 | Ga0207651_100357421 | 338 |
| 491 | 3300026095 | Ga0207676_10296485 | Ga0207676_102964851 | 338 |
| 492 | 3300028380 | Ga0268265_10019252 | Ga0268265_100192524 | 338 |
| 493 | 3300048905 | Ga0496102_0030829 | Ga0496102_0030829_2746_4035 | 338 |
| 494 | 3300048913 | Ga0496110_0275162 | Ga0496110_0275162_230_1519 | 338 |
| 495 | 3300005344 | Ga0070661_100024446 | Ga0070661_1000244463 | 339 |
| 496 | 3300005530 | Ga0070679_100021405 | Ga0070679_1000214052 | 339 |
| 497 | 3300005564 | Ga0070664_100054705 | Ga0070664_1000547052 | 339 |
| 498 | 3300025911 | Ga0207654_10013143 | Ga0207654_100131432 | 339 |
| 499 | 3300025912 | Ga0207707_10004960 | Ga0207707_100049606 | 339 |
| 500 | 3300026142 | Ga0207698_10009730 | Ga0207698_100097302 | 339 |
| 501 | 3300005330 | Ga0070690_100022040 | Ga0070690_1000220403 | 340 |
| 502 | 3300005331 | Ga0070670_100041841 | Ga0070670_1000418412 | 340 |
| 503 | 3300005334 | Ga0068869_100010531 | Ga0068869_1000105314 | 340 |
| 504 | 3300005340 | Ga0070689_100048443 | Ga0070689_1000484432 | 340 |
| 505 | 3300005365 | Ga0070688_100120809 | Ga0070688_1001208092 | 340 |
| 506 | 3300005440 | Ga0070705_100013431 | Ga0070705_1000134312 | 340 |
| 507 | 3300005445 | Ga0070708_100008392 | Ga0070708_1000083924 | 340 |
| 508 | 3300005456 | Ga0070678_100018213 | Ga0070678_1000182132 | 340 |
| 509 | 3300005459 | Ga0068867_100011329 | Ga0068867_1000113292 | 340 |
| 510 | 3300005543 | Ga0070672_100006613 | Ga0070672_1000066134 | 340 |
| 511 | 3300005618 | Ga0068864_100059725 | Ga0068864_1000597252 | 340 |
| 512 | 3300005718 | Ga0068866_10015918 | Ga0068866_100159182 | 340 |
| 513 | 3300005719 | Ga0068861_100045641 | Ga0068861_1000456413 | 340 |
| 514 | 3300005840 | Ga0068870_10116918 | Ga0068870_101169182 | 340 |
| 515 | 3300005841 | Ga0068863_100131623 | Ga0068863_1001316232 | 340 |
| 516 | 3300005842 | Ga0068858_100085482 | Ga0068858_1000854822 | 340 |
| 517 | 3300005843 | Ga0068860_100108330 | Ga0068860_1001083302 | 340 |
| 518 | 3300005844 | Ga0068862_100127085 | Ga0068862_1001270852 | 340 |
| 519 | 3300006237 | Ga0097621_100078593 | Ga0097621_1000785932 | 340 |
| 520 | 3300006358 | Ga0068871_100033495 | Ga0068871_1000334953 | 340 |
| 521 | 3300009148 | Ga0105243_10037207 | Ga0105243_100372072 | 340 |
| 522 | 3300009176 | Ga0105242_10012394 | Ga0105242_100123942 | 340 |
| 523 | 3300013104 | Ga0157370_10015916 | Ga0157370_100159162 | 340 |
| 524 | 3300013306 | Ga0163162_10165240 | Ga0163162_101652402 | 340 |
| 525 | 3300014969 | Ga0157376_10067580 | Ga0157376_100675802 | 340 |
| 526 | 3300025901 | Ga0207688_10117544 | Ga0207688_101175442 | 340 |
| 527 | 3300025908 | Ga0207643_10034477 | Ga0207643_100344772 | 340 |
| 528 | 3300025918 | Ga0207662_10089507 | Ga0207662_100895072 | 340 |
| 529 | 3300025923 | Ga0207681_10131783 | Ga0207681_101317832 | 340 |
| 530 | 3300025925 | Ga0207650_10055270 | Ga0207650_100552702 | 340 |
| 531 | 3300025942 | Ga0207689_10004297 | Ga0207689_100042974 | 340 |
| 532 | 3300025960 | Ga0207651_10149365 | Ga0207651_101493652 | 340 |
| 533 | 3300026035 | Ga0207703_10038736 | Ga0207703_100387363 | 340 |
| 534 | 3300026089 | Ga0207648_10007295 | Ga0207648_100072957 | 340 |
| 535 | 3300026118 | Ga0207675_100071099 | Ga0207675_1000710992 | 340 |
| 536 | 3300028380 | Ga0268265_10016033 | Ga0268265_100160333 | 340 |
| 537 | 3300037418 | Ga0395900_0034857 | Ga0395900_0034857_2690_3904 | 341 |
| 538 | 3300038443 | Ga0395901_0012426 | Ga0395901_0012426_6532_7746 | 341 |
| 539 | 3300013307 | Ga0157372_10286715 | Ga0157372_102867152 | 344 |
| 540 | 3300028381 | Ga0268264_10044409 | Ga0268264_100444092 | 344 |
| 541 | 3300046539 | Ga0495621_0032382 | Ga0495621_0032382_271_1461 | 344 |
| 542 | 3300050512 | nmdc:mga0n895_131509_c1 | nmdc:mga0n895_131509_c1_851_2059 | 344 |
| 543 | 3300006358 | Ga0068871_100056150 | Ga0068871_1000561502 | 345 |
| 544 | 3300014968 | Ga0157379_10074558 | Ga0157379_100745582 | 345 |
| 545 | 3300025899 | Ga0207642_10011624 | Ga0207642_100116242 | 345 |
| 546 | 3300026067 | Ga0207678_10020795 | Ga0207678_100207954 | 345 |
| 547 | 3300026089 | Ga0207648_10004777 | Ga0207648_100047777 | 345 |
| 548 | 3300005535 | Ga0070684_100000644 | Ga0070684_10000064415 | 346 |
| 549 | 3300005539 | Ga0068853_100006389 | Ga0068853_1000063892 | 346 |
| 550 | 3300005564 | Ga0070664_100073844 | Ga0070664_1000738442 | 346 |
| 551 | 3300005614 | Ga0068856_100297650 | Ga0068856_1002976502 | 346 |
| 552 | 3300013105 | Ga0157369_10288852 | Ga0157369_102888522 | 346 |
| 553 | 3300025913 | Ga0207695_10021329 | Ga0207695_100213292 | 346 |
| 554 | 3300025916 | Ga0207663_10141440 | Ga0207663_101414402 | 346 |
| 555 | 3300025917 | Ga0207660_10003678 | Ga0207660_100036786 | 346 |
| 556 | 3300025919 | Ga0207657_10000229 | Ga0207657_1000022950 | 346 |
| 557 | 3300025920 | Ga0207649_10042577 | Ga0207649_100425772 | 346 |
| 558 | 3300025921 | Ga0207652_10029496 | Ga0207652_100294963 | 346 |
| 559 | 3300025924 | Ga0207694_10004898 | Ga0207694_100048982 | 346 |
| 560 | 3300025944 | Ga0207661_10026906 | Ga0207661_100269062 | 346 |
| 561 | 3300025949 | Ga0207667_10003521 | Ga0207667_1000352113 | 346 |
| 562 | 3300025960 | Ga0207651_10026244 | Ga0207651_100262443 | 346 |
| 563 | 3300026067 | Ga0207678_10005717 | Ga0207678_100057176 | 346 |
| 564 | 3300031901 | Ga0307406_10133797 | Ga0307406_101337972 | 346 |
| 565 | 3300031995 | Ga0307409_100014397 | Ga0307409_1000143972 | 346 |
| 566 | 3300032002 | Ga0307416_100298109 | Ga0307416_1002981092 | 346 |
| 567 | 3300037418 | Ga0395900_0137950 | Ga0395900_0137950_38_1264 | 346 |
| 568 | 3300005327 | Ga0070658_10007612 | Ga0070658_100076127 | 347 |
| 569 | 3300005614 | Ga0068856_100080716 | Ga0068856_1000807163 | 347 |
| 570 | 3300009093 | Ga0105240_10050674 | Ga0105240_100506743 | 347 |
| 571 | 3300009174 | Ga0105241_10010305 | Ga0105241_100103053 | 347 |
| 572 | 3300025945 | Ga0207679_10170052 | Ga0207679_101700521 | 347 |
| 573 | 3300025949 | Ga0207667_10172981 | Ga0207667_101729812 | 347 |
| 574 | 3300026116 | Ga0207674_10000225 | Ga0207674_1000022529 | 347 |
| 575 | 3300005437 | Ga0070710_10016487 | Ga0070710_100164871 | 348 |
| 576 | 3300005563 | Ga0068855_100019498 | Ga0068855_1000194987 | 348 |
| 577 | 3300005563 | Ga0068855_100038671 | Ga0068855_1000386714 | 348 |
| 578 | 3300005577 | Ga0068857_100146202 | Ga0068857_1001462022 | 348 |
| 579 | 3300006914 | Ga0075436_100065149 | Ga0075436_1000651492 | 348 |
| 580 | 3300009545 | Ga0105237_10107208 | Ga0105237_101072082 | 348 |
| 581 | 3300013104 | Ga0157370_10056881 | Ga0157370_100568812 | 348 |
| 582 | 3300013307 | Ga0157372_10074577 | Ga0157372_100745771 | 348 |
| 583 | 3300025906 | Ga0207699_10033923 | Ga0207699_100339232 | 348 |
| 584 | 3300025914 | Ga0207671_10032024 | Ga0207671_100320242 | 348 |
| 585 | 3300025919 | Ga0207657_10073335 | Ga0207657_100733353 | 348 |
| 586 | 3300025949 | Ga0207667_10016547 | Ga0207667_100165474 | 348 |
| 587 | 3300026116 | Ga0207674_10105142 | Ga0207674_101051422 | 348 |
| 588 | 3300027682 | Ga0209971_1011786 | Ga0209971_10117862 | 348 |
| 589 | 3300046472 | Ga0495580_0143767 | Ga0495580_0143767_69_1268 | 348 |
| 590 | 3300005518 | Ga0070699_100248580 | Ga0070699_1002485802 | 349 |
| 591 | 3300005546 | Ga0070696_100048476 | Ga0070696_1000484763 | 349 |
| 592 | 3300010375 | Ga0105239_10242681 | Ga0105239_102426812 | 349 |
| 593 | 3300035724 | Ga0373933_0057327 | Ga0373933_0057327_895_2094 | 350 |
| 594 | 3300005327 | Ga0070658_10113961 | Ga0070658_101139612 | 351 |
| 595 | 3300005616 | Ga0068852_100010177 | Ga0068852_1000101775 | 351 |
| 596 | 3300025321 | Ga0207656_10007695 | Ga0207656_100076953 | 351 |
| 597 | 3300025920 | Ga0207649_10005226 | Ga0207649_100052262 | 351 |
| 598 | 3300026142 | Ga0207698_10066446 | Ga0207698_100664463 | 351 |
| 599 | 3300046459 | Ga0495629_0073197 | Ga0495629_0073197_644_1843 | 351 |
| 600 | 3300005328 | Ga0070676_10003806 | Ga0070676_100038063 | 352 |
| 601 | 3300005339 | Ga0070660_100000928 | Ga0070660_1000009284 | 352 |
| 602 | 3300005344 | Ga0070661_100000654 | Ga0070661_10000065419 | 352 |
| 603 | 3300005345 | Ga0070692_10123067 | Ga0070692_101230671 | 352 |
| 604 | 3300005355 | Ga0070671_100005765 | Ga0070671_1000057653 | 352 |
| 605 | 3300005364 | Ga0070673_100014836 | Ga0070673_1000148362 | 352 |
| 606 | 3300005366 | Ga0070659_100006152 | Ga0070659_1000061524 | 352 |
| 607 | 3300005457 | Ga0070662_100000211 | Ga0070662_10000021131 | 352 |
| 608 | 3300005539 | Ga0068853_100051635 | Ga0068853_1000516353 | 352 |
| 609 | 3300005543 | Ga0070672_100150503 | Ga0070672_1001505032 | 352 |
| 610 | 3300005563 | Ga0068855_100006495 | Ga0068855_1000064954 | 352 |
| 611 | 3300005564 | Ga0070664_100000511 | Ga0070664_1000005112 | 352 |
| 612 | 3300005614 | Ga0068856_100002324 | Ga0068856_10000232416 | 352 |
| 613 | 3300013100 | Ga0157373_10009720 | Ga0157373_100097202 | 352 |
| 614 | 3300013102 | Ga0157371_10000446 | Ga0157371_1000044647 | 352 |
| 615 | 3300013105 | Ga0157369_10124451 | Ga0157369_101244512 | 352 |
| 616 | 3300013307 | Ga0157372_10000523 | Ga0157372_100005233 | 352 |
| 617 | 3300025907 | Ga0207645_10007446 | Ga0207645_100074463 | 352 |
| 618 | 3300025919 | Ga0207657_10000901 | Ga0207657_1000090110 | 352 |
| 619 | 3300025920 | Ga0207649_10009435 | Ga0207649_100094354 | 352 |
| 620 | 3300025931 | Ga0207644_10006359 | Ga0207644_100063593 | 352 |
| 621 | 3300025932 | Ga0207690_10006829 | Ga0207690_100068292 | 352 |
| 622 | 3300025933 | Ga0207706_10000045 | Ga0207706_1000004594 | 352 |
| 623 | 3300025940 | Ga0207691_10052037 | Ga0207691_100520373 | 352 |
| 624 | 3300025945 | Ga0207679_10013489 | Ga0207679_100134892 | 352 |
| 625 | 3300025949 | Ga0207667_10002323 | Ga0207667_1000232319 | 352 |
| 626 | 3300026041 | Ga0207639_10030344 | Ga0207639_100303442 | 352 |
| 627 | 3300026067 | Ga0207678_10038495 | Ga0207678_100384952 | 352 |
| 628 | 3300026078 | Ga0207702_10004090 | Ga0207702_100040904 | 352 |
| 629 | 3300048909 | Ga0496106_0008041 | Ga0496106_0008041_1003_2235 | 352 |
| 630 | 3300005339 | Ga0070660_100048288 | Ga0070660_1000482883 | 354 |
| 631 | 3300025960 | Ga0207651_10033917 | Ga0207651_100339173 | 354 |
| 632 | 3300035119 | Ga0373956_0054177 | Ga0373956_0054177_314_1513 | 355 |
| 633 | 3300005336 | Ga0070680_100094648 | Ga0070680_1000946482 | 356 |
| 634 | 3300005614 | Ga0068856_100026012 | Ga0068856_1000260126 | 356 |
| 635 | 3300013104 | Ga0157370_10080301 | Ga0157370_100803012 | 356 |
| 636 | 3300013104 | Ga0157370_10087723 | Ga0157370_100877232 | 356 |
| 637 | 3300025917 | Ga0207660_10123181 | Ga0207660_101231812 | 356 |
| 638 | 3300026078 | Ga0207702_10011074 | Ga0207702_100110745 | 356 |
| 639 | 3300005365 | Ga0070688_100004308 | Ga0070688_1000043084 | 357 |
| 640 | 3300005457 | Ga0070662_100038681 | Ga0070662_1000386812 | 357 |
| 641 | 3300005458 | Ga0070681_10212027 | Ga0070681_102120272 | 357 |
| 642 | 3300005530 | Ga0070679_100060269 | Ga0070679_1000602693 | 357 |
| 643 | 3300005719 | Ga0068861_100007083 | Ga0068861_1000070832 | 357 |
| 644 | 3300013307 | Ga0157372_10102496 | Ga0157372_101024962 | 357 |
| 645 | 3300025912 | Ga0207707_10060664 | Ga0207707_100606642 | 357 |
| 646 | 3300001991 | JGI24743J22301_10001094 | JGI24743J22301_100010942 | 358 |
| 647 | 3300005327 | Ga0070658_10189575 | Ga0070658_101895752 | 358 |
| 648 | 3300005333 | Ga0070677_10000465 | Ga0070677_100004654 | 358 |
| 649 | 3300005334 | Ga0068869_100021406 | Ga0068869_1000214062 | 358 |
| 650 | 3300005339 | Ga0070660_100065441 | Ga0070660_1000654412 | 358 |
| 651 | 3300005343 | Ga0070687_100015593 | Ga0070687_1000155932 | 358 |
| 652 | 3300005366 | Ga0070659_100055875 | Ga0070659_1000558753 | 358 |
| 653 | 3300005455 | Ga0070663_100020273 | Ga0070663_1000202732 | 358 |
| 654 | 3300005466 | Ga0070685_10014295 | Ga0070685_100142953 | 358 |
| 655 | 3300005539 | Ga0068853_100024169 | Ga0068853_1000241692 | 358 |
| 656 | 3300005544 | Ga0070686_100006716 | Ga0070686_1000067164 | 358 |
| 657 | 3300005577 | Ga0068857_100255390 | Ga0068857_1002553902 | 358 |
| 658 | 3300005618 | Ga0068864_100074624 | Ga0068864_1000746243 | 358 |
| 659 | 3300005718 | Ga0068866_10003584 | Ga0068866_100035841 | 358 |
| 660 | 3300005834 | Ga0068851_10008426 | Ga0068851_100084263 | 358 |
| 661 | 3300005840 | Ga0068870_10003956 | Ga0068870_100039564 | 358 |
| 662 | 3300005841 | Ga0068863_100005268 | Ga0068863_1000052689 | 358 |
| 663 | 3300005842 | Ga0068858_100052595 | Ga0068858_1000525952 | 358 |
| 664 | 3300005843 | Ga0068860_100019364 | Ga0068860_1000193644 | 358 |
| 665 | 3300006358 | Ga0068871_100117797 | Ga0068871_1001177972 | 358 |
| 666 | 3300006881 | Ga0068865_100078760 | Ga0068865_1000787602 | 358 |
| 667 | 3300009148 | Ga0105243_10145491 | Ga0105243_101454912 | 358 |
| 668 | 3300009177 | Ga0105248_10074239 | Ga0105248_100742392 | 358 |
| 669 | 3300014325 | Ga0163163_10096073 | Ga0163163_100960732 | 358 |
| 670 | 3300014968 | Ga0157379_10016518 | Ga0157379_100165183 | 358 |
| 671 | 3300014969 | Ga0157376_10058553 | Ga0157376_100585532 | 358 |
| 672 | 3300017792 | Ga0163161_10008051 | Ga0163161_100080514 | 358 |
| 673 | 3300025315 | Ga0207697_10007842 | Ga0207697_100078423 | 358 |
| 674 | 3300025321 | Ga0207656_10009625 | Ga0207656_100096252 | 358 |
| 675 | 3300025893 | Ga0207682_10006659 | Ga0207682_100066592 | 358 |
| 676 | 3300025899 | Ga0207642_10030019 | Ga0207642_100300192 | 358 |
| 677 | 3300025901 | Ga0207688_10028403 | Ga0207688_100284032 | 358 |
| 678 | 3300025904 | Ga0207647_10051155 | Ga0207647_100511551 | 358 |
| 679 | 3300025908 | Ga0207643_10004535 | Ga0207643_100045354 | 358 |
| 680 | 3300025919 | Ga0207657_10052292 | Ga0207657_100522922 | 358 |
| 681 | 3300025920 | Ga0207649_10066510 | Ga0207649_100665101 | 358 |
| 682 | 3300025921 | Ga0207652_10072278 | Ga0207652_100722782 | 358 |
| 683 | 3300025923 | Ga0207681_10021602 | Ga0207681_100216022 | 358 |
| 684 | 3300025931 | Ga0207644_10088897 | Ga0207644_100888972 | 358 |
| 685 | 3300025933 | Ga0207706_10037597 | Ga0207706_100375973 | 358 |
| 686 | 3300025937 | Ga0207669_10057413 | Ga0207669_100574131 | 358 |
| 687 | 3300025938 | Ga0207704_10004989 | Ga0207704_100049894 | 358 |
| 688 | 3300025940 | Ga0207691_10079105 | Ga0207691_100791052 | 358 |
| 689 | 3300025941 | Ga0207711_10077753 | Ga0207711_100777532 | 358 |
| 690 | 3300025942 | Ga0207689_10004723 | Ga0207689_100047233 | 358 |
| 691 | 3300025944 | Ga0207661_10021471 | Ga0207661_100214713 | 358 |
| 692 | 3300025949 | Ga0207667_10230411 | Ga0207667_102304111 | 358 |
| 693 | 3300025972 | Ga0207668_10127096 | Ga0207668_101270962 | 358 |
| 694 | 3300025986 | Ga0207658_10034687 | Ga0207658_100346873 | 358 |
| 695 | 3300026067 | Ga0207678_10058404 | Ga0207678_100584042 | 358 |
| 696 | 3300026075 | Ga0207708_10001315 | Ga0207708_100013159 | 358 |
| 697 | 3300026089 | Ga0207648_10006304 | Ga0207648_100063044 | 358 |
| 698 | 3300026116 | Ga0207674_10003637 | Ga0207674_100036379 | 358 |
| 699 | 3300026118 | Ga0207675_100009307 | Ga0207675_1000093072 | 358 |
| 700 | 3300026121 | Ga0207683_10006759 | Ga0207683_100067592 | 358 |
| 701 | 3300028380 | Ga0268265_10103612 | Ga0268265_101036122 | 358 |
| 702 | 3300048903 | Ga0496100_0068321 | Ga0496100_0068321_474_1673 | 358 |
| 703 | 3300048907 | Ga0496104_0023107 | Ga0496104_0023107_1920_3119 | 358 |
| 704 | 3300048908 | Ga0496105_0031562 | Ga0496105_0031562_2803_4002 | 358 |
| 705 | 3300048909 | Ga0496106_0044172 | Ga0496106_0044172_229_1428 | 358 |
| 706 | 3300048912 | Ga0496109_0052662 | Ga0496109_0052662_851_2050 | 358 |
| 707 | 3300048917 | Ga0496114_0059484 | Ga0496114_0059484_1168_2367 | 358 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
197
383
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m6z-assembly1.cif.gz_D | a de novo designed transmembrane nanopore, tmh4c4 | 0.3051 | 167 | 352 |
| 6bl6-assembly1.cif.gz_A | crystallization of lipid a transporter msba from salmonella typhimurium | 0.2832 | 166 | 346 |
| 6m6z-assembly1.cif.gz_D | a de novo designed transmembrane nanopore, tmh4c4 | 0.2829 | 167 | 352 |
| 7t56-assembly1.cif.gz_A | cryo-em structure of pcat1 in the inward-facing intermediate conformation under atp turnover condition | 0.2399 | 166 | 351 |
| 7vr5-assembly1.cif.gz_A-2 | crystal structure of cmabcb1 w114y/w161y/w363y/w364y/m391w (4wy/m391w) mutant | 0.2347 | 166 | 348 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.5017 | 221 | 345 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4805 | 221 | 345 | 1.10.3720.10 |
| af_Q2FVE9_63_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4049 | 164 | 346 | 1.10.3720.10 |
| af_Q2G1F6_179_383_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4023 | 169 | 348 | 1.10.3720.10 |
| af_Q2FZQ8_74_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3982 | 166 | 345 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L7FH76-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.6466 | 193 | 304 |
GO:0005886
GO:0055085 |
| AF-L7FH76-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.6262 | 193 | 304 |
GO:0005886
GO:0055085 |
| AF-A0A7G2KFG3-F1-model_v4 | deleted | 0.5933 | 218 | 332 |
|
| AF-A0A7G2KFG3-F1-model_v4 | deleted | 0.5802 | 218 | 332 |
|
| AF-A0A6B3B4Q1-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.5799 | 224 | 348 |
GO:0005524
GO:0005886 GO:0015833 GO:0016887 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar