F476560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 707 | 347 | 707 | 61 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_1652821|Ga0451807_1652821_320_547 |
| Length | 75 |
| Sequence | MATEALKQKQQRKPKFKVRAYTRCRRCGRPRSVYRKFGLCRVCLRQLAHAGEIPGVTTSSWGEEATDRDYDGPNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 157 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 160 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 161 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 162 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 163 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 165 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 203 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 204 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 205 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 206 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 207 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 208 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 209 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 210 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 211 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 212 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.47 |
| Metatranscriptomes | 4.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.96 |
| Nodule | 0 |
| Rhizoplane | 6.22 |
| Rhizosphere | 86.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10003241 | 3300003373 | Bacteria | 3874 |
| 2 | JGI25405J52794_10004901 | 3300003911 | Bacteria | 2399 |
| 3 | JGI25405J52794_10019605 | 3300003911 | Bacteria | 1357 |
| 4 | Ga0058863_11587950 | 3300004799 | Bacteria | 569 |
| 5 | Ga0065715_10220399 | 3300005293 | Bacteria | 1261 |
| 6 | Ga0070658_11958811 | 3300005327 | Bacteria | 506 |
| 7 | Ga0070683_100295217 | 3300005329 | Bacteria | 1541 |
| 8 | Ga0070670_101830984 | 3300005331 | Bacteria | 559 |
| 9 | Ga0070680_100837301 | 3300005336 | Bacteria | 793 |
| 10 | Ga0070680_100924178 | 3300005336 | Bacteria | 753 |
| 11 | Ga0070680_101886028 | 3300005336 | Bacteria | 518 |
| 12 | Ga0070680_101909176 | 3300005336 | Bacteria | 515 |
| 13 | Ga0070682_101219823 | 3300005337 | Bacteria | 636 |
| 14 | Ga0070682_101329966 | 3300005337 | Bacteria | 612 |
| 15 | Ga0068868_102361680 | 3300005338 | Bacteria | 508 |
| 16 | Ga0070687_100373703 | 3300005343 | Bacteria | 927 |
| 17 | Ga0070661_101121711 | 3300005344 | Bacteria | 656 |
| 18 | Ga0070675_100720717 | 3300005354 | Bacteria | 909 |
| 19 | Ga0070671_100081875 | 3300005355 | Bacteria | 2699 |
| 20 | Ga0070671_101641711 | 3300005355 | Bacteria | 570 |
| 21 | Ga0070674_100965481 | 3300005356 | Bacteria | 746 |
| 22 | Ga0070659_100536174 | 3300005366 | Bacteria | 1001 |
| 23 | Ga0070659_101832681 | 3300005366 | Bacteria | 544 |
| 24 | Ga0070667_101171537 | 3300005367 | Bacteria | 719 |
| 25 | Ga0070703_10199130 | 3300005406 | Bacteria | 785 |
| 26 | Ga0070713_100841435 | 3300005436 | Bacteria | 881 |
| 27 | Ga0070705_100004009 | 3300005440 | Bacteria | 7191 |
| 28 | Ga0070705_101629287 | 3300005440 | Bacteria | 544 |
| 29 | Ga0070694_100662432 | 3300005444 | Bacteria | 846 |
| 30 | Ga0070708_100002882 | 3300005445 | Bacteria | 13353 |
| 31 | Ga0070708_100010139 | 3300005445 | Bacteria | 7624 |
| 32 | Ga0070708_100054472 | 3300005445 | Bacteria | 3552 |
| 33 | Ga0070708_100197861 | 3300005445 | Bacteria | 1881 |
| 34 | Ga0070708_100264020 | 3300005445 | Bacteria | 1619 |
| 35 | Ga0070662_101454875 | 3300005457 | Bacteria | 591 |
| 36 | Ga0070681_10022654 | 3300005458 | Bacteria | 6310 |
| 37 | Ga0070681_10283665 | 3300005458 | Bacteria | 1567 |
| 38 | Ga0068867_101862662 | 3300005459 | Bacteria | 567 |
| 39 | Ga0070706_100068700 | 3300005467 | Bacteria | 3277 |
| 40 | Ga0070706_100075943 | 3300005467 | Bacteria | 3110 |
| 41 | Ga0070706_100489090 | 3300005467 | Bacteria | 1145 |
| 42 | Ga0070707_100142593 | 3300005468 | Bacteria | 2332 |
| 43 | Ga0070707_100909345 | 3300005468 | Bacteria | 845 |
| 44 | Ga0070698_100045833 | 3300005471 | Bacteria | 4474 |
| 45 | Ga0070698_101693886 | 3300005471 | Bacteria | 585 |
| 46 | Ga0070699_100059059 | 3300005518 | Bacteria | 3323 |
| 47 | Ga0070699_100708528 | 3300005518 | Bacteria | 920 |
| 48 | Ga0070699_101712313 | 3300005518 | Bacteria | 576 |
| 49 | Ga0070679_100471497 | 3300005530 | Bacteria | 1199 |
| 50 | Ga0070679_100498385 | 3300005530 | Bacteria | 1162 |
| 51 | Ga0070679_100664457 | 3300005530 | Bacteria | 985 |
| 52 | Ga0070684_100711310 | 3300005535 | Bacteria | 937 |
| 53 | Ga0070684_101085855 | 3300005535 | Bacteria | 752 |
| 54 | Ga0070684_101325386 | 3300005535 | Bacteria | 678 |
| 55 | Ga0070697_100211578 | 3300005536 | Bacteria | 1651 |
| 56 | Ga0070697_101511690 | 3300005536 | Bacteria | 600 |
| 57 | Ga0070672_100144963 | 3300005543 | Bacteria | 1962 |
| 58 | Ga0070686_101841393 | 3300005544 | Bacteria | 516 |
| 59 | Ga0070695_100011172 | 3300005545 | Bacteria | 5369 |
| 60 | Ga0070695_100555881 | 3300005545 | Bacteria | 895 |
| 61 | Ga0070696_100012226 | 3300005546 | Bacteria | 5753 |
| 62 | Ga0070696_100251830 | 3300005546 | Bacteria | 1336 |
| 63 | Ga0070696_100430175 | 3300005546 | Bacteria | 1038 |
| 64 | Ga0070704_100043449 | 3300005549 | Bacteria | 3115 |
| 65 | Ga0070704_100852693 | 3300005549 | Bacteria | 817 |
| 66 | Ga0070704_100872085 | 3300005549 | Bacteria | 808 |
| 67 | Ga0070704_101244632 | 3300005549 | Bacteria | 680 |
| 68 | Ga0070704_102205766 | 3300005549 | Bacteria | 512 |
| 69 | Ga0068855_100898522 | 3300005563 | Bacteria | 936 |
| 70 | Ga0068855_101167947 | 3300005563 | Bacteria | 802 |
| 71 | Ga0068855_101183335 | 3300005563 | Bacteria | 796 |
| 72 | Ga0068855_102164467 | 3300005563 | Bacteria | 559 |
| 73 | Ga0068857_102039935 | 3300005577 | Bacteria | 563 |
| 74 | Ga0068856_100179013 | 3300005614 | Bacteria | 2133 |
| 75 | Ga0068856_102651037 | 3300005614 | Bacteria | 507 |
| 76 | Ga0068852_100749286 | 3300005616 | Bacteria | 989 |
| 77 | Ga0068859_101051495 | 3300005617 | Bacteria | 895 |
| 78 | Ga0068866_11222192 | 3300005718 | Bacteria | 543 |
| 79 | Ga0068860_100715425 | 3300005843 | Bacteria | 1012 |
| 80 | Ga0081455_10001246 | 3300005937 | Bacteria | 31840 |
| 81 | Ga0081455_10019861 | 3300005937 | Bacteria | 6345 |
| 82 | Ga0081455_10074703 | 3300005937 | Bacteria | 2799 |
| 83 | Ga0081455_10085652 | 3300005937 | Bacteria | 2569 |
| 84 | Ga0081455_10182101 | 3300005937 | Bacteria | 1589 |
| 85 | Ga0081455_10817738 | 3300005937 | Bacteria | 584 |
| 86 | Ga0081538_10012203 | 3300005981 | Bacteria | 6904 |
| 87 | Ga0081538_10066834 | 3300005981 | Bacteria | 2012 |
| 88 | Ga0081538_10082905 | 3300005981 | Bacteria | 1697 |
| 89 | Ga0081538_10176800 | 3300005981 | Bacteria | 920 |
| 90 | Ga0075365_10103174 | 3300006038 | Bacteria | 1954 |
| 91 | Ga0075365_10299062 | 3300006038 | Bacteria | 1132 |
| 92 | Ga0075365_10516571 | 3300006038 | Bacteria | 844 |
| 93 | Ga0075368_10247087 | 3300006042 | Bacteria | 762 |
| 94 | Ga0075363_100315687 | 3300006048 | Bacteria | 909 |
| 95 | Ga0075364_10384433 | 3300006051 | Bacteria | 957 |
| 96 | Ga0070716_101688136 | 3300006173 | Bacteria | 522 |
| 97 | Ga0070712_101891342 | 3300006175 | Bacteria | 522 |
| 98 | Ga0075362_10240646 | 3300006177 | Bacteria | 888 |
| 99 | Ga0075367_10738087 | 3300006178 | Bacteria | 627 |
| 100 | Ga0075369_10211607 | 3300006186 | Bacteria | 896 |
| 101 | Ga0075427_10058576 | 3300006194 | Bacteria | 672 |
| 102 | Ga0097621_102324722 | 3300006237 | Bacteria | 513 |
| 103 | Ga0075370_10633424 | 3300006353 | Bacteria | 649 |
| 104 | Ga0075370_10680404 | 3300006353 | Bacteria | 625 |
| 105 | Ga0068871_100657964 | 3300006358 | Bacteria | 957 |
| 106 | Ga0075428_100006199 | 3300006844 | Bacteria | 13302 |
| 107 | Ga0075428_100034071 | 3300006844 | Bacteria | 5618 |
| 108 | Ga0075428_100058733 | 3300006844 | Bacteria | 4211 |
| 109 | Ga0075428_100260598 | 3300006844 | Bacteria | 1867 |
| 110 | Ga0075428_102294481 | 3300006844 | Bacteria | 555 |
| 111 | Ga0075430_100006208 | 3300006846 | Bacteria | 10075 |
| 112 | Ga0075430_100012317 | 3300006846 | Bacteria | 7274 |
| 113 | Ga0075430_100130160 | 3300006846 | Bacteria | 2098 |
| 114 | Ga0075430_100595749 | 3300006846 | Bacteria | 912 |
| 115 | Ga0075431_100026546 | 3300006847 | Bacteria | 5941 |
| 116 | Ga0075431_100039453 | 3300006847 | Bacteria | 4864 |
| 117 | Ga0075431_100101856 | 3300006847 | Bacteria | 2963 |
| 118 | Ga0075431_100422381 | 3300006847 | Bacteria | 1332 |
| 119 | Ga0075431_102040331 | 3300006847 | Bacteria | 528 |
| 120 | Ga0075433_10002059 | 3300006852 | Bacteria | 15203 |
| 121 | Ga0075434_100004000 | 3300006871 | Bacteria | 13201 |
| 122 | Ga0075434_100501225 | 3300006871 | Bacteria | 1235 |
| 123 | Ga0075434_100521092 | 3300006871 | Bacteria | 1209 |
| 124 | Ga0075434_100883286 | 3300006871 | Bacteria | 909 |
| 125 | Ga0075429_100001166 | 3300006880 | Bacteria | 21212 |
| 126 | Ga0075429_100035358 | 3300006880 | Bacteria | 4345 |
| 127 | Ga0075429_100073670 | 3300006880 | Bacteria | 2974 |
| 128 | Ga0075429_100080207 | 3300006880 | Bacteria | 2845 |
| 129 | Ga0075429_100799658 | 3300006880 | Bacteria | 826 |
| 130 | Ga0075436_100044915 | 3300006914 | Bacteria | 3048 |
| 131 | Ga0097620_101051447 | 3300006931 | Bacteria | 895 |
| 132 | Ga0075435_100039605 | 3300007076 | Bacteria | 3761 |
| 133 | Ga0075435_101292323 | 3300007076 | Bacteria | 639 |
| 134 | Ga0105240_10590877 | 3300009093 | Bacteria | 1223 |
| 135 | Ga0105240_12194005 | 3300009093 | Bacteria | 573 |
| 136 | Ga0111539_10028860 | 3300009094 | Bacteria | 6766 |
| 137 | Ga0111539_10092465 | 3300009094 | Bacteria | 3555 |
| 138 | Ga0111539_10156465 | 3300009094 | Bacteria | 2667 |
| 139 | Ga0111539_10863583 | 3300009094 | Bacteria | 1053 |
| 140 | Ga0111539_12392350 | 3300009094 | Bacteria | 613 |
| 141 | Ga0105245_10842196 | 3300009098 | Bacteria | 957 |
| 142 | Ga0105245_11299592 | 3300009098 | Bacteria | 776 |
| 143 | Ga0114129_10045478 | 3300009147 | Bacteria | 6171 |
| 144 | Ga0114129_10253665 | 3300009147 | Bacteria | 2360 |
| 145 | Ga0114129_10538457 | 3300009147 | Bacteria | 1520 |
| 146 | Ga0114129_10543643 | 3300009147 | Bacteria | 1511 |
| 147 | Ga0114129_10877341 | 3300009147 | Bacteria | 1138 |
| 148 | Ga0105243_10425232 | 3300009148 | Bacteria | 1240 |
| 149 | Ga0105243_12921906 | 3300009148 | Bacteria | 518 |
| 150 | Ga0105241_10694866 | 3300009174 | Bacteria | 928 |
| 151 | Ga0105241_11060672 | 3300009174 | Bacteria | 761 |
| 152 | Ga0105242_10173533 | 3300009176 | Bacteria | 1896 |
| 153 | Ga0105248_11382012 | 3300009177 | Bacteria | 797 |
| 154 | Ga0105237_10194860 | 3300009545 | Bacteria | 2026 |
| 155 | Ga0105237_11757183 | 3300009545 | Bacteria | 628 |
| 156 | Ga0105238_11040475 | 3300009551 | Bacteria | 840 |
| 157 | Ga0105238_11230575 | 3300009551 | Bacteria | 774 |
| 158 | Ga0105238_12105830 | 3300009551 | Bacteria | 598 |
| 159 | Ga0105238_12682894 | 3300009551 | Bacteria | 535 |
| 160 | Ga0105249_12297973 | 3300009553 | Bacteria | 612 |
| 161 | Ga0105239_10662241 | 3300010375 | Bacteria | 1193 |
| 162 | Ga0105239_12497406 | 3300010375 | Bacteria | 602 |
| 163 | Ga0105239_12553468 | 3300010375 | Bacteria | 596 |
| 164 | Ga0105246_10461397 | 3300011119 | Bacteria | 1070 |
| 165 | Ga0105246_11475645 | 3300011119 | Bacteria | 638 |
| 166 | Ga0157342_1038308 | 3300012507 | Bacteria | 632 |
| 167 | Ga0157373_11042943 | 3300013100 | Bacteria | 612 |
| 168 | Ga0157371_10385932 | 3300013102 | Bacteria | 1023 |
| 169 | Ga0157370_10742003 | 3300013104 | Bacteria | 895 |
| 170 | Ga0157369_10513161 | 3300013105 | Bacteria | 1240 |
| 171 | Ga0157378_11654735 | 3300013297 | Bacteria | 686 |
| 172 | Ga0157378_12418023 | 3300013297 | Bacteria | 577 |
| 173 | Ga0163162_11393423 | 3300013306 | Bacteria | 797 |
| 174 | Ga0163162_12604806 | 3300013306 | Bacteria | 582 |
| 175 | Ga0157372_10876526 | 3300013307 | Bacteria | 1042 |
| 176 | Ga0157375_11782241 | 3300013308 | Bacteria | 730 |
| 177 | Ga0163163_10684354 | 3300014325 | Bacteria | 1089 |
| 178 | Ga0163163_11480285 | 3300014325 | Bacteria | 740 |
| 179 | Ga0157380_11442300 | 3300014326 | Bacteria | 740 |
| 180 | Ga0157380_11601090 | 3300014326 | Bacteria | 707 |
| 181 | Ga0157377_11373179 | 3300014745 | Bacteria | 556 |
| 182 | Ga0157379_10713626 | 3300014968 | Bacteria | 942 |
| 183 | Ga0157379_12606513 | 3300014968 | Bacteria | 506 |
| 184 | Ga0157376_10525657 | 3300014969 | Bacteria | 1167 |
| 185 | Ga0157376_11442519 | 3300014969 | Bacteria | 720 |
| 186 | Ga0197907_10151244 | 3300020069 | Bacteria | 828 |
| 187 | Ga0206352_11181811 | 3300020078 | Bacteria | 873 |
| 188 | Ga0206354_10198866 | 3300020081 | Bacteria | 588 |
| 189 | Ga0206354_10579374 | 3300020081 | Bacteria | 956 |
| 190 | Ga0206354_11095091 | 3300020081 | Bacteria | 531 |
| 191 | Ga0213874_10317408 | 3300021377 | Bacteria | 590 |
| 192 | Ga0213875_10502884 | 3300021388 | Bacteria | 582 |
| 193 | Ga0224712_10258977 | 3300022467 | Bacteria | 805 |
| 194 | Ga0207653_10168233 | 3300025885 | Bacteria | 814 |
| 195 | Ga0207710_10285998 | 3300025900 | Bacteria | 830 |
| 196 | Ga0207688_10569820 | 3300025901 | Bacteria | 712 |
| 197 | Ga0207645_10387615 | 3300025907 | Bacteria | 939 |
| 198 | Ga0207643_10154726 | 3300025908 | Bacteria | 1377 |
| 199 | Ga0207705_10834415 | 3300025909 | Bacteria | 715 |
| 200 | Ga0207684_10037904 | 3300025910 | Bacteria | 4090 |
| 201 | Ga0207684_10067749 | 3300025910 | Bacteria | 3033 |
| 202 | Ga0207684_10521315 | 3300025910 | Bacteria | 1018 |
| 203 | Ga0207654_10639675 | 3300025911 | Bacteria | 761 |
| 204 | Ga0207654_11037421 | 3300025911 | Bacteria | 597 |
| 205 | Ga0207707_10303885 | 3300025912 | Bacteria | 1379 |
| 206 | Ga0207707_10467844 | 3300025912 | Bacteria | 1078 |
| 207 | Ga0207707_11011970 | 3300025912 | Bacteria | 681 |
| 208 | Ga0207695_10676123 | 3300025913 | Bacteria | 913 |
| 209 | Ga0207671_10465254 | 3300025914 | Bacteria | 1008 |
| 210 | Ga0207663_11504744 | 3300025916 | Bacteria | 542 |
| 211 | Ga0207663_11546305 | 3300025916 | Bacteria | 534 |
| 212 | Ga0207660_10173107 | 3300025917 | Bacteria | 1672 |
| 213 | Ga0207660_10630866 | 3300025917 | Bacteria | 873 |
| 214 | Ga0207660_10746261 | 3300025917 | Bacteria | 799 |
| 215 | Ga0207662_10867426 | 3300025918 | Bacteria | 638 |
| 216 | Ga0207652_10590324 | 3300025921 | Bacteria | 997 |
| 217 | Ga0207652_10701807 | 3300025921 | Bacteria | 903 |
| 218 | Ga0207646_10419911 | 3300025922 | Bacteria | 1207 |
| 219 | Ga0207681_10811597 | 3300025923 | Bacteria | 782 |
| 220 | Ga0207681_11644922 | 3300025923 | Bacteria | 537 |
| 221 | Ga0207687_10570242 | 3300025927 | Bacteria | 951 |
| 222 | Ga0207644_10016437 | 3300025931 | Bacteria | 4978 |
| 223 | Ga0207644_11833858 | 3300025931 | Bacteria | 507 |
| 224 | Ga0207690_11159828 | 3300025932 | Bacteria | 645 |
| 225 | Ga0207706_11074713 | 3300025933 | Bacteria | 673 |
| 226 | Ga0207686_10654838 | 3300025934 | Bacteria | 831 |
| 227 | Ga0207709_11457483 | 3300025935 | Bacteria | 567 |
| 228 | Ga0207670_11164960 | 3300025936 | Bacteria | 652 |
| 229 | Ga0207669_10468316 | 3300025937 | Bacteria | 1002 |
| 230 | Ga0207704_10341777 | 3300025938 | Bacteria | 1162 |
| 231 | Ga0207704_10728729 | 3300025938 | Bacteria | 823 |
| 232 | Ga0207665_10769798 | 3300025939 | Bacteria | 759 |
| 233 | Ga0207665_11143191 | 3300025939 | Bacteria | 621 |
| 234 | Ga0207691_10118730 | 3300025940 | Bacteria | 2346 |
| 235 | Ga0207661_10214880 | 3300025944 | Bacteria | 1697 |
| 236 | Ga0207661_11299597 | 3300025944 | Bacteria | 668 |
| 237 | Ga0207661_11395126 | 3300025944 | Bacteria | 643 |
| 238 | Ga0207661_11400026 | 3300025944 | Bacteria | 642 |
| 239 | Ga0207667_10373047 | 3300025949 | Bacteria | 1454 |
| 240 | Ga0207667_11111089 | 3300025949 | Bacteria | 773 |
| 241 | Ga0207651_10137488 | 3300025960 | Bacteria | 1882 |
| 242 | Ga0207712_11167396 | 3300025961 | Bacteria | 686 |
| 243 | Ga0207668_11627277 | 3300025972 | Bacteria | 583 |
| 244 | Ga0207677_10585338 | 3300026023 | Bacteria | 977 |
| 245 | Ga0207677_11453047 | 3300026023 | Bacteria | 632 |
| 246 | Ga0207677_11892486 | 3300026023 | Bacteria | 554 |
| 247 | Ga0207703_11635942 | 3300026035 | Bacteria | 619 |
| 248 | Ga0207708_10154426 | 3300026075 | Bacteria | 1809 |
| 249 | Ga0207708_10205752 | 3300026075 | Bacteria | 1572 |
| 250 | Ga0207702_11049561 | 3300026078 | Bacteria | 809 |
| 251 | Ga0207702_11157335 | 3300026078 | Bacteria | 768 |
| 252 | Ga0207702_12059462 | 3300026078 | Bacteria | 561 |
| 253 | Ga0207648_10371933 | 3300026089 | Bacteria | 1291 |
| 254 | Ga0207648_11490267 | 3300026089 | Bacteria | 636 |
| 255 | Ga0207674_10831231 | 3300026116 | Bacteria | 891 |
| 256 | Ga0207675_100500511 | 3300026118 | Bacteria | 1209 |
| 257 | Ga0207698_11454984 | 3300026142 | Bacteria | 700 |
| 258 | Ga0209813_10360194 | 3300027866 | Bacteria | 578 |
| 259 | Ga0209974_10372268 | 3300027876 | Bacteria | 557 |
| 260 | Ga0207428_10029499 | 3300027907 | Bacteria | 4546 |
| 261 | Ga0207428_10539873 | 3300027907 | Bacteria | 844 |
| 262 | Ga0207428_11217681 | 3300027907 | Bacteria | 523 |
| 263 | Ga0268264_10364274 | 3300028381 | Bacteria | 1380 |
| 264 | Ga0268264_11053263 | 3300028381 | Bacteria | 821 |
| 265 | Ga0265327_10186780 | 3300031251 | Bacteria | 945 |
| 266 | Ga0265327_10398115 | 3300031251 | Bacteria | 598 |
| 267 | Ga0265327_10410393 | 3300031251 | Bacteria | 587 |
| 268 | Ga0316575_10261993 | 3300031665 | Bacteria | 726 |
| 269 | Ga0316575_10472894 | 3300031665 | Bacteria | 542 |
| 270 | Ga0316576_10003787 | 3300031727 | Bacteria | 8941 |
| 271 | Ga0316576_10136842 | 3300031727 | Bacteria | 1844 |
| 272 | Ga0316576_10289985 | 3300031727 | Bacteria | 1224 |
| 273 | Ga0316576_10612465 | 3300031727 | Bacteria | 794 |
| 274 | Ga0316578_10051067 | 3300031728 | Bacteria | 2421 |
| 275 | Ga0307405_10586286 | 3300031731 | Bacteria | 908 |
| 276 | Ga0326468_10053188 | 3300031889 | Bacteria | 621 |
| 277 | Ga0307412_11101467 | 3300031911 | Bacteria | 707 |
| 278 | Ga0307412_11314432 | 3300031911 | Bacteria | 651 |
| 279 | Ga0307409_100410741 | 3300031995 | Bacteria | 1296 |
| 280 | Ga0307409_101038964 | 3300031995 | Bacteria | 839 |
| 281 | Ga0307416_101027404 | 3300032002 | Bacteria | 928 |
| 282 | Ga0316585_10131826 | 3300032137 | Bacteria | 824 |
| 283 | Ga0316593_10116132 | 3300032168 | Bacteria | 958 |
| 284 | Ga0316596_1111917 | 3300033541 | Bacteria | 741 |
| 285 | Ga0373930_0000469 | 3300034816 | Bacteria | 5443 |
| 286 | Ga0373948_0065273 | 3300034817 | Bacteria | 806 |
| 287 | Ga0373958_0099380 | 3300034819 | Bacteria | 681 |
| 288 | Ga0373938_0198838 | 3300034957 | Bacteria | 555 |
| 289 | Ga0373928_0004933 | 3300035084 | Bacteria | 2542 |
| 290 | Ga0373928_0282089 | 3300035084 | Bacteria | 504 |
| 291 | Ga0373929_0000799 | 3300035085 | Bacteria | 6117 |
| 292 | Ga0373944_0035109 | 3300035089 | Bacteria | 1527 |
| 293 | Ga0373949_0013928 | 3300035090 | Bacteria | 1788 |
| 294 | Ga0373932_0000629 | 3300035112 | Bacteria | 10701 |
| 295 | Ga0373939_0465356 | 3300035114 | Bacteria | 534 |
| 296 | Ga0373941_0378741 | 3300035115 | Bacteria | 581 |
| 297 | Ga0373954_0454940 | 3300035118 | Bacteria | 634 |
| 298 | Ga0373960_0126464 | 3300035121 | Bacteria | 853 |
| 299 | Ga0373960_0383872 | 3300035121 | Bacteria | 539 |
| 300 | Ga0373943_0098052 | 3300035170 | Bacteria | 1528 |
| 301 | Ga0373946_0112085 | 3300035171 | Bacteria | 1236 |
| 302 | Ga0373955_0201827 | 3300035172 | Bacteria | 1184 |
| 303 | Ga0373961_0255309 | 3300035241 | Bacteria | 636 |
| 304 | Ga0373962_0265714 | 3300035242 | Bacteria | 600 |
| 305 | Ga0316574_0067221 | 3300035398 | Bacteria | 2259 |
| 306 | Ga0316574_0296929 | 3300035398 | Bacteria | 1028 |
| 307 | Ga0373924_0415527 | 3300035410 | Bacteria | 602 |
| 308 | Ga0373931_0000003 | 3300035691 | Bacteria | 560286 |
| 309 | Ga0373931_0272387 | 3300035691 | Bacteria | 1037 |
| 310 | Ga0373931_0841743 | 3300035691 | Bacteria | 614 |
| 311 | Ga0373931_0880766 | 3300035691 | Bacteria | 601 |
| 312 | Ga0373931_1218138 | 3300035691 | Bacteria | 516 |
| 313 | Ga0373935_0994322 | 3300035692 | Bacteria | 623 |
| 314 | Ga0373927_1093282 | 3300035695 | Bacteria | 526 |
| 315 | Ga0373947_0102489 | 3300035725 | Bacteria | 1800 |
| 316 | Ga0373937_0811315 | 3300036401 | Bacteria | 884 |
| 317 | Ga0373937_1962981 | 3300036401 | Bacteria | 531 |
| 318 | Ga0316582_0033668 | 3300036647 | Bacteria | 3149 |
| 319 | Ga0316584_0027637 | 3300036712 | Bacteria | 4177 |
| 320 | Ga0316584_0039289 | 3300036712 | Bacteria | 3523 |
| 321 | Ga0316584_0091105 | 3300036712 | Bacteria | 2283 |
| 322 | Ga0316584_0312602 | 3300036712 | Bacteria | 1135 |
| 323 | Ga0373925_1316339 | 3300037068 | Bacteria | 593 |
| 324 | Ga0373925_1715863 | 3300037068 | Bacteria | 513 |
| 325 | Ga0395898_1943313 | 3300037466 | Bacteria | 508 |
| 326 | Ga0436364_0252787 | 3300037853 | Bacteria | 691 |
| 327 | Ga0436364_0502838 | 3300037853 | Bacteria | 719 |
| 328 | Ga0436364_1523557 | 3300037853 | Bacteria | 661 |
| 329 | Ga0395901_1701266 | 3300038443 | Bacteria | 582 |
| 330 | Ga0400483_003112 | 3300039062 | Bacteria | 4314 |
| 331 | Ga0400483_023236 | 3300039062 | Bacteria | 2635 |
| 332 | Ga0400483_131915 | 3300039062 | Bacteria | 8343 |
| 333 | Ga0400483_131932 | 3300039062 | Bacteria | 3270 |
| 334 | Ga0400483_186328 | 3300039062 | Bacteria | 7437 |
| 335 | Ga0400483_217638 | 3300039062 | Bacteria | 24445 |
| 336 | Ga0400483_218418 | 3300039062 | Bacteria | 42144 |
| 337 | Ga0400483_291615 | 3300039062 | Bacteria | 2549 |
| 338 | Ga0436360_0420887 | 3300039438 | Bacteria | 732 |
| 339 | Ga0436363_0802854 | 3300039450 | Bacteria | 767 |
| 340 | Ga0436363_1052075 | 3300039450 | Bacteria | 530 |
| 341 | Ga0436363_1149441 | 3300039450 | Bacteria | 569 |
| 342 | Ga0436363_1551998 | 3300039450 | Bacteria | 1133 |
| 343 | Ga0436363_1682136 | 3300039450 | Bacteria | 624 |
| 344 | Ga0451793_0165964 | 3300041452 | Bacteria | 785 |
| 345 | Ga0451802_0293405 | 3300041460 | Bacteria | 503 |
| 346 | Ga0451802_0819940 | 3300041460 | Bacteria | 741 |
| 347 | Ga0451806_007425 | 3300041462 | Bacteria | 574 |
| 348 | Ga0451804_0942618 | 3300041463 | Bacteria | 530 |
| 349 | Ga0451807_1652821 | 3300041486 | Bacteria | 686 |
| 350 | Ga0451807_2373495 | 3300041486 | Bacteria | 523 |
| 351 | Ga0451833_0784089 | 3300041491 | Bacteria | 504 |
| 352 | Ga0451853_2208428 | 3300041512 | Bacteria | 559 |
| 353 | Ga0439443_023052 | 3300042003 | Bacteria | 992 |
| 354 | Ga0439448_0005269 | 3300042005 | Bacteria | 3684 |
| 355 | Ga0439450_107624 | 3300042008 | Bacteria | 711 |
| 356 | Ga0439451_059104 | 3300042009 | Bacteria | 767 |
| 357 | Ga0439454_000932 | 3300042011 | Bacteria | 2590 |
| 358 | Ga0439456_043183 | 3300042013 | Bacteria | 980 |
| 359 | Ga0439463_001342 | 3300042016 | Bacteria | 6565 |
| 360 | Ga0450920_067475 | 3300042122 | Bacteria | 726 |
| 361 | Ga0450923_004570 | 3300042125 | Bacteria | 2178 |
| 362 | Ga0439435_0086387 | 3300042436 | Bacteria | 948 |
| 363 | Ga0439444_0102021 | 3300042437 | Bacteria | 651 |
| 364 | Ga0439464_0000848 | 3300042439 | Bacteria | 6778 |
| 365 | Ga0439460_0004479 | 3300042461 | Bacteria | 3406 |
| 366 | Ga0439460_0242255 | 3300042461 | Bacteria | 622 |
| 367 | Ga0439460_0332470 | 3300042461 | Bacteria | 534 |
| 368 | Ga0451577_1106579 | 3300042876 | Bacteria | 709 |
| 369 | Ga0439440_0003816 | 3300042993 | Bacteria | 2931 |
| 370 | Ga0466963_1213182 | 3300044694 | Bacteria | 530 |
| 371 | Ga0466968_0135235 | 3300044735 | Bacteria | 1124 |
| 372 | Ga0466960_0987889 | 3300044901 | Bacteria | 517 |
| 373 | Ga0466967_0242667 | 3300045976 | Bacteria | 1719 |
| 374 | Ga0466967_0756998 | 3300045976 | Bacteria | 963 |
| 375 | Ga0466967_2024266 | 3300045976 | Bacteria | 572 |
| 376 | Ga0495592_0406759 | 3300046454 | Bacteria | 861 |
| 377 | Ga0495603_0084466 | 3300046455 | Bacteria | 1859 |
| 378 | Ga0495603_0790550 | 3300046455 | Bacteria | 541 |
| 379 | Ga0495629_0074831 | 3300046459 | Bacteria | 2365 |
| 380 | Ga0495629_0416273 | 3300046459 | Bacteria | 912 |
| 381 | Ga0495629_0740021 | 3300046459 | Bacteria | 651 |
| 382 | Ga0495641_0347658 | 3300046461 | Bacteria | 670 |
| 383 | Ga0495641_0472868 | 3300046461 | Bacteria | 571 |
| 384 | Ga0495641_0526205 | 3300046461 | Bacteria | 539 |
| 385 | Ga0495651_0557705 | 3300046462 | Bacteria | 727 |
| 386 | Ga0495653_0113682 | 3300046463 | Bacteria | 1941 |
| 387 | Ga0495653_0310825 | 3300046463 | Bacteria | 1025 |
| 388 | Ga0495653_0313092 | 3300046463 | Bacteria | 1020 |
| 389 | Ga0495653_0399219 | 3300046463 | Bacteria | 874 |
| 390 | Ga0495582_0447711 | 3300046473 | Bacteria | 746 |
| 391 | Ga0495582_0711513 | 3300046473 | Bacteria | 581 |
| 392 | Ga0495639_0519882 | 3300046475 | Bacteria | 608 |
| 393 | Ga0495639_0562538 | 3300046475 | Bacteria | 585 |
| 394 | Ga0495662_0486366 | 3300046476 | Bacteria | 605 |
| 395 | Ga0495664_0897657 | 3300046477 | Bacteria | 518 |
| 396 | Ga0495618_0491630 | 3300046514 | Bacteria | 741 |
| 397 | Ga0495628_0237518 | 3300046516 | Bacteria | 1364 |
| 398 | Ga0495628_0348691 | 3300046516 | Bacteria | 1089 |
| 399 | Ga0495630_0089420 | 3300046517 | Bacteria | 2326 |
| 400 | Ga0495630_0538626 | 3300046517 | Bacteria | 895 |
| 401 | Ga0495642_0186115 | 3300046528 | Bacteria | 904 |
| 402 | Ga0495652_0288617 | 3300046529 | Bacteria | 1198 |
| 403 | Ga0495652_0395801 | 3300046529 | Bacteria | 979 |
| 404 | Ga0495665_0238502 | 3300046531 | Bacteria | 938 |
| 405 | Ga0495640_0705623 | 3300046533 | Bacteria | 605 |
| 406 | Ga0495586_0020382 | 3300046535 | Bacteria | 3532 |
| 407 | Ga0495586_0575684 | 3300046535 | Bacteria | 650 |
| 408 | Ga0495587_0227468 | 3300046536 | Bacteria | 1051 |
| 409 | Ga0495645_0552142 | 3300046543 | Bacteria | 714 |
| 410 | Ga0495645_0930239 | 3300046543 | Bacteria | 515 |
| 411 | Ga0495622_0048905 | 3300046557 | Bacteria | 1964 |
| 412 | Ga0495667_0113042 | 3300046559 | Bacteria | 1755 |
| 413 | Ga0495667_0457486 | 3300046559 | Bacteria | 801 |
| 414 | Ga0495625_0637761 | 3300046660 | Bacteria | 636 |
| 415 | Ga0495635_0296984 | 3300046663 | Bacteria | 1083 |
| 416 | Ga0495635_0520326 | 3300046663 | Bacteria | 782 |
| 417 | Ga0495588_0270321 | 3300046674 | Bacteria | 896 |
| 418 | Ga0495588_0669849 | 3300046674 | Bacteria | 543 |
| 419 | Ga0495657_0140444 | 3300046675 | Bacteria | 1506 |
| 420 | Ga0495623_0302821 | 3300046679 | Bacteria | 883 |
| 421 | Ga0495646_0468266 | 3300046680 | Bacteria | 649 |
| 422 | Ga0495647_0029017 | 3300046681 | Bacteria | 2043 |
| 423 | Ga0495647_0336861 | 3300046681 | Bacteria | 685 |
| 424 | Ga0495658_0285831 | 3300046683 | Bacteria | 1041 |
| 425 | Ga0495613_0028211 | 3300046689 | Bacteria | 4176 |
| 426 | Ga0495613_0407975 | 3300046689 | Bacteria | 926 |
| 427 | Ga0495624_0131082 | 3300046690 | Bacteria | 1537 |
| 428 | Ga0495624_0855135 | 3300046690 | Bacteria | 536 |
| 429 | Ga0495589_0314922 | 3300046794 | Bacteria | 724 |
| 430 | Ga0495600_0131917 | 3300046809 | Bacteria | 1624 |
| 431 | Ga0495600_0523565 | 3300046809 | Bacteria | 727 |
| 432 | Ga0495581_0230674 | 3300047315 | Bacteria | 1083 |
| 433 | Ga0495581_0564532 | 3300047315 | Bacteria | 660 |
| 434 | Ga0495581_0606488 | 3300047315 | Bacteria | 634 |
| 435 | Ga0495581_0853714 | 3300047315 | Bacteria | 521 |
| 436 | Ga0495674_0078522 | 3300047319 | Bacteria | 2836 |
| 437 | Ga0495674_0128531 | 3300047319 | Bacteria | 2136 |
| 438 | Ga0495676_0068054 | 3300047321 | Bacteria | 2753 |
| 439 | Ga0495676_0534621 | 3300047321 | Bacteria | 767 |
| 440 | Ga0495680_0049949 | 3300047322 | Bacteria | 3273 |
| 441 | Ga0495680_0451867 | 3300047322 | Bacteria | 879 |
| 442 | Ga0495680_1029064 | 3300047322 | Bacteria | 524 |
| 443 | Ga0495675_0354999 | 3300047444 | Bacteria | 861 |
| 444 | Ga0495684_0265865 | 3300047471 | Bacteria | 1243 |
| 445 | Ga0495684_0380426 | 3300047471 | Bacteria | 996 |
| 446 | Ga0495602_0282230 | 3300048088 | Bacteria | 1223 |
| 447 | Ga0495602_0699356 | 3300048088 | Bacteria | 688 |
| 448 | Ga0495614_0077224 | 3300048089 | Bacteria | 1440 |
| 449 | Ga0496100_0439447 | 3300048903 | Bacteria | 999 |
| 450 | Ga0496101_0580928 | 3300048904 | Bacteria | 886 |
| 451 | Ga0496101_1382644 | 3300048904 | Bacteria | 549 |
| 452 | Ga0496102_0080016 | 3300048905 | Bacteria | 3010 |
| 453 | Ga0496102_0384681 | 3300048905 | Bacteria | 1320 |
| 454 | Ga0496102_0695419 | 3300048905 | Bacteria | 940 |
| 455 | Ga0496102_1678517 | 3300048905 | Bacteria | 553 |
| 456 | Ga0496105_0671430 | 3300048908 | Bacteria | 798 |
| 457 | Ga0496105_1178233 | 3300048908 | Bacteria | 565 |
| 458 | Ga0496106_0248521 | 3300048909 | Bacteria | 1422 |
| 459 | Ga0496108_0106778 | 3300048911 | Bacteria | 2391 |
| 460 | Ga0496108_0320364 | 3300048911 | Bacteria | 1352 |
| 461 | Ga0496108_0843029 | 3300048911 | Bacteria | 789 |
| 462 | Ga0496109_0060704 | 3300048912 | Bacteria | 3455 |
| 463 | Ga0496109_1255409 | 3300048912 | Bacteria | 677 |
| 464 | Ga0496110_0296428 | 3300048913 | Bacteria | 1473 |
| 465 | Ga0496110_0558842 | 3300048913 | Bacteria | 1040 |
| 466 | Ga0496110_0584306 | 3300048913 | Bacteria | 1014 |
| 467 | Ga0496110_0664142 | 3300048913 | Bacteria | 943 |
| 468 | Ga0496110_0790481 | 3300048913 | Bacteria | 853 |
| 469 | Ga0496111_0180555 | 3300048914 | Bacteria | 1569 |
| 470 | Ga0496111_0551534 | 3300048914 | Bacteria | 846 |
| 471 | Ga0496111_0906303 | 3300048914 | Bacteria | 635 |
| 472 | Ga0496112_0644485 | 3300048915 | Bacteria | 989 |
| 473 | Ga0496112_0878566 | 3300048915 | Bacteria | 819 |
| 474 | Ga0496112_1167396 | 3300048915 | Bacteria | 687 |
| 475 | Ga0496113_0341037 | 3300048916 | Bacteria | 1202 |
| 476 | Ga0496113_0394024 | 3300048916 | Bacteria | 1112 |
| 477 | Ga0496114_0032318 | 3300048917 | Bacteria | 4306 |
| 478 | Ga0496114_0569221 | 3300048917 | Bacteria | 1000 |
| 479 | Ga0496114_1021108 | 3300048917 | Bacteria | 711 |
| 480 | Ga0496114_1159845 | 3300048917 | Bacteria | 658 |
| 481 | Ga0496114_1287520 | 3300048917 | Bacteria | 618 |
| 482 | Ga0496114_1749973 | 3300048917 | Bacteria | 510 |
| 483 | Ga0496115_0230056 | 3300048918 | Bacteria | 1529 |
| 484 | Ga0496115_0435781 | 3300048918 | Bacteria | 1060 |
| 485 | Ga0496115_1090322 | 3300048918 | Bacteria | 606 |
| 486 | Ga0501031_0020256 | 3300049568 | Bacteria | 4337 |
| 487 | Ga0501031_0156187 | 3300049568 | Bacteria | 1491 |
| 488 | Ga0501031_1060261 | 3300049568 | Bacteria | 517 |
| 489 | Ga0501032_0002622 | 3300049569 | Bacteria | 14061 |
| 490 | Ga0501032_0241796 | 3300049569 | Bacteria | 1173 |
| 491 | Ga0501033_0000586 | 3300049570 | Bacteria | 33688 |
| 492 | Ga0501033_0007082 | 3300049570 | Bacteria | 8756 |
| 493 | Ga0501033_0107686 | 3300049570 | Bacteria | 2030 |
| 494 | Ga0501033_0331236 | 3300049570 | Bacteria | 1068 |
| 495 | Ga0501034_0003206 | 3300049571 | Bacteria | 18765 |
| 496 | Ga0501034_0010612 | 3300049571 | Bacteria | 9586 |
| 497 | Ga0501034_0030403 | 3300049571 | Bacteria | 5490 |
| 498 | Ga0501034_0208645 | 3300049571 | Bacteria | 1909 |
| 499 | Ga0501034_0244440 | 3300049571 | Bacteria | 1740 |
| 500 | Ga0501034_0600312 | 3300049571 | Bacteria | 1006 |
| 501 | Ga0501034_1226092 | 3300049571 | Bacteria | 628 |
| 502 | Ga0501036_0016080 | 3300049572 | Bacteria | 6252 |
| 503 | Ga0501036_0043183 | 3300049572 | Bacteria | 3817 |
| 504 | Ga0501036_0132019 | 3300049572 | Bacteria | 2108 |
| 505 | Ga0501036_0592898 | 3300049572 | Bacteria | 919 |
| 506 | Ga0501036_0789976 | 3300049572 | Bacteria | 782 |
| 507 | Ga0501037_0003123 | 3300049573 | Bacteria | 12009 |
| 508 | Ga0501037_0119642 | 3300049573 | Bacteria | 1894 |
| 509 | Ga0501037_0198520 | 3300049573 | Bacteria | 1418 |
| 510 | Ga0501037_0312248 | 3300049573 | Bacteria | 1090 |
| 511 | Ga0501037_0395526 | 3300049573 | Bacteria | 948 |
| 512 | Ga0501037_0493189 | 3300049573 | Bacteria | 831 |
| 513 | Ga0501038_0038011 | 3300049574 | Bacteria | 4217 |
| 514 | Ga0501038_0853551 | 3300049574 | Bacteria | 674 |
| 515 | Ga0501038_1013284 | 3300049574 | Bacteria | 609 |
| 516 | Ga0501038_1112141 | 3300049574 | Bacteria | 576 |
| 517 | Ga0501039_0002563 | 3300049575 | Bacteria | 13562 |
| 518 | Ga0501039_0139633 | 3300049575 | Bacteria | 1903 |
| 519 | Ga0501039_0520170 | 3300049575 | Bacteria | 934 |
| 520 | Ga0501039_0568196 | 3300049575 | Bacteria | 890 |
| 521 | Ga0501039_1018425 | 3300049575 | Bacteria | 643 |
| 522 | Ga0501039_1305401 | 3300049575 | Bacteria | 560 |
| 523 | Ga0501040_0002053 | 3300049576 | Bacteria | 12978 |
| 524 | Ga0501040_0011866 | 3300049576 | Bacteria | 5701 |
| 525 | Ga0501040_0510273 | 3300049576 | Bacteria | 867 |
| 526 | Ga0501041_0018833 | 3300049577 | Bacteria | 4111 |
| 527 | Ga0501041_0022117 | 3300049577 | Bacteria | 3808 |
| 528 | Ga0501042_0013371 | 3300049578 | Bacteria | 5584 |
| 529 | Ga0501042_0207932 | 3300049578 | Bacteria | 1411 |
| 530 | Ga0501042_0234780 | 3300049578 | Bacteria | 1323 |
| 531 | Ga0501043_0057348 | 3300049579 | Bacteria | 3059 |
| 532 | Ga0501043_0066703 | 3300049579 | Bacteria | 2826 |
| 533 | Ga0501043_0359780 | 3300049579 | Bacteria | 1105 |
| 534 | Ga0501043_0932803 | 3300049579 | Bacteria | 621 |
| 535 | Ga0501046_0030593 | 3300049580 | Bacteria | 4368 |
| 536 | Ga0501046_0259532 | 3300049580 | Bacteria | 1277 |
| 537 | Ga0501046_0505783 | 3300049580 | Bacteria | 865 |
| 538 | Ga0501047_0106910 | 3300049581 | Bacteria | 2679 |
| 539 | Ga0501047_1012867 | 3300049581 | Bacteria | 644 |
| 540 | Ga0501048_0004571 | 3300049582 | Bacteria | 10528 |
| 541 | Ga0501048_0030108 | 3300049582 | Bacteria | 3930 |
| 542 | Ga0501048_0273052 | 3300049582 | Bacteria | 1202 |
| 543 | Ga0501048_0424780 | 3300049582 | Bacteria | 951 |
| 544 | Ga0501048_1218732 | 3300049582 | Bacteria | 541 |
| 545 | Ga0501048_1353101 | 3300049582 | Bacteria | 512 |
| 546 | Ga0501048_1382293 | 3300049582 | Bacteria | 506 |
| 547 | Ga0501067_0447471 | 3300049583 | Bacteria | 721 |
| 548 | Ga0501068_0005345 | 3300049584 | Bacteria | 7020 |
| 549 | Ga0501068_0049403 | 3300049584 | Bacteria | 2540 |
| 550 | Ga0501068_0209272 | 3300049584 | Bacteria | 1238 |
| 551 | Ga0501068_0560924 | 3300049584 | Bacteria | 743 |
| 552 | Ga0501069_0019197 | 3300049585 | Bacteria | 3694 |
| 553 | Ga0501069_0203371 | 3300049585 | Bacteria | 1148 |
| 554 | Ga0501069_0498006 | 3300049585 | Bacteria | 727 |
| 555 | Ga0501069_0599088 | 3300049585 | Bacteria | 661 |
| 556 | Ga0501070_0093284 | 3300049586 | Bacteria | 2490 |
| 557 | Ga0501070_0117073 | 3300049586 | Bacteria | 2201 |
| 558 | Ga0501070_0393615 | 3300049586 | Bacteria | 1121 |
| 559 | Ga0501070_0564877 | 3300049586 | Bacteria | 910 |
| 560 | Ga0501071_0005915 | 3300049587 | Bacteria | 7914 |
| 561 | Ga0501071_0032022 | 3300049587 | Bacteria | 3731 |
| 562 | Ga0501071_0099590 | 3300049587 | Bacteria | 2142 |
| 563 | Ga0501071_0448133 | 3300049587 | Bacteria | 988 |
| 564 | Ga0501071_0473049 | 3300049587 | Bacteria | 960 |
| 565 | Ga0501071_0679974 | 3300049587 | Bacteria | 792 |
| 566 | Ga0501072_0000404 | 3300049588 | Bacteria | 30870 |
| 567 | Ga0501072_0010936 | 3300049588 | Bacteria | 6919 |
| 568 | Ga0501072_0015662 | 3300049588 | Bacteria | 5811 |
| 569 | Ga0501072_0112249 | 3300049588 | Bacteria | 2170 |
| 570 | Ga0501072_0364644 | 3300049588 | Bacteria | 1147 |
| 571 | Ga0501073_0029052 | 3300049589 | Bacteria | 3950 |
| 572 | Ga0501073_0046586 | 3300049589 | Bacteria | 3049 |
| 573 | Ga0501073_0616410 | 3300049589 | Bacteria | 749 |
| 574 | Ga0501074_0002739 | 3300049590 | Bacteria | 12327 |
| 575 | Ga0501074_0042273 | 3300049590 | Bacteria | 3298 |
| 576 | Ga0501074_0063243 | 3300049590 | Bacteria | 2666 |
| 577 | Ga0501074_0151918 | 3300049590 | Bacteria | 1655 |
| 578 | Ga0501075_0003133 | 3300049591 | Bacteria | 11058 |
| 579 | Ga0501075_0004688 | 3300049591 | Bacteria | 9283 |
| 580 | Ga0501075_1212087 | 3300049591 | Bacteria | 572 |
| 581 | Ga0501075_1481603 | 3300049591 | Bacteria | 514 |
| 582 | Ga0501076_0002476 | 3300049592 | Bacteria | 12692 |
| 583 | Ga0501076_0007602 | 3300049592 | Bacteria | 7891 |
| 584 | Ga0501076_0039880 | 3300049592 | Bacteria | 3688 |
| 585 | Ga0501076_0204345 | 3300049592 | Bacteria | 1613 |
| 586 | Ga0501076_0288215 | 3300049592 | Bacteria | 1345 |
| 587 | Ga0501076_1507636 | 3300049592 | Bacteria | 552 |
| 588 | Ga0501077_0006635 | 3300049593 | Bacteria | 7107 |
| 589 | Ga0501077_0010895 | 3300049593 | Bacteria | 5665 |
| 590 | Ga0501079_0004185 | 3300049741 | Bacteria | 10698 |
| 591 | Ga0501079_0017365 | 3300049741 | Bacteria | 5495 |
| 592 | Ga0501079_1408769 | 3300049741 | Bacteria | 548 |
| 593 | Ga0501080_0007063 | 3300049742 | Bacteria | 10140 |
| 594 | Ga0501080_0054851 | 3300049742 | Bacteria | 3711 |
| 595 | Ga0501080_0255999 | 3300049742 | Bacteria | 1596 |
| 596 | Ga0501081_0006867 | 3300049743 | Bacteria | 7402 |
| 597 | Ga0501081_0361648 | 3300049743 | Bacteria | 1070 |
| 598 | Ga0501081_0825252 | 3300049743 | Bacteria | 698 |
| 599 | Ga0501081_1532983 | 3300049743 | Bacteria | 506 |
| 600 | Ga0501083_0039064 | 3300049744 | Bacteria | 3224 |
| 601 | Ga0501083_0060423 | 3300049744 | Bacteria | 2532 |
| 602 | Ga0501083_0175360 | 3300049744 | Bacteria | 1401 |
| 603 | Ga0501035_0113375 | 3300049822 | Bacteria | 2375 |
| 604 | Ga0501035_0306310 | 3300049822 | Bacteria | 1337 |
| 605 | Ga0501035_0899635 | 3300049822 | Bacteria | 701 |
| 606 | Ga0501035_1518323 | 3300049822 | Bacteria | 510 |
| 607 | Ga0501044_0005788 | 3300049823 | Bacteria | 13687 |
| 608 | Ga0501044_0007378 | 3300049823 | Bacteria | 12090 |
| 609 | Ga0501044_0932126 | 3300049823 | Bacteria | 742 |
| 610 | Ga0501044_1055992 | 3300049823 | Bacteria | 683 |
| 611 | Ga0501045_0002201 | 3300049824 | Bacteria | 13214 |
| 612 | Ga0501045_0012325 | 3300049824 | Bacteria | 6019 |
| 613 | Ga0501045_1246749 | 3300049824 | Bacteria | 542 |
| 614 | nmdc:mga03683_135598_c1 | 3300050489 | Bacteria | 1104 |
| 615 | nmdc:mga00v17_1062363_c1 | 3300050491 | Bacteria | 508 |
| 616 | nmdc:mga00v17_260114_c1 | 3300050491 | Bacteria | 1126 |
| 617 | nmdc:mga00v17_81415_c1 | 3300050491 | Bacteria | 2022 |
| 618 | nmdc:mga0yw44_1138384_c1 | 3300050492 | Bacteria | 527 |
| 619 | nmdc:mga0yw44_151101_c1 | 3300050492 | Bacteria | 1174 |
| 620 | nmdc:mga0yw44_182969_c1 | 3300050492 | Bacteria | 1380 |
| 621 | nmdc:mga0yw44_259460_c1 | 3300050492 | Bacteria | 1158 |
| 622 | nmdc:mga0yw44_431300_c1 | 3300050492 | Bacteria | 893 |
| 623 | nmdc:mga0yw44_50327_c1 | 3300050492 | Bacteria | 2519 |
| 624 | nmdc:mga0k408_626622_c1 | 3300050493 | Bacteria | 633 |
| 625 | nmdc:mga06z11_412145_c1 | 3300050494 | Bacteria | 814 |
| 626 | nmdc:mga04h51_538757_c1 | 3300050495 | Bacteria | 502 |
| 627 | nmdc:mga05p37_1641956_c1 | 3300050507 | Bacteria | 630 |
| 628 | nmdc:mga05p37_218630_c1 | 3300050507 | Bacteria | 2300 |
| 629 | nmdc:mga05p37_24020_c1 | 3300050507 | Bacteria | 7404 |
| 630 | nmdc:mga05p37_450163_c1 | 3300050507 | Bacteria | 1491 |
| 631 | nmdc:mga05p37_47080_c1 | 3300050507 | Bacteria | 5303 |
| 632 | nmdc:mga09592_183_c1 | 3300050508 | Bacteria | 44709 |
| 633 | nmdc:mga09592_23438_c1 | 3300050508 | Bacteria | 5099 |
| 634 | nmdc:mga09592_47724_c1 | 3300050508 | Bacteria | 3610 |
| 635 | nmdc:mga09592_98529_c1 | 3300050508 | Bacteria | 2502 |
| 636 | nmdc:mga0qj67_111369_c1 | 3300050509 | Bacteria | 2210 |
| 637 | nmdc:mga0qj67_1362695_c1 | 3300050509 | Bacteria | 548 |
| 638 | nmdc:mga0qj67_49649_c1 | 3300050509 | Bacteria | 3316 |
| 639 | nmdc:mga0qj67_5012_c1 | 3300050509 | Bacteria | 9622 |
| 640 | nmdc:mga06r32_120569_c1 | 3300050510 | Bacteria | 2587 |
| 641 | nmdc:mga06r32_126116_c1 | 3300050510 | Bacteria | 2529 |
| 642 | nmdc:mga06r32_1274081_c1 | 3300050510 | Bacteria | 680 |
| 643 | nmdc:mga06r32_158317_c1 | 3300050510 | Bacteria | 2247 |
| 644 | nmdc:mga06r32_1710178_c1 | 3300050510 | Bacteria | 566 |
| 645 | nmdc:mga06r32_221909_c1 | 3300050510 | Bacteria | 1878 |
| 646 | nmdc:mga06r32_342_c1 | 3300050510 | Bacteria | 38838 |
| 647 | nmdc:mga08y16_1127282_c1 | 3300050511 | Bacteria | 758 |
| 648 | nmdc:mga08y16_164043_c1 | 3300050511 | Bacteria | 2308 |
| 649 | nmdc:mga08y16_74751_c1 | 3300050511 | Bacteria | 3532 |
| 650 | nmdc:mga0n895_115481_c1 | 3300050512 | Bacteria | 2703 |
| 651 | nmdc:mga0n895_2092794_c1 | 3300050512 | Bacteria | 522 |
| 652 | nmdc:mga0rr50_1019012_c1 | 3300050513 | Bacteria | 705 |
| 653 | nmdc:mga0rr50_1745_c1 | 3300050513 | Bacteria | 11991 |
| 654 | nmdc:mga0rr50_1903491_c1 | 3300050513 | Bacteria | 500 |
| 655 | nmdc:mga0rr50_257839_c1 | 3300050513 | Bacteria | 1450 |
| 656 | nmdc:mga0rr50_842387_c1 | 3300050513 | Bacteria | 782 |
| 657 | nmdc:mga08x19_4128_c1 | 3300050514 | Bacteria | 8615 |
| 658 | nmdc:mga08x19_930391_c1 | 3300050514 | Bacteria | 617 |
| 659 | nmdc:mga0a205_25778_c1 | 3300050515 | Bacteria | 5602 |
| 660 | Ga0495601_0368983 | 3300053077 | Bacteria | 932 |
| 661 | Ga0495595_0030369 | 3300053084 | Bacteria | 2424 |
| 662 | Ga0495595_0185874 | 3300053084 | Bacteria | 1031 |
| 663 | Ga0495595_0273127 | 3300053084 | Bacteria | 848 |
| 664 | Ga0495619_0069359 | 3300053085 | Bacteria | 2356 |
| 665 | Ga0495619_0081922 | 3300053085 | Bacteria | 2174 |
| 666 | Ga0495619_0323117 | 3300053085 | Bacteria | 1068 |
| 667 | Ga0500566_0341682 | 3300053094 | Bacteria | 689 |
| 668 | Ga0500650_0157516 | 3300053098 | Bacteria | 1048 |
| 669 | Ga0500616_0000816 | 3300053153 | Bacteria | 35390 |
| 670 | Ga0501084_0004976 | 3300054114 | Bacteria | 10867 |
| 671 | Ga0501084_0072401 | 3300054114 | Bacteria | 2886 |
| 672 | Ga0501084_0112467 | 3300054114 | Bacteria | 2288 |
| 673 | Ga0501084_1029920 | 3300054114 | Bacteria | 692 |
| 674 | Ga0587070_119409 | 3300059491 | Bacteria | 629 |
| 675 | Ga0587073_0277747 | 3300059492 | Bacteria | 536 |
| 676 | Ga0587080_160426 | 3300059503 | Bacteria | 527 |
| 677 | Ga0587082_132818 | 3300059504 | Bacteria | 573 |
| 678 | Ga0587085_185613 | 3300059506 | Bacteria | 501 |
| 679 | Ga0587088_045312 | 3300059508 | Bacteria | 843 |
| 680 | Ga0587091_135892 | 3300059511 | Bacteria | 611 |
| 681 | Ga0587094_026889 | 3300059513 | Bacteria | 870 |
| 682 | Ga0587094_121373 | 3300059513 | Bacteria | 524 |
| 683 | Ga0587106_130452 | 3300059605 | Bacteria | 542 |
| 684 | Ga0587109_062669 | 3300059624 | Bacteria | 787 |
| 685 | Ga0587117_058990 | 3300059627 | Bacteria | 655 |
| 686 | Ga0587122_047037 | 3300059628 | Bacteria | 551 |
| 687 | Ga0587128_018752 | 3300059630 | Bacteria | 1040 |
| 688 | Ga0587128_101709 | 3300059630 | Bacteria | 603 |
| 689 | Ga0587062_060811 | 3300059639 | Bacteria | 662 |
| 690 | Ga0587062_070200 | 3300059639 | Bacteria | 632 |
| 691 | Ga0587067_104502 | 3300059640 | Bacteria | 660 |
| 692 | Ga0587067_112143 | 3300059640 | Bacteria | 645 |
| 693 | Ga0587067_128376 | 3300059640 | Bacteria | 616 |
| 694 | Ga0587069_029618 | 3300059642 | Bacteria | 877 |
| 695 | Ga0587114_048052 | 3300059655 | Bacteria | 714 |
| 696 | Ga0587114_138970 | 3300059655 | Bacteria | 506 |
| 697 | Ga0501082_0018922 | 3300060353 | Bacteria | 5933 |
| 698 | Ga0501082_0068849 | 3300060353 | Bacteria | 3047 |
| 699 | Ga0501082_0193846 | 3300060353 | Bacteria | 1767 |
| 700 | Ga0501082_0383828 | 3300060353 | Bacteria | 1226 |
| 701 | Ga0501082_1709867 | 3300060353 | Bacteria | 549 |
| 702 | Ga0530510_0000429 | 3300061734 | Bacteria | 27096 |
| 703 | Ga0530510_0008315 | 3300061734 | Bacteria | 7237 |
| 704 | Ga0530510_0010398 | 3300061734 | Bacteria | 6523 |
| 705 | Ga0530510_0071866 | 3300061734 | Bacteria | 2512 |
| 706 | Ga0530510_0770595 | 3300061734 | Bacteria | 734 |
| 707 | Ga0530510_0891215 | 3300061734 | Bacteria | 680 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003911 | JGI25405J52794_10004901 | JGI25405J52794_100049012 | 54 |
| 2 | 3300003911 | JGI25405J52794_10019605 | JGI25405J52794_100196052 | 54 |
| 3 | 3300004799 | Ga0058863_11587950 | Ga0058863_115879502 | 54 |
| 4 | 3300005293 | Ga0065715_10220399 | Ga0065715_102203992 | 54 |
| 5 | 3300005327 | Ga0070658_11958811 | Ga0070658_119588112 | 54 |
| 6 | 3300005329 | Ga0070683_100295217 | Ga0070683_1002952172 | 54 |
| 7 | 3300005331 | Ga0070670_101830984 | Ga0070670_1018309842 | 54 |
| 8 | 3300005336 | Ga0070680_100837301 | Ga0070680_1008373012 | 54 |
| 9 | 3300005336 | Ga0070680_100924178 | Ga0070680_1009241782 | 54 |
| 10 | 3300005336 | Ga0070680_101886028 | Ga0070680_1018860281 | 54 |
| 11 | 3300005336 | Ga0070680_101909176 | Ga0070680_1019091761 | 54 |
| 12 | 3300005337 | Ga0070682_101219823 | Ga0070682_1012198232 | 54 |
| 13 | 3300005337 | Ga0070682_101329966 | Ga0070682_1013299662 | 54 |
| 14 | 3300005338 | Ga0068868_102361680 | Ga0068868_1023616802 | 54 |
| 15 | 3300005343 | Ga0070687_100373703 | Ga0070687_1003737032 | 54 |
| 16 | 3300005344 | Ga0070661_101121711 | Ga0070661_1011217111 | 54 |
| 17 | 3300005354 | Ga0070675_100720717 | Ga0070675_1007207171 | 54 |
| 18 | 3300005355 | Ga0070671_100081875 | Ga0070671_1000818755 | 54 |
| 19 | 3300005355 | Ga0070671_101641711 | Ga0070671_1016417111 | 54 |
| 20 | 3300005356 | Ga0070674_100965481 | Ga0070674_1009654812 | 54 |
| 21 | 3300005366 | Ga0070659_100536174 | Ga0070659_1005361741 | 54 |
| 22 | 3300005366 | Ga0070659_101832681 | Ga0070659_1018326811 | 54 |
| 23 | 3300005367 | Ga0070667_101171537 | Ga0070667_1011715372 | 54 |
| 24 | 3300005406 | Ga0070703_10199130 | Ga0070703_101991301 | 54 |
| 25 | 3300005436 | Ga0070713_100841435 | Ga0070713_1008414352 | 54 |
| 26 | 3300005440 | Ga0070705_100004009 | Ga0070705_1000040095 | 54 |
| 27 | 3300005440 | Ga0070705_101629287 | Ga0070705_1016292872 | 54 |
| 28 | 3300005444 | Ga0070694_100662432 | Ga0070694_1006624322 | 54 |
| 29 | 3300005445 | Ga0070708_100002882 | Ga0070708_10000288221 | 54 |
| 30 | 3300005445 | Ga0070708_100010139 | Ga0070708_1000101396 | 54 |
| 31 | 3300005445 | Ga0070708_100054472 | Ga0070708_1000544728 | 54 |
| 32 | 3300005445 | Ga0070708_100197861 | Ga0070708_1001978613 | 54 |
| 33 | 3300005445 | Ga0070708_100264020 | Ga0070708_1002640202 | 54 |
| 34 | 3300005457 | Ga0070662_101454875 | Ga0070662_1014548752 | 54 |
| 35 | 3300005458 | Ga0070681_10022654 | Ga0070681_1002265411 | 54 |
| 36 | 3300005458 | Ga0070681_10283665 | Ga0070681_102836654 | 54 |
| 37 | 3300005459 | Ga0068867_101862662 | Ga0068867_1018626621 | 54 |
| 38 | 3300005467 | Ga0070706_100068700 | Ga0070706_1000687005 | 54 |
| 39 | 3300005467 | Ga0070706_100075943 | Ga0070706_1000759437 | 54 |
| 40 | 3300005467 | Ga0070706_100489090 | Ga0070706_1004890903 | 54 |
| 41 | 3300005468 | Ga0070707_100142593 | Ga0070707_1001425934 | 54 |
| 42 | 3300005468 | Ga0070707_100909345 | Ga0070707_1009093452 | 54 |
| 43 | 3300005471 | Ga0070698_100045833 | Ga0070698_1000458338 | 54 |
| 44 | 3300005471 | Ga0070698_101693886 | Ga0070698_1016938862 | 54 |
| 45 | 3300005518 | Ga0070699_100059059 | Ga0070699_1000590597 | 54 |
| 46 | 3300005518 | Ga0070699_100708528 | Ga0070699_1007085282 | 54 |
| 47 | 3300005518 | Ga0070699_101712313 | Ga0070699_1017123132 | 54 |
| 48 | 3300005530 | Ga0070679_100471497 | Ga0070679_1004714972 | 54 |
| 49 | 3300005530 | Ga0070679_100498385 | Ga0070679_1004983853 | 54 |
| 50 | 3300005530 | Ga0070679_100664457 | Ga0070679_1006644573 | 54 |
| 51 | 3300005535 | Ga0070684_100711310 | Ga0070684_1007113102 | 54 |
| 52 | 3300005535 | Ga0070684_101085855 | Ga0070684_1010858552 | 54 |
| 53 | 3300005535 | Ga0070684_101325386 | Ga0070684_1013253862 | 54 |
| 54 | 3300005536 | Ga0070697_100211578 | Ga0070697_1002115784 | 54 |
| 55 | 3300005536 | Ga0070697_101511690 | Ga0070697_1015116901 | 54 |
| 56 | 3300005543 | Ga0070672_100144963 | Ga0070672_1001449634 | 54 |
| 57 | 3300005544 | Ga0070686_101841393 | Ga0070686_1018413932 | 54 |
| 58 | 3300005545 | Ga0070695_100011172 | Ga0070695_1000111729 | 54 |
| 59 | 3300005545 | Ga0070695_100555881 | Ga0070695_1005558812 | 54 |
| 60 | 3300005546 | Ga0070696_100012226 | Ga0070696_1000122264 | 54 |
| 61 | 3300005546 | Ga0070696_100251830 | Ga0070696_1002518302 | 54 |
| 62 | 3300005546 | Ga0070696_100430175 | Ga0070696_1004301753 | 54 |
| 63 | 3300005549 | Ga0070704_100043449 | Ga0070704_1000434492 | 54 |
| 64 | 3300005549 | Ga0070704_100852693 | Ga0070704_1008526932 | 54 |
| 65 | 3300005549 | Ga0070704_100872085 | Ga0070704_1008720852 | 54 |
| 66 | 3300005549 | Ga0070704_101244632 | Ga0070704_1012446322 | 54 |
| 67 | 3300005549 | Ga0070704_102205766 | Ga0070704_1022057662 | 54 |
| 68 | 3300005563 | Ga0068855_100898522 | Ga0068855_1008985222 | 54 |
| 69 | 3300005563 | Ga0068855_101167947 | Ga0068855_1011679472 | 54 |
| 70 | 3300005563 | Ga0068855_101183335 | Ga0068855_1011833352 | 54 |
| 71 | 3300005563 | Ga0068855_102164467 | Ga0068855_1021644672 | 54 |
| 72 | 3300005577 | Ga0068857_102039935 | Ga0068857_1020399352 | 54 |
| 73 | 3300005614 | Ga0068856_100179013 | Ga0068856_1001790136 | 54 |
| 74 | 3300005614 | Ga0068856_102651037 | Ga0068856_1026510371 | 54 |
| 75 | 3300005616 | Ga0068852_100749286 | Ga0068852_1007492863 | 54 |
| 76 | 3300005617 | Ga0068859_101051495 | Ga0068859_1010514951 | 54 |
| 77 | 3300005718 | Ga0068866_11222192 | Ga0068866_112221922 | 54 |
| 78 | 3300005843 | Ga0068860_100715425 | Ga0068860_1007154252 | 54 |
| 79 | 3300005937 | Ga0081455_10001246 | Ga0081455_100012469 | 54 |
| 80 | 3300005937 | Ga0081455_10019861 | Ga0081455_100198619 | 54 |
| 81 | 3300005937 | Ga0081455_10074703 | Ga0081455_100747033 | 54 |
| 82 | 3300005937 | Ga0081455_10085652 | Ga0081455_100856526 | 54 |
| 83 | 3300005937 | Ga0081455_10182101 | Ga0081455_101821014 | 54 |
| 84 | 3300005937 | Ga0081455_10817738 | Ga0081455_108177382 | 54 |
| 85 | 3300005981 | Ga0081538_10012203 | Ga0081538_100122038 | 54 |
| 86 | 3300005981 | Ga0081538_10066834 | Ga0081538_100668344 | 54 |
| 87 | 3300005981 | Ga0081538_10082905 | Ga0081538_100829051 | 54 |
| 88 | 3300005981 | Ga0081538_10176800 | Ga0081538_101768002 | 54 |
| 89 | 3300006038 | Ga0075365_10103174 | Ga0075365_101031745 | 54 |
| 90 | 3300006038 | Ga0075365_10299062 | Ga0075365_102990622 | 54 |
| 91 | 3300006038 | Ga0075365_10516571 | Ga0075365_105165713 | 54 |
| 92 | 3300006042 | Ga0075368_10247087 | Ga0075368_102470872 | 54 |
| 93 | 3300006048 | Ga0075363_100315687 | Ga0075363_1003156872 | 54 |
| 94 | 3300006051 | Ga0075364_10384433 | Ga0075364_103844333 | 54 |
| 95 | 3300006173 | Ga0070716_101688136 | Ga0070716_1016881362 | 54 |
| 96 | 3300006175 | Ga0070712_101891342 | Ga0070712_1018913422 | 54 |
| 97 | 3300006177 | Ga0075362_10240646 | Ga0075362_102406463 | 54 |
| 98 | 3300006178 | Ga0075367_10738087 | Ga0075367_107380872 | 54 |
| 99 | 3300006186 | Ga0075369_10211607 | Ga0075369_102116072 | 54 |
| 100 | 3300006194 | Ga0075427_10058576 | Ga0075427_100585761 | 54 |
| 101 | 3300006237 | Ga0097621_102324722 | Ga0097621_1023247221 | 54 |
| 102 | 3300006353 | Ga0075370_10633424 | Ga0075370_106334241 | 54 |
| 103 | 3300006353 | Ga0075370_10680404 | Ga0075370_106804042 | 54 |
| 104 | 3300006358 | Ga0068871_100657964 | Ga0068871_1006579641 | 54 |
| 105 | 3300006844 | Ga0075428_100006199 | Ga0075428_1000061995 | 54 |
| 106 | 3300006844 | Ga0075428_100034071 | Ga0075428_1000340717 | 54 |
| 107 | 3300006844 | Ga0075428_100058733 | Ga0075428_1000587334 | 54 |
| 108 | 3300006844 | Ga0075428_100260598 | Ga0075428_1002605983 | 54 |
| 109 | 3300006844 | Ga0075428_102294481 | Ga0075428_1022944812 | 54 |
| 110 | 3300006846 | Ga0075430_100006208 | Ga0075430_1000062089 | 54 |
| 111 | 3300006846 | Ga0075430_100012317 | Ga0075430_1000123179 | 54 |
| 112 | 3300006846 | Ga0075430_100130160 | Ga0075430_1001301607 | 54 |
| 113 | 3300006846 | Ga0075430_100595749 | Ga0075430_1005957492 | 54 |
| 114 | 3300006847 | Ga0075431_100026546 | Ga0075431_1000265463 | 54 |
| 115 | 3300006847 | Ga0075431_100039453 | Ga0075431_1000394536 | 54 |
| 116 | 3300006847 | Ga0075431_100101856 | Ga0075431_1001018565 | 54 |
| 117 | 3300006847 | Ga0075431_100422381 | Ga0075431_1004223812 | 54 |
| 118 | 3300006847 | Ga0075431_102040331 | Ga0075431_1020403312 | 54 |
| 119 | 3300006852 | Ga0075433_10002059 | Ga0075433_1000205920 | 54 |
| 120 | 3300006871 | Ga0075434_100004000 | Ga0075434_10000400017 | 54 |
| 121 | 3300006871 | Ga0075434_100501225 | Ga0075434_1005012252 | 54 |
| 122 | 3300006871 | Ga0075434_100521092 | Ga0075434_1005210923 | 54 |
| 123 | 3300006871 | Ga0075434_100883286 | Ga0075434_1008832863 | 54 |
| 124 | 3300006880 | Ga0075429_100001166 | Ga0075429_10000116617 | 54 |
| 125 | 3300006880 | Ga0075429_100035358 | Ga0075429_1000353588 | 54 |
| 126 | 3300006880 | Ga0075429_100073670 | Ga0075429_1000736705 | 54 |
| 127 | 3300006880 | Ga0075429_100080207 | Ga0075429_1000802075 | 54 |
| 128 | 3300006880 | Ga0075429_100799658 | Ga0075429_1007996582 | 54 |
| 129 | 3300006914 | Ga0075436_100044915 | Ga0075436_1000449152 | 54 |
| 130 | 3300006931 | Ga0097620_101051447 | Ga0097620_1010514472 | 54 |
| 131 | 3300007076 | Ga0075435_100039605 | Ga0075435_1000396052 | 54 |
| 132 | 3300007076 | Ga0075435_101292323 | Ga0075435_1012923232 | 54 |
| 133 | 3300009093 | Ga0105240_10590877 | Ga0105240_105908773 | 54 |
| 134 | 3300009093 | Ga0105240_12194005 | Ga0105240_121940052 | 54 |
| 135 | 3300009094 | Ga0111539_10028860 | Ga0111539_1002886010 | 54 |
| 136 | 3300009094 | Ga0111539_10092465 | Ga0111539_100924658 | 54 |
| 137 | 3300009094 | Ga0111539_10156465 | Ga0111539_101564657 | 54 |
| 138 | 3300009094 | Ga0111539_10863583 | Ga0111539_108635832 | 54 |
| 139 | 3300009094 | Ga0111539_12392350 | Ga0111539_123923502 | 54 |
| 140 | 3300009098 | Ga0105245_10842196 | Ga0105245_108421963 | 54 |
| 141 | 3300009098 | Ga0105245_11299592 | Ga0105245_112995922 | 54 |
| 142 | 3300009147 | Ga0114129_10045478 | Ga0114129_100454788 | 54 |
| 143 | 3300009147 | Ga0114129_10253665 | Ga0114129_102536656 | 54 |
| 144 | 3300009147 | Ga0114129_10538457 | Ga0114129_105384572 | 54 |
| 145 | 3300009147 | Ga0114129_10543643 | Ga0114129_105436432 | 54 |
| 146 | 3300009147 | Ga0114129_10877341 | Ga0114129_108773412 | 54 |
| 147 | 3300009148 | Ga0105243_10425232 | Ga0105243_104252322 | 54 |
| 148 | 3300009148 | Ga0105243_12921906 | Ga0105243_129219062 | 54 |
| 149 | 3300009174 | Ga0105241_10694866 | Ga0105241_106948662 | 54 |
| 150 | 3300009174 | Ga0105241_11060672 | Ga0105241_110606722 | 54 |
| 151 | 3300009176 | Ga0105242_10173533 | Ga0105242_101735333 | 54 |
| 152 | 3300009177 | Ga0105248_11382012 | Ga0105248_113820121 | 54 |
| 153 | 3300009545 | Ga0105237_10194860 | Ga0105237_101948604 | 54 |
| 154 | 3300009545 | Ga0105237_11757183 | Ga0105237_117571832 | 54 |
| 155 | 3300009551 | Ga0105238_11040475 | Ga0105238_110404752 | 54 |
| 156 | 3300009551 | Ga0105238_11230575 | Ga0105238_112305751 | 54 |
| 157 | 3300009551 | Ga0105238_12105830 | Ga0105238_121058302 | 54 |
| 158 | 3300009551 | Ga0105238_12682894 | Ga0105238_126828942 | 54 |
| 159 | 3300009553 | Ga0105249_12297973 | Ga0105249_122979732 | 54 |
| 160 | 3300010375 | Ga0105239_10662241 | Ga0105239_106622413 | 54 |
| 161 | 3300010375 | Ga0105239_12497406 | Ga0105239_124974062 | 54 |
| 162 | 3300010375 | Ga0105239_12553468 | Ga0105239_125534682 | 54 |
| 163 | 3300011119 | Ga0105246_10461397 | Ga0105246_104613973 | 54 |
| 164 | 3300011119 | Ga0105246_11475645 | Ga0105246_114756452 | 54 |
| 165 | 3300012507 | Ga0157342_1038308 | Ga0157342_10383082 | 54 |
| 166 | 3300013100 | Ga0157373_11042943 | Ga0157373_110429432 | 54 |
| 167 | 3300013102 | Ga0157371_10385932 | Ga0157371_103859323 | 54 |
| 168 | 3300013104 | Ga0157370_10742003 | Ga0157370_107420032 | 54 |
| 169 | 3300013105 | Ga0157369_10513161 | Ga0157369_105131613 | 54 |
| 170 | 3300013297 | Ga0157378_11654735 | Ga0157378_116547352 | 54 |
| 171 | 3300013297 | Ga0157378_12418023 | Ga0157378_124180232 | 54 |
| 172 | 3300013306 | Ga0163162_11393423 | Ga0163162_113934232 | 54 |
| 173 | 3300013306 | Ga0163162_12604806 | Ga0163162_126048061 | 54 |
| 174 | 3300013307 | Ga0157372_10876526 | Ga0157372_108765263 | 54 |
| 175 | 3300013308 | Ga0157375_11782241 | Ga0157375_117822411 | 54 |
| 176 | 3300014325 | Ga0163163_10684354 | Ga0163163_106843543 | 54 |
| 177 | 3300014325 | Ga0163163_11480285 | Ga0163163_114802852 | 54 |
| 178 | 3300014326 | Ga0157380_11442300 | Ga0157380_114423002 | 54 |
| 179 | 3300014326 | Ga0157380_11601090 | Ga0157380_116010902 | 54 |
| 180 | 3300014745 | Ga0157377_11373179 | Ga0157377_113731792 | 54 |
| 181 | 3300014968 | Ga0157379_10713626 | Ga0157379_107136263 | 54 |
| 182 | 3300014968 | Ga0157379_12606513 | Ga0157379_126065131 | 54 |
| 183 | 3300014969 | Ga0157376_10525657 | Ga0157376_105256573 | 54 |
| 184 | 3300014969 | Ga0157376_11442519 | Ga0157376_114425192 | 54 |
| 185 | 3300020069 | Ga0197907_10151244 | Ga0197907_101512442 | 54 |
| 186 | 3300020078 | Ga0206352_11181811 | Ga0206352_111818112 | 54 |
| 187 | 3300020081 | Ga0206354_10198866 | Ga0206354_101988662 | 54 |
| 188 | 3300020081 | Ga0206354_10579374 | Ga0206354_105793742 | 54 |
| 189 | 3300020081 | Ga0206354_11095091 | Ga0206354_110950912 | 54 |
| 190 | 3300021377 | Ga0213874_10317408 | Ga0213874_103174082 | 54 |
| 191 | 3300021388 | Ga0213875_10502884 | Ga0213875_105028841 | 54 |
| 192 | 3300022467 | Ga0224712_10258977 | Ga0224712_102589772 | 54 |
| 193 | 3300025885 | Ga0207653_10168233 | Ga0207653_101682332 | 54 |
| 194 | 3300025900 | Ga0207710_10285998 | Ga0207710_102859982 | 54 |
| 195 | 3300025901 | Ga0207688_10569820 | Ga0207688_105698202 | 54 |
| 196 | 3300025907 | Ga0207645_10387615 | Ga0207645_103876151 | 54 |
| 197 | 3300025908 | Ga0207643_10154726 | Ga0207643_101547264 | 54 |
| 198 | 3300025909 | Ga0207705_10834415 | Ga0207705_108344152 | 54 |
| 199 | 3300025910 | Ga0207684_10037904 | Ga0207684_100379047 | 54 |
| 200 | 3300025910 | Ga0207684_10067749 | Ga0207684_100677495 | 54 |
| 201 | 3300025910 | Ga0207684_10521315 | Ga0207684_105213152 | 54 |
| 202 | 3300025911 | Ga0207654_10639675 | Ga0207654_106396752 | 54 |
| 203 | 3300025911 | Ga0207654_11037421 | Ga0207654_110374211 | 54 |
| 204 | 3300025912 | Ga0207707_10303885 | Ga0207707_103038853 | 54 |
| 205 | 3300025912 | Ga0207707_10467844 | Ga0207707_104678443 | 54 |
| 206 | 3300025912 | Ga0207707_11011970 | Ga0207707_110119702 | 54 |
| 207 | 3300025913 | Ga0207695_10676123 | Ga0207695_106761232 | 54 |
| 208 | 3300025914 | Ga0207671_10465254 | Ga0207671_104652542 | 54 |
| 209 | 3300025916 | Ga0207663_11504744 | Ga0207663_115047441 | 54 |
| 210 | 3300025916 | Ga0207663_11546305 | Ga0207663_115463051 | 54 |
| 211 | 3300025917 | Ga0207660_10173107 | Ga0207660_101731072 | 54 |
| 212 | 3300025917 | Ga0207660_10630866 | Ga0207660_106308663 | 54 |
| 213 | 3300025917 | Ga0207660_10746261 | Ga0207660_107462612 | 54 |
| 214 | 3300025918 | Ga0207662_10867426 | Ga0207662_108674262 | 54 |
| 215 | 3300025921 | Ga0207652_10590324 | Ga0207652_105903242 | 54 |
| 216 | 3300025921 | Ga0207652_10701807 | Ga0207652_107018073 | 54 |
| 217 | 3300025922 | Ga0207646_10419911 | Ga0207646_104199112 | 54 |
| 218 | 3300025923 | Ga0207681_10811597 | Ga0207681_108115971 | 54 |
| 219 | 3300025923 | Ga0207681_11644922 | Ga0207681_116449222 | 54 |
| 220 | 3300025927 | Ga0207687_10570242 | Ga0207687_105702422 | 54 |
| 221 | 3300025931 | Ga0207644_10016437 | Ga0207644_100164373 | 54 |
| 222 | 3300025931 | Ga0207644_11833858 | Ga0207644_118338582 | 54 |
| 223 | 3300025932 | Ga0207690_11159828 | Ga0207690_111598281 | 54 |
| 224 | 3300025933 | Ga0207706_11074713 | Ga0207706_110747132 | 54 |
| 225 | 3300025934 | Ga0207686_10654838 | Ga0207686_106548382 | 54 |
| 226 | 3300025935 | Ga0207709_11457483 | Ga0207709_114574832 | 54 |
| 227 | 3300025936 | Ga0207670_11164960 | Ga0207670_111649602 | 54 |
| 228 | 3300025937 | Ga0207669_10468316 | Ga0207669_104683162 | 54 |
| 229 | 3300025938 | Ga0207704_10341777 | Ga0207704_103417773 | 54 |
| 230 | 3300025938 | Ga0207704_10728729 | Ga0207704_107287292 | 54 |
| 231 | 3300025939 | Ga0207665_10769798 | Ga0207665_107697982 | 54 |
| 232 | 3300025939 | Ga0207665_11143191 | Ga0207665_111431912 | 54 |
| 233 | 3300025940 | Ga0207691_10118730 | Ga0207691_101187305 | 54 |
| 234 | 3300025944 | Ga0207661_10214880 | Ga0207661_102148803 | 54 |
| 235 | 3300025944 | Ga0207661_11299597 | Ga0207661_112995972 | 54 |
| 236 | 3300025944 | Ga0207661_11395126 | Ga0207661_113951262 | 54 |
| 237 | 3300025944 | Ga0207661_11400026 | Ga0207661_114000262 | 54 |
| 238 | 3300025949 | Ga0207667_10373047 | Ga0207667_103730472 | 54 |
| 239 | 3300025949 | Ga0207667_11111089 | Ga0207667_111110892 | 54 |
| 240 | 3300025960 | Ga0207651_10137488 | Ga0207651_101374882 | 54 |
| 241 | 3300025961 | Ga0207712_11167396 | Ga0207712_111673962 | 54 |
| 242 | 3300025972 | Ga0207668_11627277 | Ga0207668_116272771 | 54 |
| 243 | 3300026023 | Ga0207677_10585338 | Ga0207677_105853382 | 54 |
| 244 | 3300026023 | Ga0207677_11453047 | Ga0207677_114530471 | 54 |
| 245 | 3300026023 | Ga0207677_11892486 | Ga0207677_118924861 | 54 |
| 246 | 3300026035 | Ga0207703_11635942 | Ga0207703_116359422 | 54 |
| 247 | 3300026075 | Ga0207708_10154426 | Ga0207708_101544264 | 54 |
| 248 | 3300026075 | Ga0207708_10205752 | Ga0207708_102057523 | 54 |
| 249 | 3300026078 | Ga0207702_11049561 | Ga0207702_110495612 | 54 |
| 250 | 3300026078 | Ga0207702_11157335 | Ga0207702_111573352 | 54 |
| 251 | 3300026078 | Ga0207702_12059462 | Ga0207702_120594622 | 54 |
| 252 | 3300026089 | Ga0207648_10371933 | Ga0207648_103719332 | 54 |
| 253 | 3300026089 | Ga0207648_11490267 | Ga0207648_114902672 | 54 |
| 254 | 3300026116 | Ga0207674_10831231 | Ga0207674_108312313 | 54 |
| 255 | 3300026118 | Ga0207675_100500511 | Ga0207675_1005005112 | 54 |
| 256 | 3300026142 | Ga0207698_11454984 | Ga0207698_114549841 | 54 |
| 257 | 3300027866 | Ga0209813_10360194 | Ga0209813_103601942 | 54 |
| 258 | 3300027876 | Ga0209974_10372268 | Ga0209974_103722682 | 54 |
| 259 | 3300027907 | Ga0207428_10029499 | Ga0207428_100294997 | 54 |
| 260 | 3300027907 | Ga0207428_10539873 | Ga0207428_105398732 | 54 |
| 261 | 3300027907 | Ga0207428_11217681 | Ga0207428_112176811 | 54 |
| 262 | 3300028381 | Ga0268264_10364274 | Ga0268264_103642743 | 54 |
| 263 | 3300028381 | Ga0268264_11053263 | Ga0268264_110532632 | 54 |
| 264 | 3300031251 | Ga0265327_10186780 | Ga0265327_101867802 | 54 |
| 265 | 3300031251 | Ga0265327_10398115 | Ga0265327_103981152 | 54 |
| 266 | 3300031251 | Ga0265327_10410393 | Ga0265327_104103931 | 54 |
| 267 | 3300031665 | Ga0316575_10261993 | Ga0316575_102619932 | 54 |
| 268 | 3300031665 | Ga0316575_10472894 | Ga0316575_104728942 | 54 |
| 269 | 3300031727 | Ga0316576_10003787 | Ga0316576_100037872 | 54 |
| 270 | 3300031727 | Ga0316576_10136842 | Ga0316576_101368424 | 54 |
| 271 | 3300031727 | Ga0316576_10289985 | Ga0316576_102899852 | 54 |
| 272 | 3300031727 | Ga0316576_10612465 | Ga0316576_106124652 | 54 |
| 273 | 3300031728 | Ga0316578_10051067 | Ga0316578_100510673 | 54 |
| 274 | 3300031731 | Ga0307405_10586286 | Ga0307405_105862862 | 54 |
| 275 | 3300031889 | Ga0326468_10053188 | Ga0326468_100531882 | 54 |
| 276 | 3300031911 | Ga0307412_11101467 | Ga0307412_111014672 | 54 |
| 277 | 3300031911 | Ga0307412_11314432 | Ga0307412_113144322 | 54 |
| 278 | 3300031995 | Ga0307409_100410741 | Ga0307409_1004107413 | 54 |
| 279 | 3300031995 | Ga0307409_101038964 | Ga0307409_1010389642 | 54 |
| 280 | 3300032002 | Ga0307416_101027404 | Ga0307416_1010274042 | 54 |
| 281 | 3300032137 | Ga0316585_10131826 | Ga0316585_101318263 | 54 |
| 282 | 3300032168 | Ga0316593_10116132 | Ga0316593_101161322 | 54 |
| 283 | 3300033541 | Ga0316596_1111917 | Ga0316596_11119172 | 54 |
| 284 | 3300034816 | Ga0373930_0000469 | Ga0373930_0000469_3903_4088 | 54 |
| 285 | 3300034817 | Ga0373948_0065273 | Ga0373948_0065273_162_347 | 54 |
| 286 | 3300034819 | Ga0373958_0099380 | Ga0373958_0099380_171_356 | 54 |
| 287 | 3300034957 | Ga0373938_0198838 | Ga0373938_0198838_133_318 | 54 |
| 288 | 3300035084 | Ga0373928_0004933 | Ga0373928_0004933_678_863 | 54 |
| 289 | 3300035084 | Ga0373928_0282089 | Ga0373928_0282089_150_335 | 54 |
| 290 | 3300035085 | Ga0373929_0000799 | Ga0373929_0000799_1757_1942 | 54 |
| 291 | 3300035089 | Ga0373944_0035109 | Ga0373944_0035109_1300_1485 | 54 |
| 292 | 3300035090 | Ga0373949_0013928 | Ga0373949_0013928_1547_1732 | 54 |
| 293 | 3300035112 | Ga0373932_0000629 | Ga0373932_0000629_8129_8314 | 54 |
| 294 | 3300035114 | Ga0373939_0465356 | Ga0373939_0465356_190_375 | 54 |
| 295 | 3300035115 | Ga0373941_0378741 | Ga0373941_0378741_64_249 | 54 |
| 296 | 3300035118 | Ga0373954_0454940 | Ga0373954_0454940_272_457 | 54 |
| 297 | 3300035121 | Ga0373960_0126464 | Ga0373960_0126464_125_310 | 54 |
| 298 | 3300035121 | Ga0373960_0383872 | Ga0373960_0383872_267_452 | 54 |
| 299 | 3300035170 | Ga0373943_0098052 | Ga0373943_0098052_748_933 | 54 |
| 300 | 3300035171 | Ga0373946_0112085 | Ga0373946_0112085_182_367 | 54 |
| 301 | 3300035172 | Ga0373955_0201827 | Ga0373955_0201827_607_792 | 54 |
| 302 | 3300035241 | Ga0373961_0255309 | Ga0373961_0255309_210_395 | 54 |
| 303 | 3300035242 | Ga0373962_0265714 | Ga0373962_0265714_348_533 | 54 |
| 304 | 3300035398 | Ga0316574_0067221 | Ga0316574_0067221_72_257 | 54 |
| 305 | 3300035398 | Ga0316574_0296929 | Ga0316574_0296929_580_765 | 54 |
| 306 | 3300035410 | Ga0373924_0415527 | Ga0373924_0415527_33_218 | 54 |
| 307 | 3300035691 | Ga0373931_0000003 | Ga0373931_0000003_387415_387600 | 54 |
| 308 | 3300035691 | Ga0373931_0272387 | Ga0373931_0272387_360_545 | 54 |
| 309 | 3300035691 | Ga0373931_0841743 | Ga0373931_0841743_272_457 | 54 |
| 310 | 3300035691 | Ga0373931_0880766 | Ga0373931_0880766_271_456 | 54 |
| 311 | 3300035691 | Ga0373931_1218138 | Ga0373931_1218138_19_204 | 54 |
| 312 | 3300035692 | Ga0373935_0994322 | Ga0373935_0994322_308_493 | 54 |
| 313 | 3300035695 | Ga0373927_1093282 | Ga0373927_1093282_248_433 | 54 |
| 314 | 3300035725 | Ga0373947_0102489 | Ga0373947_0102489_607_792 | 54 |
| 315 | 3300036401 | Ga0373937_0811315 | Ga0373937_0811315_22_207 | 54 |
| 316 | 3300036401 | Ga0373937_1962981 | Ga0373937_1962981_33_218 | 54 |
| 317 | 3300036647 | Ga0316582_0033668 | Ga0316582_0033668_2129_2314 | 54 |
| 318 | 3300036712 | Ga0316584_0027637 | Ga0316584_0027637_1640_1825 | 54 |
| 319 | 3300036712 | Ga0316584_0039289 | Ga0316584_0039289_66_251 | 54 |
| 320 | 3300036712 | Ga0316584_0091105 | Ga0316584_0091105_2088_2273 | 54 |
| 321 | 3300036712 | Ga0316584_0312602 | Ga0316584_0312602_313_498 | 54 |
| 322 | 3300037068 | Ga0373925_1316339 | Ga0373925_1316339_374_559 | 54 |
| 323 | 3300037068 | Ga0373925_1715863 | Ga0373925_1715863_133_318 | 54 |
| 324 | 3300037466 | Ga0395898_1943313 | Ga0395898_1943313_205_390 | 54 |
| 325 | 3300037853 | Ga0436364_0252787 | Ga0436364_0252787_28_213 | 54 |
| 326 | 3300037853 | Ga0436364_0502838 | Ga0436364_0502838_396_581 | 54 |
| 327 | 3300037853 | Ga0436364_1523557 | Ga0436364_1523557_24_209 | 54 |
| 328 | 3300038443 | Ga0395901_1701266 | Ga0395901_1701266_109_294 | 54 |
| 329 | 3300039062 | Ga0400483_003112 | Ga0400483_003112_1488_1673 | 54 |
| 330 | 3300039062 | Ga0400483_023236 | Ga0400483_023236_1984_2169 | 54 |
| 331 | 3300039062 | Ga0400483_131915 | Ga0400483_131915_4893_5078 | 54 |
| 332 | 3300039062 | Ga0400483_131932 | Ga0400483_131932_1958_2143 | 54 |
| 333 | 3300039062 | Ga0400483_186328 | Ga0400483_186328_4138_4323 | 54 |
| 334 | 3300039062 | Ga0400483_217638 | Ga0400483_217638_7690_7875 | 54 |
| 335 | 3300039062 | Ga0400483_218418 | Ga0400483_218418_10467_10652 | 54 |
| 336 | 3300039062 | Ga0400483_291615 | Ga0400483_291615_283_468 | 54 |
| 337 | 3300039438 | Ga0436360_0420887 | Ga0436360_0420887_287_472 | 54 |
| 338 | 3300039450 | Ga0436363_0802854 | Ga0436363_0802854_171_356 | 54 |
| 339 | 3300039450 | Ga0436363_1052075 | Ga0436363_1052075_178_363 | 54 |
| 340 | 3300039450 | Ga0436363_1149441 | Ga0436363_1149441_19_204 | 54 |
| 341 | 3300039450 | Ga0436363_1551998 | Ga0436363_1551998_513_698 | 54 |
| 342 | 3300039450 | Ga0436363_1682136 | Ga0436363_1682136_270_536 | 54 |
| 343 | 3300041452 | Ga0451793_0165964 | Ga0451793_0165964_260_445 | 54 |
| 344 | 3300041460 | Ga0451802_0293405 | Ga0451802_0293405_163_348 | 54 |
| 345 | 3300041460 | Ga0451802_0819940 | Ga0451802_0819940_45_230 | 54 |
| 346 | 3300041462 | Ga0451806_007425 | Ga0451806_007425_323_508 | 54 |
| 347 | 3300041463 | Ga0451804_0942618 | Ga0451804_0942618_77_262 | 54 |
| 348 | 3300041486 | Ga0451807_1652821 | Ga0451807_1652821_320_547 | 54 |
| 349 | 3300041486 | Ga0451807_2373495 | Ga0451807_2373495_320_505 | 54 |
| 350 | 3300041491 | Ga0451833_0784089 | Ga0451833_0784089_44_229 | 54 |
| 351 | 3300041512 | Ga0451853_2208428 | Ga0451853_2208428_257_442 | 54 |
| 352 | 3300042003 | Ga0439443_023052 | Ga0439443_023052_170_355 | 54 |
| 353 | 3300042005 | Ga0439448_0005269 | Ga0439448_0005269_2998_3183 | 54 |
| 354 | 3300042008 | Ga0439450_107624 | Ga0439450_107624_304_489 | 54 |
| 355 | 3300042009 | Ga0439451_059104 | Ga0439451_059104_299_484 | 54 |
| 356 | 3300042011 | Ga0439454_000932 | Ga0439454_000932_489_674 | 54 |
| 357 | 3300042013 | Ga0439456_043183 | Ga0439456_043183_451_636 | 54 |
| 358 | 3300042016 | Ga0439463_001342 | Ga0439463_001342_3668_3853 | 54 |
| 359 | 3300042122 | Ga0450920_067475 | Ga0450920_067475_173_358 | 54 |
| 360 | 3300042125 | Ga0450923_004570 | Ga0450923_004570_236_421 | 54 |
| 361 | 3300042436 | Ga0439435_0086387 | Ga0439435_0086387_603_788 | 54 |
| 362 | 3300042437 | Ga0439444_0102021 | Ga0439444_0102021_412_597 | 54 |
| 363 | 3300042439 | Ga0439464_0000848 | Ga0439464_0000848_831_1016 | 54 |
| 364 | 3300042461 | Ga0439460_0004479 | Ga0439460_0004479_679_864 | 54 |
| 365 | 3300042461 | Ga0439460_0242255 | Ga0439460_0242255_192_377 | 54 |
| 366 | 3300042461 | Ga0439460_0332470 | Ga0439460_0332470_336_521 | 54 |
| 367 | 3300042876 | Ga0451577_1106579 | Ga0451577_1106579_281_466 | 54 |
| 368 | 3300042993 | Ga0439440_0003816 | Ga0439440_0003816_1934_2119 | 54 |
| 369 | 3300044694 | Ga0466963_1213182 | Ga0466963_1213182_95_280 | 54 |
| 370 | 3300044735 | Ga0466968_0135235 | Ga0466968_0135235_400_585 | 54 |
| 371 | 3300044901 | Ga0466960_0987889 | Ga0466960_0987889_182_367 | 54 |
| 372 | 3300045976 | Ga0466967_0242667 | Ga0466967_0242667_22_207 | 54 |
| 373 | 3300045976 | Ga0466967_0756998 | Ga0466967_0756998_529_714 | 54 |
| 374 | 3300045976 | Ga0466967_2024266 | Ga0466967_2024266_277_462 | 54 |
| 375 | 3300046454 | Ga0495592_0406759 | Ga0495592_0406759_500_685 | 54 |
| 376 | 3300046455 | Ga0495603_0084466 | Ga0495603_0084466_1354_1539 | 54 |
| 377 | 3300046455 | Ga0495603_0790550 | Ga0495603_0790550_137_322 | 54 |
| 378 | 3300046459 | Ga0495629_0074831 | Ga0495629_0074831_361_546 | 54 |
| 379 | 3300046459 | Ga0495629_0416273 | Ga0495629_0416273_647_832 | 54 |
| 380 | 3300046459 | Ga0495629_0740021 | Ga0495629_0740021_116_301 | 54 |
| 381 | 3300046461 | Ga0495641_0347658 | Ga0495641_0347658_119_304 | 54 |
| 382 | 3300046461 | Ga0495641_0472868 | Ga0495641_0472868_211_396 | 54 |
| 383 | 3300046461 | Ga0495641_0526205 | Ga0495641_0526205_249_434 | 54 |
| 384 | 3300046462 | Ga0495651_0557705 | Ga0495651_0557705_327_512 | 54 |
| 385 | 3300046463 | Ga0495653_0113682 | Ga0495653_0113682_220_405 | 54 |
| 386 | 3300046463 | Ga0495653_0310825 | Ga0495653_0310825_327_512 | 54 |
| 387 | 3300046463 | Ga0495653_0313092 | Ga0495653_0313092_362_547 | 54 |
| 388 | 3300046463 | Ga0495653_0399219 | Ga0495653_0399219_578_763 | 54 |
| 389 | 3300046473 | Ga0495582_0447711 | Ga0495582_0447711_146_331 | 54 |
| 390 | 3300046473 | Ga0495582_0711513 | Ga0495582_0711513_301_486 | 54 |
| 391 | 3300046475 | Ga0495639_0519882 | Ga0495639_0519882_206_391 | 54 |
| 392 | 3300046475 | Ga0495639_0562538 | Ga0495639_0562538_277_462 | 54 |
| 393 | 3300046476 | Ga0495662_0486366 | Ga0495662_0486366_83_268 | 54 |
| 394 | 3300046477 | Ga0495664_0897657 | Ga0495664_0897657_88_273 | 54 |
| 395 | 3300046514 | Ga0495618_0491630 | Ga0495618_0491630_22_207 | 54 |
| 396 | 3300046516 | Ga0495628_0237518 | Ga0495628_0237518_915_1100 | 54 |
| 397 | 3300046516 | Ga0495628_0348691 | Ga0495628_0348691_725_910 | 54 |
| 398 | 3300046517 | Ga0495630_0089420 | Ga0495630_0089420_530_715 | 54 |
| 399 | 3300046517 | Ga0495630_0538626 | Ga0495630_0538626_257_442 | 54 |
| 400 | 3300046528 | Ga0495642_0186115 | Ga0495642_0186115_27_212 | 54 |
| 401 | 3300046529 | Ga0495652_0288617 | Ga0495652_0288617_254_439 | 54 |
| 402 | 3300046529 | Ga0495652_0395801 | Ga0495652_0395801_38_223 | 54 |
| 403 | 3300046531 | Ga0495665_0238502 | Ga0495665_0238502_454_639 | 54 |
| 404 | 3300046533 | Ga0495640_0705623 | Ga0495640_0705623_103_288 | 54 |
| 405 | 3300046535 | Ga0495586_0020382 | Ga0495586_0020382_825_1010 | 54 |
| 406 | 3300046535 | Ga0495586_0575684 | Ga0495586_0575684_431_616 | 54 |
| 407 | 3300046536 | Ga0495587_0227468 | Ga0495587_0227468_145_330 | 54 |
| 408 | 3300046543 | Ga0495645_0552142 | Ga0495645_0552142_473_658 | 54 |
| 409 | 3300046543 | Ga0495645_0930239 | Ga0495645_0930239_314_499 | 54 |
| 410 | 3300046557 | Ga0495622_0048905 | Ga0495622_0048905_1377_1562 | 54 |
| 411 | 3300046559 | Ga0495667_0113042 | Ga0495667_0113042_704_889 | 54 |
| 412 | 3300046559 | Ga0495667_0457486 | Ga0495667_0457486_58_243 | 54 |
| 413 | 3300046660 | Ga0495625_0637761 | Ga0495625_0637761_55_240 | 54 |
| 414 | 3300046663 | Ga0495635_0296984 | Ga0495635_0296984_835_1020 | 54 |
| 415 | 3300046663 | Ga0495635_0520326 | Ga0495635_0520326_504_689 | 54 |
| 416 | 3300046674 | Ga0495588_0270321 | Ga0495588_0270321_176_361 | 54 |
| 417 | 3300046674 | Ga0495588_0669849 | Ga0495588_0669849_54_239 | 54 |
| 418 | 3300046675 | Ga0495657_0140444 | Ga0495657_0140444_1048_1233 | 54 |
| 419 | 3300046679 | Ga0495623_0302821 | Ga0495623_0302821_673_858 | 54 |
| 420 | 3300046680 | Ga0495646_0468266 | Ga0495646_0468266_210_395 | 54 |
| 421 | 3300046681 | Ga0495647_0029017 | Ga0495647_0029017_1426_1611 | 54 |
| 422 | 3300046681 | Ga0495647_0336861 | Ga0495647_0336861_314_499 | 54 |
| 423 | 3300046683 | Ga0495658_0285831 | Ga0495658_0285831_573_758 | 54 |
| 424 | 3300046689 | Ga0495613_0028211 | Ga0495613_0028211_1826_2011 | 54 |
| 425 | 3300046689 | Ga0495613_0407975 | Ga0495613_0407975_248_433 | 54 |
| 426 | 3300046690 | Ga0495624_0131082 | Ga0495624_0131082_174_359 | 54 |
| 427 | 3300046690 | Ga0495624_0855135 | Ga0495624_0855135_71_256 | 54 |
| 428 | 3300046794 | Ga0495589_0314922 | Ga0495589_0314922_473_658 | 54 |
| 429 | 3300046809 | Ga0495600_0131917 | Ga0495600_0131917_1122_1307 | 54 |
| 430 | 3300046809 | Ga0495600_0523565 | Ga0495600_0523565_262_447 | 54 |
| 431 | 3300047315 | Ga0495581_0230674 | Ga0495581_0230674_739_924 | 54 |
| 432 | 3300047315 | Ga0495581_0564532 | Ga0495581_0564532_314_499 | 54 |
| 433 | 3300047315 | Ga0495581_0606488 | Ga0495581_0606488_104_289 | 54 |
| 434 | 3300047315 | Ga0495581_0853714 | Ga0495581_0853714_305_490 | 54 |
| 435 | 3300047319 | Ga0495674_0078522 | Ga0495674_0078522_2146_2331 | 54 |
| 436 | 3300047319 | Ga0495674_0128531 | Ga0495674_0128531_607_792 | 54 |
| 437 | 3300047321 | Ga0495676_0068054 | Ga0495676_0068054_1578_1763 | 54 |
| 438 | 3300047321 | Ga0495676_0534621 | Ga0495676_0534621_558_743 | 54 |
| 439 | 3300047322 | Ga0495680_0049949 | Ga0495680_0049949_1112_1297 | 54 |
| 440 | 3300047322 | Ga0495680_0451867 | Ga0495680_0451867_252_437 | 54 |
| 441 | 3300047322 | Ga0495680_1029064 | Ga0495680_1029064_27_212 | 54 |
| 442 | 3300047444 | Ga0495675_0354999 | Ga0495675_0354999_578_763 | 54 |
| 443 | 3300047471 | Ga0495684_0265865 | Ga0495684_0265865_448_633 | 54 |
| 444 | 3300047471 | Ga0495684_0380426 | Ga0495684_0380426_118_303 | 54 |
| 445 | 3300048088 | Ga0495602_0282230 | Ga0495602_0282230_156_341 | 54 |
| 446 | 3300048088 | Ga0495602_0699356 | Ga0495602_0699356_286_471 | 54 |
| 447 | 3300048089 | Ga0495614_0077224 | Ga0495614_0077224_1214_1399 | 54 |
| 448 | 3300048903 | Ga0496100_0439447 | Ga0496100_0439447_390_575 | 54 |
| 449 | 3300048904 | Ga0496101_0580928 | Ga0496101_0580928_320_505 | 54 |
| 450 | 3300048904 | Ga0496101_1382644 | Ga0496101_1382644_279_464 | 54 |
| 451 | 3300048905 | Ga0496102_0080016 | Ga0496102_0080016_438_623 | 54 |
| 452 | 3300048905 | Ga0496102_0384681 | Ga0496102_0384681_868_1053 | 54 |
| 453 | 3300048905 | Ga0496102_0695419 | Ga0496102_0695419_77_262 | 54 |
| 454 | 3300048905 | Ga0496102_1678517 | Ga0496102_1678517_254_439 | 54 |
| 455 | 3300048908 | Ga0496105_0671430 | Ga0496105_0671430_153_338 | 54 |
| 456 | 3300048908 | Ga0496105_1178233 | Ga0496105_1178233_305_490 | 54 |
| 457 | 3300048909 | Ga0496106_0248521 | Ga0496106_0248521_803_988 | 54 |
| 458 | 3300048911 | Ga0496108_0106778 | Ga0496108_0106778_1193_1378 | 54 |
| 459 | 3300048911 | Ga0496108_0320364 | Ga0496108_0320364_532_717 | 54 |
| 460 | 3300048911 | Ga0496108_0843029 | Ga0496108_0843029_18_203 | 54 |
| 461 | 3300048912 | Ga0496109_0060704 | Ga0496109_0060704_2195_2380 | 54 |
| 462 | 3300048912 | Ga0496109_1255409 | Ga0496109_1255409_22_207 | 54 |
| 463 | 3300048913 | Ga0496110_0296428 | Ga0496110_0296428_1134_1319 | 54 |
| 464 | 3300048913 | Ga0496110_0558842 | Ga0496110_0558842_288_473 | 54 |
| 465 | 3300048913 | Ga0496110_0584306 | Ga0496110_0584306_377_562 | 54 |
| 466 | 3300048913 | Ga0496110_0664142 | Ga0496110_0664142_303_488 | 54 |
| 467 | 3300048913 | Ga0496110_0790481 | Ga0496110_0790481_563_748 | 54 |
| 468 | 3300048914 | Ga0496111_0180555 | Ga0496111_0180555_341_526 | 54 |
| 469 | 3300048914 | Ga0496111_0551534 | Ga0496111_0551534_174_359 | 54 |
| 470 | 3300048914 | Ga0496111_0906303 | Ga0496111_0906303_150_335 | 54 |
| 471 | 3300048915 | Ga0496112_0644485 | Ga0496112_0644485_624_809 | 54 |
| 472 | 3300048915 | Ga0496112_0878566 | Ga0496112_0878566_323_508 | 54 |
| 473 | 3300048915 | Ga0496112_1167396 | Ga0496112_1167396_401_586 | 54 |
| 474 | 3300048916 | Ga0496113_0341037 | Ga0496113_0341037_223_408 | 54 |
| 475 | 3300048916 | Ga0496113_0394024 | Ga0496113_0394024_116_301 | 54 |
| 476 | 3300048917 | Ga0496114_0032318 | Ga0496114_0032318_947_1132 | 54 |
| 477 | 3300048917 | Ga0496114_0569221 | Ga0496114_0569221_580_765 | 54 |
| 478 | 3300048917 | Ga0496114_1021108 | Ga0496114_1021108_328_513 | 54 |
| 479 | 3300048917 | Ga0496114_1159845 | Ga0496114_1159845_341_526 | 54 |
| 480 | 3300048917 | Ga0496114_1287520 | Ga0496114_1287520_412_597 | 54 |
| 481 | 3300048917 | Ga0496114_1749973 | Ga0496114_1749973_179_364 | 54 |
| 482 | 3300048918 | Ga0496115_0230056 | Ga0496115_0230056_766_951 | 54 |
| 483 | 3300048918 | Ga0496115_0435781 | Ga0496115_0435781_196_381 | 54 |
| 484 | 3300048918 | Ga0496115_1090322 | Ga0496115_1090322_34_219 | 54 |
| 485 | 3300049568 | Ga0501031_0020256 | Ga0501031_0020256_3244_3429 | 54 |
| 486 | 3300049568 | Ga0501031_0156187 | Ga0501031_0156187_595_780 | 54 |
| 487 | 3300049568 | Ga0501031_1060261 | Ga0501031_1060261_99_284 | 54 |
| 488 | 3300049569 | Ga0501032_0002622 | Ga0501032_0002622_3590_3775 | 54 |
| 489 | 3300049569 | Ga0501032_0241796 | Ga0501032_0241796_320_505 | 54 |
| 490 | 3300049570 | Ga0501033_0000586 | Ga0501033_0000586_12858_13043 | 54 |
| 491 | 3300049570 | Ga0501033_0007082 | Ga0501033_0007082_2195_2380 | 54 |
| 492 | 3300049570 | Ga0501033_0107686 | Ga0501033_0107686_1835_2020 | 54 |
| 493 | 3300049570 | Ga0501033_0331236 | Ga0501033_0331236_141_326 | 54 |
| 494 | 3300049571 | Ga0501034_0003206 | Ga0501034_0003206_14166_14351 | 54 |
| 495 | 3300049571 | Ga0501034_0010612 | Ga0501034_0010612_9105_9290 | 54 |
| 496 | 3300049571 | Ga0501034_0030403 | Ga0501034_0030403_1462_1647 | 54 |
| 497 | 3300049571 | Ga0501034_0208645 | Ga0501034_0208645_671_856 | 54 |
| 498 | 3300049571 | Ga0501034_0244440 | Ga0501034_0244440_1169_1354 | 54 |
| 499 | 3300049571 | Ga0501034_0600312 | Ga0501034_0600312_44_229 | 54 |
| 500 | 3300049571 | Ga0501034_1226092 | Ga0501034_1226092_70_255 | 54 |
| 501 | 3300049572 | Ga0501036_0016080 | Ga0501036_0016080_3327_3512 | 54 |
| 502 | 3300049572 | Ga0501036_0043183 | Ga0501036_0043183_2933_3118 | 54 |
| 503 | 3300049572 | Ga0501036_0132019 | Ga0501036_0132019_1432_1617 | 54 |
| 504 | 3300049572 | Ga0501036_0592898 | Ga0501036_0592898_440_625 | 54 |
| 505 | 3300049572 | Ga0501036_0789976 | Ga0501036_0789976_279_464 | 54 |
| 506 | 3300049573 | Ga0501037_0003123 | Ga0501037_0003123_2693_2878 | 54 |
| 507 | 3300049573 | Ga0501037_0119642 | Ga0501037_0119642_319_504 | 54 |
| 508 | 3300049573 | Ga0501037_0198520 | Ga0501037_0198520_1043_1228 | 54 |
| 509 | 3300049573 | Ga0501037_0312248 | Ga0501037_0312248_309_494 | 54 |
| 510 | 3300049573 | Ga0501037_0395526 | Ga0501037_0395526_406_591 | 54 |
| 511 | 3300049573 | Ga0501037_0493189 | Ga0501037_0493189_115_300 | 54 |
| 512 | 3300049574 | Ga0501038_0038011 | Ga0501038_0038011_1053_1238 | 54 |
| 513 | 3300049574 | Ga0501038_0853551 | Ga0501038_0853551_270_455 | 54 |
| 514 | 3300049574 | Ga0501038_1013284 | Ga0501038_1013284_122_307 | 54 |
| 515 | 3300049574 | Ga0501038_1112141 | Ga0501038_1112141_255_440 | 54 |
| 516 | 3300049575 | Ga0501039_0002563 | Ga0501039_0002563_5122_5307 | 54 |
| 517 | 3300049575 | Ga0501039_0139633 | Ga0501039_0139633_1614_1799 | 54 |
| 518 | 3300049575 | Ga0501039_0520170 | Ga0501039_0520170_445_630 | 54 |
| 519 | 3300049575 | Ga0501039_0568196 | Ga0501039_0568196_40_225 | 54 |
| 520 | 3300049575 | Ga0501039_1018425 | Ga0501039_1018425_180_365 | 54 |
| 521 | 3300049575 | Ga0501039_1305401 | Ga0501039_1305401_26_211 | 54 |
| 522 | 3300049576 | Ga0501040_0002053 | Ga0501040_0002053_11651_11836 | 54 |
| 523 | 3300049576 | Ga0501040_0011866 | Ga0501040_0011866_2931_3116 | 54 |
| 524 | 3300049576 | Ga0501040_0510273 | Ga0501040_0510273_549_734 | 54 |
| 525 | 3300049577 | Ga0501041_0018833 | Ga0501041_0018833_3518_3703 | 54 |
| 526 | 3300049577 | Ga0501041_0022117 | Ga0501041_0022117_2846_3031 | 54 |
| 527 | 3300049578 | Ga0501042_0013371 | Ga0501042_0013371_3346_3531 | 54 |
| 528 | 3300049578 | Ga0501042_0207932 | Ga0501042_0207932_925_1110 | 54 |
| 529 | 3300049578 | Ga0501042_0234780 | Ga0501042_0234780_849_1034 | 54 |
| 530 | 3300049579 | Ga0501043_0057348 | Ga0501043_0057348_2742_2927 | 54 |
| 531 | 3300049579 | Ga0501043_0066703 | Ga0501043_0066703_226_411 | 54 |
| 532 | 3300049579 | Ga0501043_0359780 | Ga0501043_0359780_833_1018 | 54 |
| 533 | 3300049579 | Ga0501043_0932803 | Ga0501043_0932803_140_325 | 54 |
| 534 | 3300049580 | Ga0501046_0030593 | Ga0501046_0030593_2352_2537 | 54 |
| 535 | 3300049580 | Ga0501046_0259532 | Ga0501046_0259532_222_407 | 54 |
| 536 | 3300049580 | Ga0501046_0505783 | Ga0501046_0505783_331_516 | 54 |
| 537 | 3300049581 | Ga0501047_0106910 | Ga0501047_0106910_1527_1712 | 54 |
| 538 | 3300049581 | Ga0501047_1012867 | Ga0501047_1012867_393_578 | 54 |
| 539 | 3300049582 | Ga0501048_0004571 | Ga0501048_0004571_10014_10199 | 54 |
| 540 | 3300049582 | Ga0501048_0030108 | Ga0501048_0030108_3727_3912 | 54 |
| 541 | 3300049582 | Ga0501048_0273052 | Ga0501048_0273052_657_842 | 54 |
| 542 | 3300049582 | Ga0501048_0424780 | Ga0501048_0424780_577_762 | 54 |
| 543 | 3300049582 | Ga0501048_1218732 | Ga0501048_1218732_166_351 | 54 |
| 544 | 3300049582 | Ga0501048_1353101 | Ga0501048_1353101_54_239 | 54 |
| 545 | 3300049582 | Ga0501048_1382293 | Ga0501048_1382293_30_215 | 54 |
| 546 | 3300049583 | Ga0501067_0447471 | Ga0501067_0447471_36_221 | 54 |
| 547 | 3300049584 | Ga0501068_0005345 | Ga0501068_0005345_2513_2698 | 54 |
| 548 | 3300049584 | Ga0501068_0049403 | Ga0501068_0049403_610_795 | 54 |
| 549 | 3300049584 | Ga0501068_0209272 | Ga0501068_0209272_783_968 | 54 |
| 550 | 3300049584 | Ga0501068_0560924 | Ga0501068_0560924_492_677 | 54 |
| 551 | 3300049585 | Ga0501069_0019197 | Ga0501069_0019197_1963_2148 | 54 |
| 552 | 3300049585 | Ga0501069_0203371 | Ga0501069_0203371_257_442 | 54 |
| 553 | 3300049585 | Ga0501069_0498006 | Ga0501069_0498006_389_574 | 54 |
| 554 | 3300049585 | Ga0501069_0599088 | Ga0501069_0599088_237_422 | 54 |
| 555 | 3300049586 | Ga0501070_0093284 | Ga0501070_0093284_1282_1467 | 54 |
| 556 | 3300049586 | Ga0501070_0117073 | Ga0501070_0117073_388_573 | 54 |
| 557 | 3300049586 | Ga0501070_0393615 | Ga0501070_0393615_275_460 | 54 |
| 558 | 3300049586 | Ga0501070_0564877 | Ga0501070_0564877_79_264 | 54 |
| 559 | 3300049587 | Ga0501071_0005915 | Ga0501071_0005915_1548_1733 | 54 |
| 560 | 3300049587 | Ga0501071_0032022 | Ga0501071_0032022_496_681 | 54 |
| 561 | 3300049587 | Ga0501071_0099590 | Ga0501071_0099590_658_843 | 54 |
| 562 | 3300049587 | Ga0501071_0448133 | Ga0501071_0448133_493_678 | 54 |
| 563 | 3300049587 | Ga0501071_0473049 | Ga0501071_0473049_756_941 | 54 |
| 564 | 3300049587 | Ga0501071_0679974 | Ga0501071_0679974_587_772 | 54 |
| 565 | 3300049588 | Ga0501072_0000404 | Ga0501072_0000404_23189_23374 | 54 |
| 566 | 3300049588 | Ga0501072_0010936 | Ga0501072_0010936_4971_5156 | 54 |
| 567 | 3300049588 | Ga0501072_0015662 | Ga0501072_0015662_3264_3449 | 54 |
| 568 | 3300049588 | Ga0501072_0112249 | Ga0501072_0112249_1766_1951 | 54 |
| 569 | 3300049588 | Ga0501072_0364644 | Ga0501072_0364644_753_938 | 54 |
| 570 | 3300049589 | Ga0501073_0029052 | Ga0501073_0029052_2172_2357 | 54 |
| 571 | 3300049589 | Ga0501073_0046586 | Ga0501073_0046586_1009_1194 | 54 |
| 572 | 3300049589 | Ga0501073_0616410 | Ga0501073_0616410_111_296 | 54 |
| 573 | 3300049590 | Ga0501074_0002739 | Ga0501074_0002739_10661_10846 | 54 |
| 574 | 3300049590 | Ga0501074_0042273 | Ga0501074_0042273_167_352 | 54 |
| 575 | 3300049590 | Ga0501074_0063243 | Ga0501074_0063243_181_366 | 54 |
| 576 | 3300049590 | Ga0501074_0151918 | Ga0501074_0151918_155_340 | 54 |
| 577 | 3300049591 | Ga0501075_0003133 | Ga0501075_0003133_7362_7547 | 54 |
| 578 | 3300049591 | Ga0501075_0004688 | Ga0501075_0004688_7789_7974 | 54 |
| 579 | 3300049591 | Ga0501075_1212087 | Ga0501075_1212087_119_304 | 54 |
| 580 | 3300049591 | Ga0501075_1481603 | Ga0501075_1481603_134_319 | 54 |
| 581 | 3300049592 | Ga0501076_0002476 | Ga0501076_0002476_2606_2791 | 54 |
| 582 | 3300049592 | Ga0501076_0007602 | Ga0501076_0007602_3110_3295 | 54 |
| 583 | 3300049592 | Ga0501076_0039880 | Ga0501076_0039880_2426_2611 | 54 |
| 584 | 3300049592 | Ga0501076_0204345 | Ga0501076_0204345_168_353 | 54 |
| 585 | 3300049592 | Ga0501076_0288215 | Ga0501076_0288215_956_1141 | 54 |
| 586 | 3300049592 | Ga0501076_1507636 | Ga0501076_1507636_188_373 | 54 |
| 587 | 3300049593 | Ga0501077_0006635 | Ga0501077_0006635_3748_3933 | 54 |
| 588 | 3300049593 | Ga0501077_0010895 | Ga0501077_0010895_2065_2250 | 54 |
| 589 | 3300049741 | Ga0501079_0004185 | Ga0501079_0004185_1305_1490 | 54 |
| 590 | 3300049741 | Ga0501079_0017365 | Ga0501079_0017365_1393_1578 | 54 |
| 591 | 3300049741 | Ga0501079_1408769 | Ga0501079_1408769_203_388 | 54 |
| 592 | 3300049742 | Ga0501080_0007063 | Ga0501080_0007063_795_980 | 54 |
| 593 | 3300049742 | Ga0501080_0054851 | Ga0501080_0054851_743_928 | 54 |
| 594 | 3300049742 | Ga0501080_0255999 | Ga0501080_0255999_786_971 | 54 |
| 595 | 3300049743 | Ga0501081_0006867 | Ga0501081_0006867_6978_7163 | 54 |
| 596 | 3300049743 | Ga0501081_0361648 | Ga0501081_0361648_92_277 | 54 |
| 597 | 3300049743 | Ga0501081_0825252 | Ga0501081_0825252_227_412 | 54 |
| 598 | 3300049743 | Ga0501081_1532983 | Ga0501081_1532983_75_260 | 54 |
| 599 | 3300049744 | Ga0501083_0039064 | Ga0501083_0039064_479_664 | 54 |
| 600 | 3300049744 | Ga0501083_0060423 | Ga0501083_0060423_65_250 | 54 |
| 601 | 3300049744 | Ga0501083_0175360 | Ga0501083_0175360_238_423 | 54 |
| 602 | 3300049822 | Ga0501035_0113375 | Ga0501035_0113375_1145_1330 | 54 |
| 603 | 3300049822 | Ga0501035_0306310 | Ga0501035_0306310_1060_1245 | 54 |
| 604 | 3300049822 | Ga0501035_0899635 | Ga0501035_0899635_472_657 | 54 |
| 605 | 3300049822 | Ga0501035_1518323 | Ga0501035_1518323_204_389 | 54 |
| 606 | 3300049823 | Ga0501044_0005788 | Ga0501044_0005788_7402_7587 | 54 |
| 607 | 3300049823 | Ga0501044_0007378 | Ga0501044_0007378_7722_7907 | 54 |
| 608 | 3300049823 | Ga0501044_0932126 | Ga0501044_0932126_68_253 | 54 |
| 609 | 3300049823 | Ga0501044_1055992 | Ga0501044_1055992_197_382 | 54 |
| 610 | 3300049824 | Ga0501045_0002201 | Ga0501045_0002201_9810_9995 | 54 |
| 611 | 3300049824 | Ga0501045_0012325 | Ga0501045_0012325_2905_3090 | 54 |
| 612 | 3300049824 | Ga0501045_1246749 | Ga0501045_1246749_217_402 | 54 |
| 613 | 3300050489 | nmdc:mga03683_135598_c1 | nmdc:mga03683_135598_c1_773_958 | 54 |
| 614 | 3300050491 | nmdc:mga00v17_1062363_c1 | nmdc:mga00v17_1062363_c1_236_421 | 54 |
| 615 | 3300050491 | nmdc:mga00v17_260114_c1 | nmdc:mga00v17_260114_c1_895_1080 | 54 |
| 616 | 3300050491 | nmdc:mga00v17_81415_c1 | nmdc:mga00v17_81415_c1_639_824 | 54 |
| 617 | 3300050492 | nmdc:mga0yw44_1138384_c1 | nmdc:mga0yw44_1138384_c1_176_361 | 54 |
| 618 | 3300050492 | nmdc:mga0yw44_151101_c1 | nmdc:mga0yw44_151101_c1_879_1064 | 54 |
| 619 | 3300050492 | nmdc:mga0yw44_182969_c1 | nmdc:mga0yw44_182969_c1_26_211 | 54 |
| 620 | 3300050492 | nmdc:mga0yw44_259460_c1 | nmdc:mga0yw44_259460_c1_68_253 | 54 |
| 621 | 3300050492 | nmdc:mga0yw44_431300_c1 | nmdc:mga0yw44_431300_c1_460_645 | 54 |
| 622 | 3300050492 | nmdc:mga0yw44_50327_c1 | nmdc:mga0yw44_50327_c1_909_1094 | 54 |
| 623 | 3300050493 | nmdc:mga0k408_626622_c1 | nmdc:mga0k408_626622_c1_70_255 | 54 |
| 624 | 3300050494 | nmdc:mga06z11_412145_c1 | nmdc:mga06z11_412145_c1_275_460 | 54 |
| 625 | 3300050495 | nmdc:mga04h51_538757_c1 | nmdc:mga04h51_538757_c1_35_220 | 54 |
| 626 | 3300050507 | nmdc:mga05p37_1641956_c1 | nmdc:mga05p37_1641956_c1_424_609 | 54 |
| 627 | 3300050507 | nmdc:mga05p37_218630_c1 | nmdc:mga05p37_218630_c1_1455_1640 | 54 |
| 628 | 3300050507 | nmdc:mga05p37_24020_c1 | nmdc:mga05p37_24020_c1_1785_1970 | 54 |
| 629 | 3300050507 | nmdc:mga05p37_450163_c1 | nmdc:mga05p37_450163_c1_237_422 | 54 |
| 630 | 3300050507 | nmdc:mga05p37_47080_c1 | nmdc:mga05p37_47080_c1_479_664 | 54 |
| 631 | 3300050508 | nmdc:mga09592_183_c1 | nmdc:mga09592_183_c1_26380_26565 | 54 |
| 632 | 3300050508 | nmdc:mga09592_23438_c1 | nmdc:mga09592_23438_c1_2513_2698 | 54 |
| 633 | 3300050508 | nmdc:mga09592_47724_c1 | nmdc:mga09592_47724_c1_2071_2256 | 54 |
| 634 | 3300050508 | nmdc:mga09592_98529_c1 | nmdc:mga09592_98529_c1_2122_2307 | 54 |
| 635 | 3300050509 | nmdc:mga0qj67_111369_c1 | nmdc:mga0qj67_111369_c1_1049_1234 | 54 |
| 636 | 3300050509 | nmdc:mga0qj67_1362695_c1 | nmdc:mga0qj67_1362695_c1_302_487 | 54 |
| 637 | 3300050509 | nmdc:mga0qj67_49649_c1 | nmdc:mga0qj67_49649_c1_1580_1765 | 54 |
| 638 | 3300050509 | nmdc:mga0qj67_5012_c1 | nmdc:mga0qj67_5012_c1_5891_6076 | 54 |
| 639 | 3300050510 | nmdc:mga06r32_120569_c1 | nmdc:mga06r32_120569_c1_814_999 | 54 |
| 640 | 3300050510 | nmdc:mga06r32_126116_c1 | nmdc:mga06r32_126116_c1_1408_1593 | 54 |
| 641 | 3300050510 | nmdc:mga06r32_1274081_c1 | nmdc:mga06r32_1274081_c1_392_577 | 54 |
| 642 | 3300050510 | nmdc:mga06r32_158317_c1 | nmdc:mga06r32_158317_c1_237_422 | 54 |
| 643 | 3300050510 | nmdc:mga06r32_1710178_c1 | nmdc:mga06r32_1710178_c1_341_526 | 54 |
| 644 | 3300050510 | nmdc:mga06r32_221909_c1 | nmdc:mga06r32_221909_c1_187_372 | 54 |
| 645 | 3300050510 | nmdc:mga06r32_342_c1 | nmdc:mga06r32_342_c1_38103_38288 | 54 |
| 646 | 3300050511 | nmdc:mga08y16_1127282_c1 | nmdc:mga08y16_1127282_c1_142_327 | 54 |
| 647 | 3300050511 | nmdc:mga08y16_164043_c1 | nmdc:mga08y16_164043_c1_1843_2028 | 54 |
| 648 | 3300050511 | nmdc:mga08y16_74751_c1 | nmdc:mga08y16_74751_c1_2614_2799 | 54 |
| 649 | 3300050512 | nmdc:mga0n895_115481_c1 | nmdc:mga0n895_115481_c1_2402_2587 | 54 |
| 650 | 3300050512 | nmdc:mga0n895_2092794_c1 | nmdc:mga0n895_2092794_c1_94_279 | 54 |
| 651 | 3300050513 | nmdc:mga0rr50_1019012_c1 | nmdc:mga0rr50_1019012_c1_163_348 | 54 |
| 652 | 3300050513 | nmdc:mga0rr50_1745_c1 | nmdc:mga0rr50_1745_c1_6898_7083 | 54 |
| 653 | 3300050513 | nmdc:mga0rr50_1903491_c1 | nmdc:mga0rr50_1903491_c1_265_450 | 54 |
| 654 | 3300050513 | nmdc:mga0rr50_257839_c1 | nmdc:mga0rr50_257839_c1_148_333 | 54 |
| 655 | 3300050513 | nmdc:mga0rr50_842387_c1 | nmdc:mga0rr50_842387_c1_364_549 | 54 |
| 656 | 3300050514 | nmdc:mga08x19_4128_c1 | nmdc:mga08x19_4128_c1_2764_2949 | 54 |
| 657 | 3300050514 | nmdc:mga08x19_930391_c1 | nmdc:mga08x19_930391_c1_265_450 | 54 |
| 658 | 3300050515 | nmdc:mga0a205_25778_c1 | nmdc:mga0a205_25778_c1_2512_2697 | 54 |
| 659 | 3300053077 | Ga0495601_0368983 | Ga0495601_0368983_114_299 | 54 |
| 660 | 3300053084 | Ga0495595_0030369 | Ga0495595_0030369_426_611 | 54 |
| 661 | 3300053084 | Ga0495595_0185874 | Ga0495595_0185874_579_764 | 54 |
| 662 | 3300053084 | Ga0495595_0273127 | Ga0495595_0273127_615_800 | 54 |
| 663 | 3300053085 | Ga0495619_0069359 | Ga0495619_0069359_1002_1187 | 54 |
| 664 | 3300053085 | Ga0495619_0081922 | Ga0495619_0081922_1228_1413 | 54 |
| 665 | 3300053085 | Ga0495619_0323117 | Ga0495619_0323117_247_432 | 54 |
| 666 | 3300053094 | Ga0500566_0341682 | Ga0500566_0341682_369_554 | 54 |
| 667 | 3300053098 | Ga0500650_0157516 | Ga0500650_0157516_408_593 | 54 |
| 668 | 3300053153 | Ga0500616_0000816 | Ga0500616_0000816_27767_27952 | 54 |
| 669 | 3300054114 | Ga0501084_0004976 | Ga0501084_0004976_2262_2447 | 54 |
| 670 | 3300054114 | Ga0501084_0072401 | Ga0501084_0072401_87_272 | 54 |
| 671 | 3300054114 | Ga0501084_0112467 | Ga0501084_0112467_537_722 | 54 |
| 672 | 3300054114 | Ga0501084_1029920 | Ga0501084_1029920_492_677 | 54 |
| 673 | 3300059491 | Ga0587070_119409 | Ga0587070_119409_233_418 | 54 |
| 674 | 3300059492 | Ga0587073_0277747 | Ga0587073_0277747_56_241 | 54 |
| 675 | 3300059503 | Ga0587080_160426 | Ga0587080_160426_32_217 | 54 |
| 676 | 3300059504 | Ga0587082_132818 | Ga0587082_132818_16_201 | 54 |
| 677 | 3300059506 | Ga0587085_185613 | Ga0587085_185613_63_248 | 54 |
| 678 | 3300059508 | Ga0587088_045312 | Ga0587088_045312_300_485 | 54 |
| 679 | 3300059511 | Ga0587091_135892 | Ga0587091_135892_61_246 | 54 |
| 680 | 3300059513 | Ga0587094_026889 | Ga0587094_026889_453_638 | 54 |
| 681 | 3300059513 | Ga0587094_121373 | Ga0587094_121373_37_222 | 54 |
| 682 | 3300059605 | Ga0587106_130452 | Ga0587106_130452_159_344 | 54 |
| 683 | 3300059624 | Ga0587109_062669 | Ga0587109_062669_34_219 | 54 |
| 684 | 3300059627 | Ga0587117_058990 | Ga0587117_058990_246_431 | 54 |
| 685 | 3300059628 | Ga0587122_047037 | Ga0587122_047037_43_228 | 54 |
| 686 | 3300059630 | Ga0587128_018752 | Ga0587128_018752_325_510 | 54 |
| 687 | 3300059630 | Ga0587128_101709 | Ga0587128_101709_298_483 | 54 |
| 688 | 3300059639 | Ga0587062_060811 | Ga0587062_060811_243_428 | 54 |
| 689 | 3300059639 | Ga0587062_070200 | Ga0587062_070200_204_389 | 54 |
| 690 | 3300059640 | Ga0587067_104502 | Ga0587067_104502_243_428 | 54 |
| 691 | 3300059640 | Ga0587067_112143 | Ga0587067_112143_405_590 | 54 |
| 692 | 3300059640 | Ga0587067_128376 | Ga0587067_128376_41_226 | 54 |
| 693 | 3300059642 | Ga0587069_029618 | Ga0587069_029618_343_528 | 54 |
| 694 | 3300059655 | Ga0587114_048052 | Ga0587114_048052_60_245 | 54 |
| 695 | 3300059655 | Ga0587114_138970 | Ga0587114_138970_52_237 | 54 |
| 696 | 3300060353 | Ga0501082_0018922 | Ga0501082_0018922_3632_3817 | 54 |
| 697 | 3300060353 | Ga0501082_0068849 | Ga0501082_0068849_2844_3029 | 54 |
| 698 | 3300060353 | Ga0501082_0193846 | Ga0501082_0193846_1415_1600 | 54 |
| 699 | 3300060353 | Ga0501082_0383828 | Ga0501082_0383828_336_521 | 54 |
| 700 | 3300060353 | Ga0501082_1709867 | Ga0501082_1709867_243_428 | 54 |
| 701 | 3300061734 | Ga0530510_0000429 | Ga0530510_0000429_330_515 | 54 |
| 702 | 3300061734 | Ga0530510_0008315 | Ga0530510_0008315_13_198 | 54 |
| 703 | 3300061734 | Ga0530510_0010398 | Ga0530510_0010398_2388_2573 | 54 |
| 704 | 3300061734 | Ga0530510_0071866 | Ga0530510_0071866_1752_1937 | 54 |
| 705 | 3300061734 | Ga0530510_0770595 | Ga0530510_0770595_504_689 | 54 |
| 706 | 3300061734 | Ga0530510_0891215 | Ga0530510_0891215_407_592 | 54 |
| 707 | 3300003373 | JGI25407J50210_10003241 | JGI25407J50210_100032417 | 67 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar