F476604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 708 | 300 | 1416 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0013659|Ga0395900_0013659_5778_6770 |
| Length | 330 |
| Sequence | VDSIPVSWLCATGEGAGNDIPLSNEIHEAHRCPIGANLGGGVEEGVSLNMLRKAFAVATLGLAFLAGPALSATTREEPRNIHWSFEGPLGKFDQAQLQRGYKMYREVCSACHPMSLLSFRNLGQKGGPFYDPKYPNPNDNPYVKSLAKDIQVGDIDSETGDAIKRPATSADRFPSPFPNEAAARASNGGALPPDLSVIAKAREGGPAYIYSLLTGYHAAPAGLTVTPGKYYNPFFPGDLASFWSGAKDKVPKGGVIAMPPPLAPNKVTFDDGTKSTVENQARDVAAFLMWAAEPKMEERKQFGLGAMIYLALFTGLLYASYRRIWRDVAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 56 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 142 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 159 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 231 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 232 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 233 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 262 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 263 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 264 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 265 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 267 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 269 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 270 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 271 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 272 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 273 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 275 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 277 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 279 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 281 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 282 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 285 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 292 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 293 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 294 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 295 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 296 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 297 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 298 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 299 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 300 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.02 |
| Metatranscriptomes | 0.56 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.34 |
| Nodule | 0.14 |
| Rhizoplane | 1.69 |
| Rhizosphere | 85.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0013659 | 3300037418 | Bacteria | 8292 |
| 2 | JGI25165J46597_1000246 | 3300003214 | Bacteria | 73461 |
| 3 | rootH2_10076543 | 3300003320 | Bacteria | 2034 |
| 4 | rootH2_10091432 | 3300003320 | Bacteria | 1663 |
| 5 | rootH2_10215532 | 3300003320 | Bacteria | 1159 |
| 6 | rootH1_10147226 | 3300003323 | Bacteria | 1079 |
| 7 | Ga0055530_10002084 | 3300003791 | Bacteria | 13381 |
| 8 | Ga0055531_10018190 | 3300003794 | Bacteria | 2916 |
| 9 | Ga0055531_10024884 | 3300003794 | Bacteria | 2193 |
| 10 | Ga0065165_1001609 | 3300005262 | Bacteria | 23073 |
| 11 | Ga0065165_1033482 | 3300005262 | Bacteria | 1599 |
| 12 | Ga0070658_10031693 | 3300005327 | Bacteria | 4247 |
| 13 | Ga0070658_10053126 | 3300005327 | Bacteria | 3288 |
| 14 | Ga0070658_10092982 | 3300005327 | Bacteria | 2487 |
| 15 | Ga0070658_10158845 | 3300005327 | Bacteria | 1896 |
| 16 | Ga0070658_10615499 | 3300005327 | Bacteria | 941 |
| 17 | Ga0070676_10020754 | 3300005328 | Bacteria | 3672 |
| 18 | Ga0070676_10058323 | 3300005328 | Bacteria | 2287 |
| 19 | Ga0070683_100033946 | 3300005329 | Bacteria | 4656 |
| 20 | Ga0070683_100431826 | 3300005329 | Bacteria | 1257 |
| 21 | Ga0070690_100189341 | 3300005330 | Bacteria | 1426 |
| 22 | Ga0070670_100000032 | 3300005331 | Bacteria | 158514 |
| 23 | Ga0070670_100381439 | 3300005331 | Bacteria | 1242 |
| 24 | Ga0068869_100115684 | 3300005334 | Bacteria | 2045 |
| 25 | Ga0070666_10000876 | 3300005335 | Bacteria | 18244 |
| 26 | Ga0070666_10045197 | 3300005335 | Bacteria | 2952 |
| 27 | Ga0070680_100000023 | 3300005336 | Bacteria | 78765 |
| 28 | Ga0070680_100008042 | 3300005336 | Bacteria | 8055 |
| 29 | Ga0070680_100028667 | 3300005336 | Bacteria | 4467 |
| 30 | Ga0070680_100083497 | 3300005336 | Bacteria | 2638 |
| 31 | Ga0070680_100447786 | 3300005336 | Bacteria | 1103 |
| 32 | Ga0068868_100051414 | 3300005338 | Bacteria | 3241 |
| 33 | Ga0068868_100153216 | 3300005338 | Bacteria | 1899 |
| 34 | Ga0070660_100016351 | 3300005339 | Bacteria | 5384 |
| 35 | Ga0070691_10007450 | 3300005341 | Bacteria | 5016 |
| 36 | Ga0070661_100041966 | 3300005344 | Bacteria | 3338 |
| 37 | Ga0070661_100115097 | 3300005344 | Bacteria | 2011 |
| 38 | Ga0070661_100293516 | 3300005344 | Bacteria | 1264 |
| 39 | Ga0070661_100434325 | 3300005344 | Bacteria | 1043 |
| 40 | Ga0070668_100006777 | 3300005347 | Bacteria | 8492 |
| 41 | Ga0070668_100042587 | 3300005347 | Bacteria | 3480 |
| 42 | Ga0070668_100197444 | 3300005347 | Bacteria | 1651 |
| 43 | Ga0070671_100016016 | 3300005355 | Bacteria | 6057 |
| 44 | Ga0070671_100062735 | 3300005355 | Bacteria | 3094 |
| 45 | Ga0070671_100072799 | 3300005355 | Bacteria | 2870 |
| 46 | Ga0070671_100240560 | 3300005355 | Bacteria | 1536 |
| 47 | Ga0070673_100086794 | 3300005364 | Bacteria | 2550 |
| 48 | Ga0070673_100315123 | 3300005364 | Bacteria | 1381 |
| 49 | Ga0070659_100000638 | 3300005366 | Bacteria | 25690 |
| 50 | Ga0070659_100002173 | 3300005366 | Bacteria | 13970 |
| 51 | Ga0070659_100122823 | 3300005366 | Bacteria | 2105 |
| 52 | Ga0070659_100315024 | 3300005366 | Bacteria | 1307 |
| 53 | Ga0070667_100000110 | 3300005367 | Bacteria | 105201 |
| 54 | Ga0070667_100039898 | 3300005367 | Bacteria | 3936 |
| 55 | Ga0070667_100070166 | 3300005367 | Bacteria | 2982 |
| 56 | Ga0070667_100263475 | 3300005367 | Bacteria | 1544 |
| 57 | Ga0070714_100851993 | 3300005435 | Bacteria | 884 |
| 58 | Ga0070710_10150255 | 3300005437 | Bacteria | 1436 |
| 59 | Ga0070711_100044271 | 3300005439 | Bacteria | 3020 |
| 60 | Ga0070678_100080752 | 3300005456 | Bacteria | 2463 |
| 61 | Ga0070678_100447518 | 3300005456 | Bacteria | 1131 |
| 62 | Ga0070662_100156567 | 3300005457 | Bacteria | 1779 |
| 63 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 64 | Ga0070681_10020584 | 3300005458 | Bacteria | 6611 |
| 65 | Ga0070681_10054201 | 3300005458 | Bacteria | 3995 |
| 66 | Ga0070681_10087050 | 3300005458 | Bacteria | 3077 |
| 67 | Ga0068867_100010512 | 3300005459 | Bacteria | 6531 |
| 68 | Ga0070685_10154056 | 3300005466 | Bacteria | 1459 |
| 69 | Ga0070679_100000714 | 3300005530 | Bacteria | 28591 |
| 70 | Ga0070679_100024422 | 3300005530 | Bacteria | 5922 |
| 71 | Ga0070679_100130619 | 3300005530 | Bacteria | 2493 |
| 72 | Ga0070679_100138407 | 3300005530 | Bacteria | 2415 |
| 73 | Ga0070684_100025106 | 3300005535 | Bacteria | 5005 |
| 74 | Ga0070684_100217300 | 3300005535 | Bacteria | 1743 |
| 75 | Ga0068853_100076100 | 3300005539 | Bacteria | 2930 |
| 76 | Ga0068853_100103458 | 3300005539 | Bacteria | 2520 |
| 77 | Ga0068853_100118538 | 3300005539 | Bacteria | 2359 |
| 78 | Ga0068853_100211549 | 3300005539 | Bacteria | 1768 |
| 79 | Ga0068853_100225246 | 3300005539 | Bacteria | 1714 |
| 80 | Ga0068853_100338462 | 3300005539 | Bacteria | 1398 |
| 81 | Ga0070693_100112240 | 3300005547 | Bacteria | 1679 |
| 82 | Ga0070693_100138614 | 3300005547 | Bacteria | 1529 |
| 83 | Ga0070665_100000433 | 3300005548 | Bacteria | 60988 |
| 84 | Ga0070665_100003422 | 3300005548 | Bacteria | 16956 |
| 85 | Ga0070665_100006669 | 3300005548 | Bacteria | 11740 |
| 86 | Ga0070665_100046328 | 3300005548 | Bacteria | 4368 |
| 87 | Ga0070665_100054383 | 3300005548 | Bacteria | 4015 |
| 88 | Ga0070665_100057028 | 3300005548 | Bacteria | 3916 |
| 89 | Ga0070665_100188852 | 3300005548 | Bacteria | 2061 |
| 90 | Ga0068855_100000301 | 3300005563 | Bacteria | 61661 |
| 91 | Ga0068855_100027861 | 3300005563 | Bacteria | 6758 |
| 92 | Ga0068855_100036970 | 3300005563 | Bacteria | 5809 |
| 93 | Ga0068855_100196366 | 3300005563 | Bacteria | 2273 |
| 94 | Ga0068855_100232531 | 3300005563 | Bacteria | 2063 |
| 95 | Ga0068855_100240169 | 3300005563 | Bacteria | 2025 |
| 96 | Ga0068855_100246001 | 3300005563 | Bacteria | 1996 |
| 97 | Ga0068855_100535394 | 3300005563 | Bacteria | 1269 |
| 98 | Ga0070664_100182755 | 3300005564 | Bacteria | 1865 |
| 99 | Ga0068856_100194577 | 3300005614 | Bacteria | 2042 |
| 100 | Ga0068856_100280345 | 3300005614 | Bacteria | 1683 |
| 101 | Ga0068856_100440895 | 3300005614 | Bacteria | 1323 |
| 102 | Ga0068856_100829929 | 3300005614 | Bacteria | 944 |
| 103 | Ga0068852_100052440 | 3300005616 | Bacteria | 3506 |
| 104 | Ga0068852_100058395 | 3300005616 | Bacteria | 3342 |
| 105 | Ga0068852_100122392 | 3300005616 | Bacteria | 2385 |
| 106 | Ga0068859_100191817 | 3300005617 | Bacteria | 2128 |
| 107 | Ga0068859_100378215 | 3300005617 | Bacteria | 1512 |
| 108 | Ga0068864_100000184 | 3300005618 | Bacteria | 57553 |
| 109 | Ga0068864_100000321 | 3300005618 | Bacteria | 42230 |
| 110 | Ga0068866_10065240 | 3300005718 | Bacteria | 1904 |
| 111 | Ga0068861_100363900 | 3300005719 | Bacteria | 1273 |
| 112 | Ga0068861_100552193 | 3300005719 | Bacteria | 1050 |
| 113 | Ga0068863_100000037 | 3300005841 | Bacteria | 162638 |
| 114 | Ga0068863_100001377 | 3300005841 | Bacteria | 24126 |
| 115 | Ga0068858_100000029 | 3300005842 | Bacteria | 144691 |
| 116 | Ga0068858_100006036 | 3300005842 | Bacteria | 11808 |
| 117 | Ga0068858_100128417 | 3300005842 | Bacteria | 2376 |
| 118 | Ga0068858_100129465 | 3300005842 | Bacteria | 2365 |
| 119 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 120 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 121 | Ga0068860_100148872 | 3300005843 | Bacteria | 2253 |
| 122 | Ga0068862_100008644 | 3300005844 | Bacteria | 8423 |
| 123 | Ga0068862_100103621 | 3300005844 | Bacteria | 2492 |
| 124 | Ga0068862_100717426 | 3300005844 | Bacteria | 970 |
| 125 | Ga0075366_10148732 | 3300006195 | Bacteria | 1418 |
| 126 | Ga0097621_100001198 | 3300006237 | Bacteria | 17958 |
| 127 | Ga0097621_100075644 | 3300006237 | Bacteria | 2792 |
| 128 | Ga0097621_100078408 | 3300006237 | Bacteria | 2744 |
| 129 | Ga0097621_100124335 | 3300006237 | Bacteria | 2190 |
| 130 | Ga0097621_100159729 | 3300006237 | Bacteria | 1937 |
| 131 | Ga0068871_100001487 | 3300006358 | Bacteria | 15708 |
| 132 | Ga0068871_100044818 | 3300006358 | Bacteria | 3558 |
| 133 | Ga0068871_100095041 | 3300006358 | Bacteria | 2488 |
| 134 | Ga0068871_100159533 | 3300006358 | Bacteria | 1928 |
| 135 | Ga0068871_100217893 | 3300006358 | Bacteria | 1653 |
| 136 | Ga0068871_100605204 | 3300006358 | Bacteria | 997 |
| 137 | Ga0068865_100000664 | 3300006881 | Bacteria | 19413 |
| 138 | Ga0068865_100030073 | 3300006881 | Bacteria | 3609 |
| 139 | Ga0097620_100191818 | 3300006931 | Bacteria | 2128 |
| 140 | Ga0097620_100378199 | 3300006931 | Bacteria | 1512 |
| 141 | Ga0079104_1016322 | 3300006946 | Bacteria | 2175 |
| 142 | Ga0105250_10006833 | 3300009092 | Bacteria | 4954 |
| 143 | Ga0105240_10000564 | 3300009093 | Bacteria | 68685 |
| 144 | Ga0105240_10000944 | 3300009093 | Bacteria | 51695 |
| 145 | Ga0105240_10013845 | 3300009093 | Bacteria | 11045 |
| 146 | Ga0105240_10119623 | 3300009093 | Bacteria | 3173 |
| 147 | Ga0105240_10157507 | 3300009093 | Bacteria | 2700 |
| 148 | Ga0105240_10189179 | 3300009093 | Bacteria | 2422 |
| 149 | Ga0105240_10254003 | 3300009093 | Bacteria | 2031 |
| 150 | Ga0105240_10349912 | 3300009093 | Bacteria | 1677 |
| 151 | Ga0105240_10394542 | 3300009093 | Bacteria | 1560 |
| 152 | Ga0105240_10527564 | 3300009093 | Bacteria | 1309 |
| 153 | Ga0105240_10534774 | 3300009093 | Bacteria | 1299 |
| 154 | Ga0105245_10046489 | 3300009098 | Bacteria | 3879 |
| 155 | Ga0105245_10053099 | 3300009098 | Bacteria | 3637 |
| 156 | Ga0105245_10109674 | 3300009098 | Bacteria | 2565 |
| 157 | Ga0105245_10225300 | 3300009098 | Bacteria | 1811 |
| 158 | Ga0105247_10051693 | 3300009101 | Bacteria | 2532 |
| 159 | Ga0105247_10120373 | 3300009101 | Bacteria | 1700 |
| 160 | Ga0105243_10008311 | 3300009148 | Bacteria | 7972 |
| 161 | Ga0105241_10050241 | 3300009174 | Bacteria | 3177 |
| 162 | Ga0105241_10106864 | 3300009174 | Bacteria | 2234 |
| 163 | Ga0105241_10125529 | 3300009174 | Bacteria | 2072 |
| 164 | Ga0105242_10043224 | 3300009176 | Bacteria | 3644 |
| 165 | Ga0105242_10104462 | 3300009176 | Bacteria | 2405 |
| 166 | Ga0105242_10696980 | 3300009176 | Bacteria | 993 |
| 167 | Ga0105242_10806888 | 3300009176 | Bacteria | 929 |
| 168 | Ga0105248_10000280 | 3300009177 | Bacteria | 60247 |
| 169 | Ga0105248_10022042 | 3300009177 | Bacteria | 7059 |
| 170 | Ga0105248_10022642 | 3300009177 | Bacteria | 6973 |
| 171 | Ga0105248_10024868 | 3300009177 | Bacteria | 6656 |
| 172 | Ga0105248_10099751 | 3300009177 | Bacteria | 3272 |
| 173 | Ga0105248_10740840 | 3300009177 | Bacteria | 1109 |
| 174 | Ga0105237_10108918 | 3300009545 | Bacteria | 2761 |
| 175 | Ga0105237_10144627 | 3300009545 | Bacteria | 2372 |
| 176 | Ga0105237_10153769 | 3300009545 | Bacteria | 2297 |
| 177 | Ga0105237_10387513 | 3300009545 | Bacteria | 1402 |
| 178 | Ga0105238_10005585 | 3300009551 | Bacteria | 12425 |
| 179 | Ga0105238_10007619 | 3300009551 | Bacteria | 10846 |
| 180 | Ga0105238_10024527 | 3300009551 | Bacteria | 6147 |
| 181 | Ga0105238_10069310 | 3300009551 | Bacteria | 3527 |
| 182 | Ga0105238_10078904 | 3300009551 | Bacteria | 3282 |
| 183 | Ga0105238_10164055 | 3300009551 | Bacteria | 2197 |
| 184 | Ga0105238_10236576 | 3300009551 | Bacteria | 1804 |
| 185 | Ga0105238_10374770 | 3300009551 | Bacteria | 1414 |
| 186 | Ga0105238_10399171 | 3300009551 | Bacteria | 1368 |
| 187 | Ga0105238_10528973 | 3300009551 | Bacteria | 1182 |
| 188 | Ga0105238_10782230 | 3300009551 | Bacteria | 969 |
| 189 | Ga0105249_10010828 | 3300009553 | Bacteria | 8014 |
| 190 | Ga0105249_10073283 | 3300009553 | Bacteria | 3168 |
| 191 | Ga0105249_10094935 | 3300009553 | Bacteria | 2796 |
| 192 | Ga0105249_10261115 | 3300009553 | Bacteria | 1721 |
| 193 | Ga0105249_10270726 | 3300009553 | Bacteria | 1692 |
| 194 | Ga0105249_10767843 | 3300009553 | Bacteria | 1027 |
| 195 | Ga0105239_10003451 | 3300010375 | Bacteria | 19346 |
| 196 | Ga0105239_10052496 | 3300010375 | Bacteria | 4471 |
| 197 | Ga0105239_10082819 | 3300010375 | Bacteria | 3533 |
| 198 | Ga0105239_10102209 | 3300010375 | Bacteria | 3172 |
| 199 | Ga0105239_10124257 | 3300010375 | Bacteria | 2867 |
| 200 | Ga0105239_10326146 | 3300010375 | Bacteria | 1732 |
| 201 | Ga0105239_10503921 | 3300010375 | Bacteria | 1376 |
| 202 | Ga0105246_10261917 | 3300011119 | Bacteria | 1378 |
| 203 | Ga0157373_10001320 | 3300013100 | Bacteria | 18973 |
| 204 | Ga0157373_10012399 | 3300013100 | Bacteria | 6268 |
| 205 | Ga0157373_10066755 | 3300013100 | Bacteria | 2544 |
| 206 | Ga0157370_10037032 | 3300013104 | Bacteria | 4732 |
| 207 | Ga0157370_10063705 | 3300013104 | Bacteria | 3492 |
| 208 | Ga0157370_10214089 | 3300013104 | Bacteria | 1785 |
| 209 | Ga0157370_10390438 | 3300013104 | Bacteria | 1281 |
| 210 | Ga0157370_10733469 | 3300013104 | Bacteria | 901 |
| 211 | Ga0157369_10033563 | 3300013105 | Bacteria | 5639 |
| 212 | Ga0157369_10043173 | 3300013105 | Bacteria | 4915 |
| 213 | Ga0157369_10129964 | 3300013105 | Bacteria | 2670 |
| 214 | Ga0157369_10356992 | 3300013105 | Bacteria | 1518 |
| 215 | Ga0157369_10414959 | 3300013105 | Bacteria | 1396 |
| 216 | Ga0157374_10349054 | 3300013296 | Bacteria | 1470 |
| 217 | Ga0157378_10093553 | 3300013297 | Bacteria | 2737 |
| 218 | Ga0157378_10122253 | 3300013297 | Bacteria | 2401 |
| 219 | Ga0157378_10504369 | 3300013297 | Bacteria | 1209 |
| 220 | Ga0163162_10498463 | 3300013306 | Bacteria | 1348 |
| 221 | Ga0157372_10137960 | 3300013307 | Bacteria | 2809 |
| 222 | Ga0157372_10240479 | 3300013307 | Bacteria | 2101 |
| 223 | Ga0157372_10294097 | 3300013307 | Bacteria | 1889 |
| 224 | Ga0157375_10082401 | 3300013308 | Bacteria | 3259 |
| 225 | Ga0157375_11204393 | 3300013308 | Bacteria | 888 |
| 226 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 227 | Ga0163163_10105669 | 3300014325 | Bacteria | 2841 |
| 228 | Ga0163163_10123295 | 3300014325 | Bacteria | 2627 |
| 229 | Ga0163163_10170425 | 3300014325 | Bacteria | 2223 |
| 230 | Ga0163163_10224747 | 3300014325 | Bacteria | 1926 |
| 231 | Ga0163163_10320712 | 3300014325 | Bacteria | 1603 |
| 232 | Ga0157379_10005280 | 3300014968 | Bacteria | 11093 |
| 233 | Ga0157379_10016863 | 3300014968 | Bacteria | 6429 |
| 234 | Ga0157379_10023062 | 3300014968 | Bacteria | 5518 |
| 235 | Ga0157376_10452485 | 3300014969 | Bacteria | 1253 |
| 236 | Ga0157376_10490741 | 3300014969 | Bacteria | 1205 |
| 237 | Ga0163161_10027011 | 3300017792 | Bacteria | 4071 |
| 238 | Ga0207427_103528 | 3300025231 | Bacteria | 3218 |
| 239 | Ga0209026_1000851 | 3300025250 | Bacteria | 16010 |
| 240 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 241 | Ga0209564_1006954 | 3300025295 | Bacteria | 5943 |
| 242 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 243 | Ga0209758_1000331 | 3300025297 | Bacteria | 88922 |
| 244 | Ga0209758_1065746 | 3300025297 | Bacteria | 1168 |
| 245 | Ga0209050_1000130 | 3300025298 | Bacteria | 186070 |
| 246 | Ga0209257_1000059 | 3300025304 | Bacteria | 378097 |
| 247 | Ga0209257_1000246 | 3300025304 | Bacteria | 125942 |
| 248 | Ga0209257_1001754 | 3300025304 | Bacteria | 24058 |
| 249 | Ga0207696_1040002 | 3300025711 | Bacteria | 1375 |
| 250 | Ga0207710_10141812 | 3300025900 | Bacteria | 1160 |
| 251 | Ga0207688_10072794 | 3300025901 | Bacteria | 1953 |
| 252 | Ga0207680_10001291 | 3300025903 | Bacteria | 11864 |
| 253 | Ga0207680_10156008 | 3300025903 | Bacteria | 1526 |
| 254 | Ga0207680_10164460 | 3300025903 | Bacteria | 1490 |
| 255 | Ga0207647_10137483 | 3300025904 | Bacteria | 1433 |
| 256 | Ga0207705_10000970 | 3300025909 | Bacteria | 23483 |
| 257 | Ga0207705_10034055 | 3300025909 | Bacteria | 3641 |
| 258 | Ga0207705_10232506 | 3300025909 | Bacteria | 1403 |
| 259 | Ga0207705_10442734 | 3300025909 | Bacteria | 1007 |
| 260 | Ga0207654_10093549 | 3300025911 | Bacteria | 1838 |
| 261 | Ga0207654_10233109 | 3300025911 | Bacteria | 1227 |
| 262 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 263 | Ga0207707_10037873 | 3300025912 | Bacteria | 4213 |
| 264 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 265 | Ga0207695_10004245 | 3300025913 | Bacteria | 19683 |
| 266 | Ga0207695_10010734 | 3300025913 | Bacteria | 11177 |
| 267 | Ga0207695_10011375 | 3300025913 | Bacteria | 10785 |
| 268 | Ga0207695_10069921 | 3300025913 | Bacteria | 3591 |
| 269 | Ga0207695_10092691 | 3300025913 | Bacteria | 3031 |
| 270 | Ga0207695_10132018 | 3300025913 | Bacteria | 2454 |
| 271 | Ga0207695_10205673 | 3300025913 | Bacteria | 1881 |
| 272 | Ga0207695_10303416 | 3300025913 | Bacteria | 1488 |
| 273 | Ga0207695_10321870 | 3300025913 | Bacteria | 1436 |
| 274 | Ga0207695_10387917 | 3300025913 | Bacteria | 1282 |
| 275 | Ga0207695_10441565 | 3300025913 | Bacteria | 1185 |
| 276 | Ga0207671_10230063 | 3300025914 | Bacteria | 1454 |
| 277 | Ga0207660_10003432 | 3300025917 | Bacteria | 10338 |
| 278 | Ga0207660_10015133 | 3300025917 | Bacteria | 5087 |
| 279 | Ga0207660_10374695 | 3300025917 | Bacteria | 1143 |
| 280 | Ga0207649_10099121 | 3300025920 | Bacteria | 1924 |
| 281 | Ga0207649_10191177 | 3300025920 | Bacteria | 1440 |
| 282 | Ga0207649_10304239 | 3300025920 | Bacteria | 1167 |
| 283 | Ga0207652_10000641 | 3300025921 | Bacteria | 34615 |
| 284 | Ga0207652_10004285 | 3300025921 | Bacteria | 11637 |
| 285 | Ga0207652_10176631 | 3300025921 | Bacteria | 1918 |
| 286 | Ga0207652_10197875 | 3300025921 | Bacteria | 1808 |
| 287 | Ga0207694_10000016 | 3300025924 | Bacteria | 349087 |
| 288 | Ga0207694_10020349 | 3300025924 | Bacteria | 5019 |
| 289 | Ga0207694_10059819 | 3300025924 | Bacteria | 2964 |
| 290 | Ga0207694_10208300 | 3300025924 | Bacteria | 1592 |
| 291 | Ga0207694_10251364 | 3300025924 | Bacteria | 1447 |
| 292 | Ga0207694_10252963 | 3300025924 | Bacteria | 1442 |
| 293 | Ga0207694_10261294 | 3300025924 | Bacteria | 1418 |
| 294 | Ga0207694_10444388 | 3300025924 | Bacteria | 1082 |
| 295 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 296 | Ga0207650_10152295 | 3300025925 | Bacteria | 1826 |
| 297 | Ga0207650_10349449 | 3300025925 | Bacteria | 1216 |
| 298 | Ga0207659_10008634 | 3300025926 | Bacteria | 6338 |
| 299 | Ga0207687_10072593 | 3300025927 | Bacteria | 2462 |
| 300 | Ga0207687_10075128 | 3300025927 | Bacteria | 2424 |
| 301 | Ga0207687_10143736 | 3300025927 | Bacteria | 1813 |
| 302 | Ga0207687_10338732 | 3300025927 | Bacteria | 1222 |
| 303 | Ga0207644_10012414 | 3300025931 | Bacteria | 5658 |
| 304 | Ga0207644_10119076 | 3300025931 | Bacteria | 2007 |
| 305 | Ga0207644_10180958 | 3300025931 | Bacteria | 1652 |
| 306 | Ga0207644_10407319 | 3300025931 | Bacteria | 1112 |
| 307 | Ga0207690_10000159 | 3300025932 | Bacteria | 52852 |
| 308 | Ga0207690_10006522 | 3300025932 | Bacteria | 6918 |
| 309 | Ga0207690_10060485 | 3300025932 | Bacteria | 2571 |
| 310 | Ga0207690_10574778 | 3300025932 | Bacteria | 918 |
| 311 | Ga0207706_10049653 | 3300025933 | Bacteria | 3707 |
| 312 | Ga0207706_10492146 | 3300025933 | Bacteria | 1059 |
| 313 | Ga0207686_10044035 | 3300025934 | Bacteria | 2738 |
| 314 | Ga0207686_10070243 | 3300025934 | Bacteria | 2249 |
| 315 | Ga0207709_10012017 | 3300025935 | Bacteria | 4774 |
| 316 | Ga0207669_10011030 | 3300025937 | Bacteria | 4378 |
| 317 | Ga0207704_10001590 | 3300025938 | Bacteria | 10203 |
| 318 | Ga0207704_10008398 | 3300025938 | Bacteria | 4937 |
| 319 | Ga0207691_10356149 | 3300025940 | Bacteria | 1252 |
| 320 | Ga0207711_10007049 | 3300025941 | Bacteria | 9418 |
| 321 | Ga0207711_10022124 | 3300025941 | Bacteria | 5315 |
| 322 | Ga0207711_10037615 | 3300025941 | Bacteria | 4112 |
| 323 | Ga0207711_10365278 | 3300025941 | Bacteria | 1338 |
| 324 | Ga0207689_10050504 | 3300025942 | Bacteria | 3429 |
| 325 | Ga0207679_10011413 | 3300025945 | Bacteria | 5754 |
| 326 | Ga0207679_10133980 | 3300025945 | Bacteria | 1992 |
| 327 | Ga0207667_10000021 | 3300025949 | Bacteria | 370524 |
| 328 | Ga0207667_10046655 | 3300025949 | Bacteria | 4588 |
| 329 | Ga0207667_10049413 | 3300025949 | Bacteria | 4441 |
| 330 | Ga0207667_10107498 | 3300025949 | Bacteria | 2878 |
| 331 | Ga0207667_10125211 | 3300025949 | Bacteria | 2646 |
| 332 | Ga0207667_10127520 | 3300025949 | Bacteria | 2621 |
| 333 | Ga0207667_10202470 | 3300025949 | Bacteria | 2036 |
| 334 | Ga0207667_10221876 | 3300025949 | Bacteria | 1937 |
| 335 | Ga0207712_10006330 | 3300025961 | Bacteria | 7468 |
| 336 | Ga0207712_10049994 | 3300025961 | Bacteria | 2917 |
| 337 | Ga0207712_10064732 | 3300025961 | Bacteria | 2608 |
| 338 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 339 | Ga0207668_10000246 | 3300025972 | Bacteria | 36387 |
| 340 | Ga0207640_10096969 | 3300025981 | Bacteria | 2057 |
| 341 | Ga0207658_10000275 | 3300025986 | Bacteria | 53906 |
| 342 | Ga0207658_10026953 | 3300025986 | Bacteria | 4033 |
| 343 | Ga0207658_10031695 | 3300025986 | Bacteria | 3756 |
| 344 | Ga0207658_10289521 | 3300025986 | Bacteria | 1407 |
| 345 | Ga0207677_10032925 | 3300026023 | Bacteria | 3337 |
| 346 | Ga0207703_10001093 | 3300026035 | Bacteria | 25768 |
| 347 | Ga0207703_10054178 | 3300026035 | Bacteria | 3261 |
| 348 | Ga0207703_10086103 | 3300026035 | Bacteria | 2631 |
| 349 | Ga0207703_10360642 | 3300026035 | Bacteria | 1340 |
| 350 | Ga0207639_10014523 | 3300026041 | Bacteria | 5542 |
| 351 | Ga0207639_10043000 | 3300026041 | Bacteria | 3389 |
| 352 | Ga0207639_10061463 | 3300026041 | Bacteria | 2901 |
| 353 | Ga0207639_10094891 | 3300026041 | Bacteria | 2396 |
| 354 | Ga0207639_10166908 | 3300026041 | Bacteria | 1860 |
| 355 | Ga0207639_10211323 | 3300026041 | Bacteria | 1670 |
| 356 | Ga0207639_10245397 | 3300026041 | Bacteria | 1559 |
| 357 | Ga0207639_10320795 | 3300026041 | Bacteria | 1375 |
| 358 | Ga0207639_10609170 | 3300026041 | Bacteria | 1008 |
| 359 | Ga0207708_10068878 | 3300026075 | Bacteria | 2709 |
| 360 | Ga0207702_10095020 | 3300026078 | Bacteria | 2618 |
| 361 | Ga0207702_10316832 | 3300026078 | Bacteria | 1484 |
| 362 | Ga0207702_10572709 | 3300026078 | Bacteria | 1106 |
| 363 | Ga0207702_10923761 | 3300026078 | Bacteria | 865 |
| 364 | Ga0207641_10000034 | 3300026088 | Bacteria | 217752 |
| 365 | Ga0207641_10001917 | 3300026088 | Bacteria | 19953 |
| 366 | Ga0207648_10016983 | 3300026089 | Bacteria | 6632 |
| 367 | Ga0207648_10047240 | 3300026089 | Bacteria | 3774 |
| 368 | Ga0207676_10000202 | 3300026095 | Bacteria | 51825 |
| 369 | Ga0207676_10001101 | 3300026095 | Bacteria | 20425 |
| 370 | Ga0207676_10004781 | 3300026095 | Bacteria | 9608 |
| 371 | Ga0207674_10052452 | 3300026116 | Bacteria | 4159 |
| 372 | Ga0207674_10164284 | 3300026116 | Bacteria | 2174 |
| 373 | Ga0207674_10286716 | 3300026116 | Bacteria | 1595 |
| 374 | Ga0207674_10418990 | 3300026116 | Bacteria | 1294 |
| 375 | Ga0207675_100444220 | 3300026118 | Bacteria | 1284 |
| 376 | Ga0207698_10034015 | 3300026142 | Bacteria | 3710 |
| 377 | Ga0207698_10064132 | 3300026142 | Bacteria | 2878 |
| 378 | Ga0209981_1003305 | 3300027378 | Bacteria | 2089 |
| 379 | Ga0209999_1005248 | 3300027543 | Bacteria | 2329 |
| 380 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 381 | Ga0268266_10000289 | 3300028379 | Bacteria | 82515 |
| 382 | Ga0268266_10000746 | 3300028379 | Bacteria | 43523 |
| 383 | Ga0268266_10012231 | 3300028379 | Bacteria | 7427 |
| 384 | Ga0268266_10022231 | 3300028379 | Bacteria | 5404 |
| 385 | Ga0268266_10038206 | 3300028379 | Bacteria | 4088 |
| 386 | Ga0268266_10048721 | 3300028379 | Bacteria | 3632 |
| 387 | Ga0268266_10090410 | 3300028379 | Bacteria | 2683 |
| 388 | Ga0268266_10101306 | 3300028379 | Bacteria | 2538 |
| 389 | Ga0268265_10000648 | 3300028380 | Bacteria | 34549 |
| 390 | Ga0268265_10276562 | 3300028380 | Bacteria | 1500 |
| 391 | Ga0268265_10560268 | 3300028380 | Bacteria | 1086 |
| 392 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 393 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 394 | Ga0268264_10459255 | 3300028381 | Bacteria | 1235 |
| 395 | Ga0265318_10001360 | 3300028577 | Bacteria | 14524 |
| 396 | Ga0307517_10002267 | 3300028786 | Bacteria | 31005 |
| 397 | Ga0307517_10033152 | 3300028786 | Bacteria | 5946 |
| 398 | Ga0307517_10074807 | 3300028786 | Bacteria | 2981 |
| 399 | Ga0307517_10199204 | 3300028786 | Bacteria | 1255 |
| 400 | Ga0307515_10012598 | 3300028794 | Bacteria | 15891 |
| 401 | Ga0265338_10007293 | 3300028800 | Bacteria | 13796 |
| 402 | Ga0307511_10030594 | 3300030521 | Bacteria | 4833 |
| 403 | Ga0265760_10021543 | 3300031090 | Bacteria | 1866 |
| 404 | Ga0265332_10011546 | 3300031238 | Bacteria | 3924 |
| 405 | Ga0265325_10004954 | 3300031241 | Bacteria | 8299 |
| 406 | Ga0265325_10050543 | 3300031241 | Bacteria | 2140 |
| 407 | Ga0265340_10036654 | 3300031247 | Bacteria | 2430 |
| 408 | Ga0265340_10050883 | 3300031247 | Bacteria | 2008 |
| 409 | Ga0265339_10009253 | 3300031249 | Bacteria | 6209 |
| 410 | Ga0265339_10047970 | 3300031249 | Bacteria | 2344 |
| 411 | Ga0265339_10048746 | 3300031249 | Bacteria | 2322 |
| 412 | Ga0265339_10090711 | 3300031249 | Bacteria | 1602 |
| 413 | Ga0265331_10000080 | 3300031250 | Bacteria | 137743 |
| 414 | Ga0265331_10007961 | 3300031250 | Bacteria | 6068 |
| 415 | Ga0265331_10039691 | 3300031250 | Bacteria | 2294 |
| 416 | Ga0265331_10045360 | 3300031250 | Bacteria | 2122 |
| 417 | Ga0265327_10003877 | 3300031251 | Bacteria | 13777 |
| 418 | Ga0265327_10008511 | 3300031251 | Bacteria | 7626 |
| 419 | Ga0265327_10163968 | 3300031251 | Bacteria | 1025 |
| 420 | Ga0265316_10075979 | 3300031344 | Bacteria | 2582 |
| 421 | Ga0265316_10094004 | 3300031344 | Bacteria | 2284 |
| 422 | Ga0307513_10000045 | 3300031456 | Bacteria | 158626 |
| 423 | Ga0307513_10000790 | 3300031456 | Bacteria | 45976 |
| 424 | Ga0307513_10004139 | 3300031456 | Bacteria | 19425 |
| 425 | Ga0307513_10478974 | 3300031456 | Bacteria | 965 |
| 426 | Ga0265313_10041225 | 3300031595 | Bacteria | 2276 |
| 427 | Ga0265313_10042413 | 3300031595 | Bacteria | 2235 |
| 428 | Ga0265313_10079895 | 3300031595 | Bacteria | 1487 |
| 429 | Ga0265314_10007720 | 3300031711 | Bacteria | 9300 |
| 430 | Ga0265314_10024020 | 3300031711 | Bacteria | 4631 |
| 431 | Ga0265314_10043804 | 3300031711 | Bacteria | 3178 |
| 432 | Ga0265314_10051744 | 3300031711 | Bacteria | 2860 |
| 433 | Ga0265314_10066847 | 3300031711 | Bacteria | 2423 |
| 434 | Ga0265314_10086198 | 3300031711 | Bacteria | 2057 |
| 435 | Ga0265342_10029142 | 3300031712 | Bacteria | 3431 |
| 436 | Ga0265342_10113010 | 3300031712 | Bacteria | 1535 |
| 437 | Ga0307516_10078605 | 3300031730 | Bacteria | 3145 |
| 438 | Ga0307516_10200559 | 3300031730 | Bacteria | 1715 |
| 439 | Ga0307413_10272838 | 3300031824 | Bacteria | 1267 |
| 440 | Ga0307510_10045879 | 3300033180 | Bacteria | 4708 |
| 441 | Ga0307510_10160178 | 3300033180 | Bacteria | 1849 |
| 442 | Ga0307510_10162304 | 3300033180 | Bacteria | 1829 |
| 443 | Ga0373936_0002176 | 3300035113 | Bacteria | 7306 |
| 444 | Ga0373936_0039837 | 3300035113 | Bacteria | 1881 |
| 445 | Ga0373939_0068037 | 3300035114 | Bacteria | 1152 |
| 446 | Ga0373942_0020166 | 3300035207 | Bacteria | 1672 |
| 447 | Ga0373935_0174503 | 3300035692 | Bacteria | 1472 |
| 448 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 449 | Ga0373937_0504155 | 3300036401 | Bacteria | 1150 |
| 450 | Ga0373937_0639173 | 3300036401 | Bacteria | 1009 |
| 451 | Ga0373925_0005838 | 3300037068 | Bacteria | 9133 |
| 452 | Ga0395899_0000373 | 3300037312 | Bacteria | 53717 |
| 453 | Ga0395899_0021296 | 3300037312 | Bacteria | 4918 |
| 454 | Ga0395899_0117039 | 3300037312 | Bacteria | 1912 |
| 455 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 456 | Ga0395900_0044791 | 3300037418 | Bacteria | 4558 |
| 457 | Ga0395900_0268240 | 3300037418 | Bacteria | 1702 |
| 458 | Ga0395900_0376441 | 3300037418 | Bacteria | 1389 |
| 459 | Ga0395898_0003873 | 3300037466 | Bacteria | 16525 |
| 460 | Ga0395898_0040701 | 3300037466 | Bacteria | 4593 |
| 461 | Ga0395898_0287493 | 3300037466 | Bacteria | 1568 |
| 462 | Ga0395905_0073275 | 3300037471 | Bacteria | 3210 |
| 463 | Ga0395905_0223961 | 3300037471 | Bacteria | 1760 |
| 464 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 465 | Ga0395901_0132307 | 3300038443 | Bacteria | 2621 |
| 466 | Ga0400483_099121 | 3300039062 | Unclassified | 3954 |
| 467 | Ga0400483_273186 | 3300039062 | Bacteria | 1714 |
| 468 | Ga0436365_0608786 | 3300039437 | Bacteria | 20013 |
| 469 | Ga0436365_0822178 | 3300039437 | Bacteria | 2452 |
| 470 | Ga0436365_1687427 | 3300039437 | Bacteria | 16468 |
| 471 | Ga0439446_0012843 | 3300042156 | Bacteria | 2291 |
| 472 | Ga0466966_0205851 | 3300044684 | Bacteria | 1190 |
| 473 | Ga0466961_0298343 | 3300044693 | Bacteria | 985 |
| 474 | Ga0466964_0066934 | 3300044706 | Bacteria | 1509 |
| 475 | Ga0466957_0244773 | 3300044842 | Bacteria | 1191 |
| 476 | Ga0466957_0370449 | 3300044842 | Bacteria | 975 |
| 477 | Ga0466967_0115764 | 3300045976 | Bacteria | 2469 |
| 478 | Ga0495627_008977 | 3300046453 | Bacteria | 3697 |
| 479 | Ga0495629_0026670 | 3300046459 | Bacteria | 4104 |
| 480 | Ga0495638_0000588 | 3300046460 | Bacteria | 41034 |
| 481 | Ga0495638_0009677 | 3300046460 | Bacteria | 6739 |
| 482 | Ga0495650_0038545 | 3300046471 | Bacteria | 2070 |
| 483 | Ga0495664_0065179 | 3300046477 | Bacteria | 2171 |
| 484 | Ga0495584_0113063 | 3300046491 | Bacteria | 1374 |
| 485 | Ga0495585_0051526 | 3300046492 | Bacteria | 2281 |
| 486 | Ga0495607_0010068 | 3300046501 | Bacteria | 6367 |
| 487 | Ga0495583_0000013 | 3300046506 | Bacteria | 323372 |
| 488 | Ga0495583_0124545 | 3300046506 | Bacteria | 1082 |
| 489 | Ga0495606_0060947 | 3300046507 | Bacteria | 2415 |
| 490 | Ga0495608_0232412 | 3300046511 | Bacteria | 1154 |
| 491 | Ga0495610_0070618 | 3300046512 | Bacteria | 1630 |
| 492 | Ga0495616_0000053 | 3300046513 | Bacteria | 104389 |
| 493 | Ga0495618_0385616 | 3300046514 | Bacteria | 859 |
| 494 | Ga0495628_0199012 | 3300046516 | Bacteria | 1510 |
| 495 | Ga0495632_0016614 | 3300046519 | Bacteria | 4087 |
| 496 | Ga0495637_0033144 | 3300046520 | Bacteria | 2271 |
| 497 | Ga0495643_0023418 | 3300046522 | Bacteria | 3511 |
| 498 | Ga0495648_0120483 | 3300046524 | Bacteria | 1411 |
| 499 | Ga0495652_0060966 | 3300046529 | Bacteria | 3186 |
| 500 | Ga0495652_0149310 | 3300046529 | Bacteria | 1828 |
| 501 | Ga0495609_0008702 | 3300046538 | Bacteria | 4951 |
| 502 | Ga0495609_0012485 | 3300046538 | Bacteria | 4030 |
| 503 | Ga0495609_0059539 | 3300046538 | Bacteria | 1689 |
| 504 | Ga0495645_0043892 | 3300046543 | Bacteria | 3261 |
| 505 | Ga0495622_0005584 | 3300046557 | Bacteria | 5832 |
| 506 | Ga0495656_0102852 | 3300046615 | Bacteria | 1324 |
| 507 | Ga0495668_0020755 | 3300046616 | Bacteria | 3775 |
| 508 | Ga0495668_0220258 | 3300046616 | Bacteria | 1039 |
| 509 | Ga0495625_0000290 | 3300046660 | Bacteria | 77650 |
| 510 | Ga0495625_0010575 | 3300046660 | Bacteria | 7620 |
| 511 | Ga0495659_0130996 | 3300046664 | Bacteria | 994 |
| 512 | Ga0495661_0122720 | 3300046665 | Bacteria | 1433 |
| 513 | Ga0495669_0000012 | 3300046684 | Bacteria | 157373 |
| 514 | Ga0495669_0000329 | 3300046684 | Bacteria | 25520 |
| 515 | Ga0495669_0006242 | 3300046684 | Bacteria | 4974 |
| 516 | Ga0495669_0010908 | 3300046684 | Bacteria | 3846 |
| 517 | Ga0495669_0083777 | 3300046684 | Bacteria | 1466 |
| 518 | Ga0495613_0001323 | 3300046689 | Bacteria | 18949 |
| 519 | Ga0495670_0083012 | 3300046691 | Bacteria | 1634 |
| 520 | Ga0495589_0017961 | 3300046794 | Bacteria | 3628 |
| 521 | Ga0495589_0027872 | 3300046794 | Bacteria | 2855 |
| 522 | Ga0495660_0051302 | 3300046810 | Bacteria | 2245 |
| 523 | Ga0495581_0089676 | 3300047315 | Bacteria | 1783 |
| 524 | Ga0495636_0010312 | 3300047318 | Bacteria | 3688 |
| 525 | Ga0495674_0087567 | 3300047319 | Bacteria | 2665 |
| 526 | Ga0495672_0020752 | 3300047320 | Bacteria | 4299 |
| 527 | Ga0495683_0099212 | 3300047323 | Bacteria | 1402 |
| 528 | Ga0495683_0171908 | 3300047323 | Bacteria | 995 |
| 529 | Ga0495675_0026630 | 3300047444 | Bacteria | 3688 |
| 530 | Ga0495677_0049925 | 3300047445 | Bacteria | 1539 |
| 531 | Ga0495679_009102 | 3300047446 | Bacteria | 3999 |
| 532 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 533 | Ga0495686_0004501 | 3300047472 | Bacteria | 11443 |
| 534 | Ga0495686_0006929 | 3300047472 | Bacteria | 8570 |
| 535 | Ga0495593_0024764 | 3300047673 | Bacteria | 3323 |
| 536 | Ga0495602_0061766 | 3300048088 | Bacteria | 3255 |
| 537 | Ga0496100_0252034 | 3300048903 | Bacteria | 1306 |
| 538 | Ga0496102_0109303 | 3300048905 | Bacteria | 2576 |
| 539 | Ga0496103_0085277 | 3300048906 | Bacteria | 1990 |
| 540 | Ga0496103_0094179 | 3300048906 | Bacteria | 1892 |
| 541 | Ga0496106_0107999 | 3300048909 | Bacteria | 2164 |
| 542 | Ga0496107_0000329 | 3300048910 | Bacteria | 25658 |
| 543 | Ga0496109_0007918 | 3300048912 | Bacteria | 9006 |
| 544 | Ga0496112_0012967 | 3300048915 | Bacteria | 7681 |
| 545 | Ga0496112_0038361 | 3300048915 | Bacteria | 4677 |
| 546 | Ga0496112_0098500 | 3300048915 | Bacteria | 2893 |
| 547 | Ga0496113_0257013 | 3300048916 | Bacteria | 1395 |
| 548 | Ga0496115_0021383 | 3300048918 | Bacteria | 4998 |
| 549 | Ga0496116_0100460 | 3300048919 | Bacteria | 1730 |
| 550 | Ga0496117_0012409 | 3300048920 | Bacteria | 7515 |
| 551 | Ga0496118_0005681 | 3300048921 | Bacteria | 14053 |
| 552 | Ga0496119_0015319 | 3300048922 | Bacteria | 5914 |
| 553 | Ga0496121_0000323 | 3300048924 | Bacteria | 100188 |
| 554 | Ga0496121_0001066 | 3300048924 | Bacteria | 48544 |
| 555 | Ga0496121_0001417 | 3300048924 | Bacteria | 40646 |
| 556 | Ga0496126_0022200 | 3300048929 | Bacteria | 6180 |
| 557 | Ga0495682_0001343 | 3300049460 | Bacteria | 13591 |
| 558 | Ga0495682_0062588 | 3300049460 | Bacteria | 1343 |
| 559 | Ga0501031_0000410 | 3300049568 | Bacteria | 24834 |
| 560 | Ga0501032_0057586 | 3300049569 | Bacteria | 2611 |
| 561 | Ga0501032_0082237 | 3300049569 | Bacteria | 2142 |
| 562 | Ga0501032_0086002 | 3300049569 | Bacteria | 2090 |
| 563 | Ga0501033_0015415 | 3300049570 | Bacteria | 5797 |
| 564 | Ga0501033_0034540 | 3300049570 | Bacteria | 3792 |
| 565 | Ga0501033_0066291 | 3300049570 | Bacteria | 2655 |
| 566 | Ga0501033_0096994 | 3300049570 | Bacteria | 2154 |
| 567 | Ga0501033_0149405 | 3300049570 | Bacteria | 1686 |
| 568 | Ga0501033_0249566 | 3300049570 | Bacteria | 1258 |
| 569 | Ga0501033_0354024 | 3300049570 | Bacteria | 1028 |
| 570 | Ga0501034_0003773 | 3300049571 | Bacteria | 17105 |
| 571 | Ga0501034_0028085 | 3300049571 | Bacteria | 5722 |
| 572 | Ga0501034_0117073 | 3300049571 | Bacteria | 2652 |
| 573 | Ga0501034_0147231 | 3300049571 | Bacteria | 2332 |
| 574 | Ga0501036_0155901 | 3300049572 | Bacteria | 1926 |
| 575 | Ga0501036_0203336 | 3300049572 | Bacteria | 1666 |
| 576 | Ga0501036_0253542 | 3300049572 | Bacteria | 1474 |
| 577 | Ga0501037_0006688 | 3300049573 | Bacteria | 8432 |
| 578 | Ga0501037_0014739 | 3300049573 | Bacteria | 5749 |
| 579 | Ga0501038_0008309 | 3300049574 | Bacteria | 9555 |
| 580 | Ga0501038_0029932 | 3300049574 | Bacteria | 4820 |
| 581 | Ga0501038_0099217 | 3300049574 | Bacteria | 2428 |
| 582 | Ga0501038_0170045 | 3300049574 | Bacteria | 1765 |
| 583 | Ga0501038_0209717 | 3300049574 | Bacteria | 1559 |
| 584 | Ga0501039_0000235 | 3300049575 | Bacteria | 40369 |
| 585 | Ga0501039_0283619 | 3300049575 | Bacteria | 1302 |
| 586 | Ga0501042_0133852 | 3300049578 | Bacteria | 1787 |
| 587 | Ga0501043_0005296 | 3300049579 | Bacteria | 10428 |
| 588 | Ga0501043_0022404 | 3300049579 | Bacteria | 4955 |
| 589 | Ga0501043_0073969 | 3300049579 | Bacteria | 2676 |
| 590 | Ga0501043_0106634 | 3300049579 | Bacteria | 2201 |
| 591 | Ga0501043_0109852 | 3300049579 | Bacteria | 2165 |
| 592 | Ga0501043_0163059 | 3300049579 | Bacteria | 1741 |
| 593 | Ga0501043_0213720 | 3300049579 | Bacteria | 1494 |
| 594 | Ga0501046_0011825 | 3300049580 | Bacteria | 7451 |
| 595 | Ga0501046_0046363 | 3300049580 | Bacteria | 3450 |
| 596 | Ga0501046_0101159 | 3300049580 | Bacteria | 2211 |
| 597 | Ga0501046_0147548 | 3300049580 | Bacteria | 1776 |
| 598 | Ga0501047_0008942 | 3300049581 | Bacteria | 9457 |
| 599 | Ga0501047_0014685 | 3300049581 | Bacteria | 7452 |
| 600 | Ga0501047_0015297 | 3300049581 | Bacteria | 7309 |
| 601 | Ga0501047_0038426 | 3300049581 | Bacteria | 4631 |
| 602 | Ga0501047_0039375 | 3300049581 | Bacteria | 4572 |
| 603 | Ga0501047_0116475 | 3300049581 | Bacteria | 2554 |
| 604 | Ga0501047_0180847 | 3300049581 | Bacteria | 1975 |
| 605 | Ga0501047_0204412 | 3300049581 | Bacteria | 1835 |
| 606 | Ga0501047_0205926 | 3300049581 | Bacteria | 1826 |
| 607 | Ga0501047_0229493 | 3300049581 | Bacteria | 1710 |
| 608 | Ga0501047_0230844 | 3300049581 | Bacteria | 1704 |
| 609 | Ga0501047_0256700 | 3300049581 | Bacteria | 1596 |
| 610 | Ga0501047_0282870 | 3300049581 | Bacteria | 1503 |
| 611 | Ga0501047_0292524 | 3300049581 | Bacteria | 1472 |
| 612 | Ga0501047_0316856 | 3300049581 | Bacteria | 1400 |
| 613 | Ga0501047_0534070 | 3300049581 | Bacteria | 998 |
| 614 | Ga0501047_0575218 | 3300049581 | Bacteria | 950 |
| 615 | Ga0501048_0029706 | 3300049582 | Bacteria | 3961 |
| 616 | Ga0501067_0016841 | 3300049583 | Bacteria | 4037 |
| 617 | Ga0501067_0079155 | 3300049583 | Bacteria | 1821 |
| 618 | Ga0501068_0093034 | 3300049584 | Bacteria | 1862 |
| 619 | Ga0501068_0158142 | 3300049584 | Bacteria | 1427 |
| 620 | Ga0501069_0001790 | 3300049585 | Bacteria | 10750 |
| 621 | Ga0501070_0001994 | 3300049586 | Bacteria | 17942 |
| 622 | Ga0501070_0186086 | 3300049586 | Bacteria | 1708 |
| 623 | Ga0501073_0051923 | 3300049589 | Bacteria | 2871 |
| 624 | Ga0501073_0056303 | 3300049589 | Bacteria | 2750 |
| 625 | Ga0501073_0066239 | 3300049589 | Bacteria | 2518 |
| 626 | Ga0501073_0187747 | 3300049589 | Bacteria | 1430 |
| 627 | Ga0501073_0246221 | 3300049589 | Bacteria | 1234 |
| 628 | Ga0501074_0010076 | 3300049590 | Bacteria | 6862 |
| 629 | Ga0501079_0002251 | 3300049741 | Bacteria | 13917 |
| 630 | Ga0501080_0000748 | 3300049742 | Bacteria | 26257 |
| 631 | Ga0501080_0025188 | 3300049742 | Bacteria | 5521 |
| 632 | Ga0501080_0107922 | 3300049742 | Bacteria | 2580 |
| 633 | Ga0501080_0118789 | 3300049742 | Bacteria | 2451 |
| 634 | Ga0501080_0253297 | 3300049742 | Bacteria | 1605 |
| 635 | Ga0501080_0295341 | 3300049742 | Bacteria | 1470 |
| 636 | Ga0501083_0030847 | 3300049744 | Bacteria | 3679 |
| 637 | Ga0501083_0044781 | 3300049744 | Bacteria | 2995 |
| 638 | Ga0501035_0017113 | 3300049822 | Bacteria | 6680 |
| 639 | Ga0501035_0018463 | 3300049822 | Bacteria | 6425 |
| 640 | Ga0501035_0118020 | 3300049822 | Bacteria | 2321 |
| 641 | Ga0501035_0156589 | 3300049822 | Bacteria | 1974 |
| 642 | Ga0501035_0165350 | 3300049822 | Bacteria | 1913 |
| 643 | Ga0501035_0178421 | 3300049822 | Bacteria | 1831 |
| 644 | Ga0501035_0183071 | 3300049822 | Bacteria | 1804 |
| 645 | Ga0501044_0004024 | 3300049823 | Bacteria | 16477 |
| 646 | Ga0501044_0005225 | 3300049823 | Bacteria | 14446 |
| 647 | Ga0501044_0007695 | 3300049823 | Bacteria | 11848 |
| 648 | Ga0501044_0013403 | 3300049823 | Bacteria | 8866 |
| 649 | Ga0501044_0017089 | 3300049823 | Bacteria | 7785 |
| 650 | Ga0501044_0024916 | 3300049823 | Bacteria | 6345 |
| 651 | Ga0501044_0034581 | 3300049823 | Bacteria | 5298 |
| 652 | Ga0501044_0063978 | 3300049823 | Bacteria | 3756 |
| 653 | Ga0501044_0177572 | 3300049823 | Bacteria | 2098 |
| 654 | Ga0501044_0362358 | 3300049823 | Bacteria | 1367 |
| 655 | Ga0501044_0469118 | 3300049823 | Bacteria | 1163 |
| 656 | Ga0500635_0000045 | 3300053080 | Bacteria | 87314 |
| 657 | Ga0500643_001557 | 3300053087 | Bacteria | 12986 |
| 658 | Ga0500643_056137 | 3300053087 | Bacteria | 1114 |
| 659 | Ga0500647_0012997 | 3300053091 | Bacteria | 3758 |
| 660 | Ga0500651_0041537 | 3300053093 | Bacteria | 2899 |
| 661 | Ga0500566_0065888 | 3300053094 | Bacteria | 2042 |
| 662 | Ga0500555_057557 | 3300053103 | Bacteria | 1052 |
| 663 | Ga0500556_0000558 | 3300053104 | Bacteria | 24866 |
| 664 | Ga0500562_000146 | 3300053108 | Bacteria | 20862 |
| 665 | Ga0500562_002766 | 3300053108 | Bacteria | 4364 |
| 666 | Ga0500569_003672 | 3300053109 | Bacteria | 3164 |
| 667 | Ga0500595_000109 | 3300053119 | Bacteria | 55874 |
| 668 | Ga0500595_005023 | 3300053119 | Bacteria | 5823 |
| 669 | Ga0500595_025427 | 3300053119 | Bacteria | 2052 |
| 670 | Ga0500595_042868 | 3300053119 | Bacteria | 1444 |
| 671 | Ga0500608_007195 | 3300053122 | Bacteria | 4588 |
| 672 | Ga0500608_138252 | 3300053122 | Bacteria | 1083 |
| 673 | Ga0500614_000738 | 3300053123 | Bacteria | 8335 |
| 674 | Ga0500614_002916 | 3300053123 | Bacteria | 3750 |
| 675 | Ga0500618_000319 | 3300053125 | Bacteria | 35375 |
| 676 | Ga0500642_0048951 | 3300053130 | Bacteria | 1858 |
| 677 | Ga0500559_0000010 | 3300053136 | Bacteria | 165569 |
| 678 | Ga0500559_0000280 | 3300053136 | Bacteria | 39387 |
| 679 | Ga0500559_0002775 | 3300053136 | Bacteria | 8869 |
| 680 | Ga0500559_0022050 | 3300053136 | Bacteria | 2701 |
| 681 | Ga0500573_0000060 | 3300053140 | Bacteria | 68257 |
| 682 | Ga0500577_0056064 | 3300053142 | Bacteria | 1498 |
| 683 | Ga0500590_019652 | 3300053148 | Bacteria | 3501 |
| 684 | Ga0500603_017944 | 3300053150 | Bacteria | 1698 |
| 685 | Ga0500619_043785 | 3300053154 | Bacteria | 1424 |
| 686 | Ga0500624_006347 | 3300053157 | Bacteria | 1596 |
| 687 | Ga0500638_024821 | 3300053162 | Bacteria | 2862 |
| 688 | Ga0500636_0015065 | 3300053177 | Bacteria | 4552 |
| 689 | Ga0500637_0026874 | 3300053178 | Bacteria | 3173 |
| 690 | Ga0500596_001528 | 3300053735 | Bacteria | 4685 |
| 691 | Ga0501084_0001533 | 3300054114 | Bacteria | 18366 |
| 692 | Ga0501084_0317101 | 3300054114 | Bacteria | 1317 |
| 693 | Ga0587106_001307 | 3300059605 | Bacteria | 2163 |
| 694 | Ga0587115_001276 | 3300059626 | Bacteria | 2245 |
| 695 | Ga0587111_0006226 | 3300060346 | Bacteria | 1884 |
| 696 | Ga0501082_0007247 | 3300060353 | Bacteria | 9566 |
| 697 | Ga0501082_0087600 | 3300060353 | Bacteria | 2686 |
| 698 | Ga0501082_0095496 | 3300060353 | Bacteria | 2569 |
| 699 | 2511121725 | 2510917020 | Bacteria | 5657507 |
| 700 | 2585148988 | 2582581279 | Bacteria | 4980720 |
| 701 | 2585151606 | 2582581280 | Bacteria | 5994497 |
| 702 | 2585195520 | 2582581293 | Bacteria | 5907401 |
| 703 | 2643922933 | 2643221583 | Bacteria | 5218014 |
| 704 | 2644086731 | 2643221614 | Bacteria | 4260023 |
| 705 | 2644341685 | 2643221661 | Bacteria | 4267604 |
| 706 | 2644367972 | 2643221666 | Bacteria | 4265935 |
| 707 | 2819536336 | 2818991435 | Bacteria | 5433759 |
| 708 | 2819644591 | 2818991454 | Bacteria | 5563326 |
| 709 | Ga0395900_0013659 | |||
| 710 | JGI25165J46597_1000246 | |||
| 711 | rootH2_10076543 | |||
| 712 | rootH2_10091432 | |||
| 713 | rootH2_10215532 | |||
| 714 | rootH1_10147226 | |||
| 715 | Ga0055530_10002084 | |||
| 716 | Ga0055531_10018190 | |||
| 717 | Ga0055531_10024884 | |||
| 718 | Ga0065165_1001609 | |||
| 719 | Ga0065165_1033482 | |||
| 720 | Ga0070658_10031693 | |||
| 721 | Ga0070658_10053126 | |||
| 722 | Ga0070658_10092982 | |||
| 723 | Ga0070658_10158845 | |||
| 724 | Ga0070658_10615499 | |||
| 725 | Ga0070676_10020754 | |||
| 726 | Ga0070676_10058323 | |||
| 727 | Ga0070683_100033946 | |||
| 728 | Ga0070683_100431826 | |||
| 729 | Ga0070690_100189341 | |||
| 730 | Ga0070670_100000032 | |||
| 731 | Ga0070670_100381439 | |||
| 732 | Ga0068869_100115684 | |||
| 733 | Ga0070666_10000876 | |||
| 734 | Ga0070666_10045197 | |||
| 735 | Ga0070680_100000023 | |||
| 736 | Ga0070680_100008042 | |||
| 737 | Ga0070680_100028667 | |||
| 738 | Ga0070680_100083497 | |||
| 739 | Ga0070680_100447786 | |||
| 740 | Ga0068868_100051414 | |||
| 741 | Ga0068868_100153216 | |||
| 742 | Ga0070660_100016351 | |||
| 743 | Ga0070691_10007450 | |||
| 744 | Ga0070661_100041966 | |||
| 745 | Ga0070661_100115097 | |||
| 746 | Ga0070661_100293516 | |||
| 747 | Ga0070661_100434325 | |||
| 748 | Ga0070668_100006777 | |||
| 749 | Ga0070668_100042587 | |||
| 750 | Ga0070668_100197444 | |||
| 751 | Ga0070671_100016016 | |||
| 752 | Ga0070671_100062735 | |||
| 753 | Ga0070671_100072799 | |||
| 754 | Ga0070671_100240560 | |||
| 755 | Ga0070673_100086794 | |||
| 756 | Ga0070673_100315123 | |||
| 757 | Ga0070659_100000638 | |||
| 758 | Ga0070659_100002173 | |||
| 759 | Ga0070659_100122823 | |||
| 760 | Ga0070659_100315024 | |||
| 761 | Ga0070667_100000110 | |||
| 762 | Ga0070667_100039898 | |||
| 763 | Ga0070667_100070166 | |||
| 764 | Ga0070667_100263475 | |||
| 765 | Ga0070714_100851993 | |||
| 766 | Ga0070710_10150255 | |||
| 767 | Ga0070711_100044271 | |||
| 768 | Ga0070678_100080752 | |||
| 769 | Ga0070678_100447518 | |||
| 770 | Ga0070662_100156567 | |||
| 771 | Ga0070681_10000002 | |||
| 772 | Ga0070681_10020584 | |||
| 773 | Ga0070681_10054201 | |||
| 774 | Ga0070681_10087050 | |||
| 775 | Ga0068867_100010512 | |||
| 776 | Ga0070685_10154056 | |||
| 777 | Ga0070679_100000714 | |||
| 778 | Ga0070679_100024422 | |||
| 779 | Ga0070679_100130619 | |||
| 780 | Ga0070679_100138407 | |||
| 781 | Ga0070684_100025106 | |||
| 782 | Ga0070684_100217300 | |||
| 783 | Ga0068853_100076100 | |||
| 784 | Ga0068853_100103458 | |||
| 785 | Ga0068853_100118538 | |||
| 786 | Ga0068853_100211549 | |||
| 787 | Ga0068853_100225246 | |||
| 788 | Ga0068853_100338462 | |||
| 789 | Ga0070693_100112240 | |||
| 790 | Ga0070693_100138614 | |||
| 791 | Ga0070665_100000433 | |||
| 792 | Ga0070665_100003422 | |||
| 793 | Ga0070665_100006669 | |||
| 794 | Ga0070665_100046328 | |||
| 795 | Ga0070665_100054383 | |||
| 796 | Ga0070665_100057028 | |||
| 797 | Ga0070665_100188852 | |||
| 798 | Ga0068855_100000301 | |||
| 799 | Ga0068855_100027861 | |||
| 800 | Ga0068855_100036970 | |||
| 801 | Ga0068855_100196366 | |||
| 802 | Ga0068855_100232531 | |||
| 803 | Ga0068855_100240169 | |||
| 804 | Ga0068855_100246001 | |||
| 805 | Ga0068855_100535394 | |||
| 806 | Ga0070664_100182755 | |||
| 807 | Ga0068856_100194577 | |||
| 808 | Ga0068856_100280345 | |||
| 809 | Ga0068856_100440895 | |||
| 810 | Ga0068856_100829929 | |||
| 811 | Ga0068852_100052440 | |||
| 812 | Ga0068852_100058395 | |||
| 813 | Ga0068852_100122392 | |||
| 814 | Ga0068859_100191817 | |||
| 815 | Ga0068859_100378215 | |||
| 816 | Ga0068864_100000184 | |||
| 817 | Ga0068864_100000321 | |||
| 818 | Ga0068866_10065240 | |||
| 819 | Ga0068861_100363900 | |||
| 820 | Ga0068861_100552193 | |||
| 821 | Ga0068863_100000037 | |||
| 822 | Ga0068863_100001377 | |||
| 823 | Ga0068858_100000029 | |||
| 824 | Ga0068858_100006036 | |||
| 825 | Ga0068858_100128417 | |||
| 826 | Ga0068858_100129465 | |||
| 827 | Ga0068860_100000100 | |||
| 828 | Ga0068860_100000167 | |||
| 829 | Ga0068860_100148872 | |||
| 830 | Ga0068862_100008644 | |||
| 831 | Ga0068862_100103621 | |||
| 832 | Ga0068862_100717426 | |||
| 833 | Ga0075366_10148732 | |||
| 834 | Ga0097621_100001198 | |||
| 835 | Ga0097621_100075644 | |||
| 836 | Ga0097621_100078408 | |||
| 837 | Ga0097621_100124335 | |||
| 838 | Ga0097621_100159729 | |||
| 839 | Ga0068871_100001487 | |||
| 840 | Ga0068871_100044818 | |||
| 841 | Ga0068871_100095041 | |||
| 842 | Ga0068871_100159533 | |||
| 843 | Ga0068871_100217893 | |||
| 844 | Ga0068871_100605204 | |||
| 845 | Ga0068865_100000664 | |||
| 846 | Ga0068865_100030073 | |||
| 847 | Ga0097620_100191818 | |||
| 848 | Ga0097620_100378199 | |||
| 849 | Ga0079104_1016322 | |||
| 850 | Ga0105250_10006833 | |||
| 851 | Ga0105240_10000564 | |||
| 852 | Ga0105240_10000944 | |||
| 853 | Ga0105240_10013845 | |||
| 854 | Ga0105240_10119623 | |||
| 855 | Ga0105240_10157507 | |||
| 856 | Ga0105240_10189179 | |||
| 857 | Ga0105240_10254003 | |||
| 858 | Ga0105240_10349912 | |||
| 859 | Ga0105240_10394542 | |||
| 860 | Ga0105240_10527564 | |||
| 861 | Ga0105240_10534774 | |||
| 862 | Ga0105245_10046489 | |||
| 863 | Ga0105245_10053099 | |||
| 864 | Ga0105245_10109674 | |||
| 865 | Ga0105245_10225300 | |||
| 866 | Ga0105247_10051693 | |||
| 867 | Ga0105247_10120373 | |||
| 868 | Ga0105243_10008311 | |||
| 869 | Ga0105241_10050241 | |||
| 870 | Ga0105241_10106864 | |||
| 871 | Ga0105241_10125529 | |||
| 872 | Ga0105242_10043224 | |||
| 873 | Ga0105242_10104462 | |||
| 874 | Ga0105242_10696980 | |||
| 875 | Ga0105242_10806888 | |||
| 876 | Ga0105248_10000280 | |||
| 877 | Ga0105248_10022042 | |||
| 878 | Ga0105248_10022642 | |||
| 879 | Ga0105248_10024868 | |||
| 880 | Ga0105248_10099751 | |||
| 881 | Ga0105248_10740840 | |||
| 882 | Ga0105237_10108918 | |||
| 883 | Ga0105237_10144627 | |||
| 884 | Ga0105237_10153769 | |||
| 885 | Ga0105237_10387513 | |||
| 886 | Ga0105238_10005585 | |||
| 887 | Ga0105238_10007619 | |||
| 888 | Ga0105238_10024527 | |||
| 889 | Ga0105238_10069310 | |||
| 890 | Ga0105238_10078904 | |||
| 891 | Ga0105238_10164055 | |||
| 892 | Ga0105238_10236576 | |||
| 893 | Ga0105238_10374770 | |||
| 894 | Ga0105238_10399171 | |||
| 895 | Ga0105238_10528973 | |||
| 896 | Ga0105238_10782230 | |||
| 897 | Ga0105249_10010828 | |||
| 898 | Ga0105249_10073283 | |||
| 899 | Ga0105249_10094935 | |||
| 900 | Ga0105249_10261115 | |||
| 901 | Ga0105249_10270726 | |||
| 902 | Ga0105249_10767843 | |||
| 903 | Ga0105239_10003451 | |||
| 904 | Ga0105239_10052496 | |||
| 905 | Ga0105239_10082819 | |||
| 906 | Ga0105239_10102209 | |||
| 907 | Ga0105239_10124257 | |||
| 908 | Ga0105239_10326146 | |||
| 909 | Ga0105239_10503921 | |||
| 910 | Ga0105246_10261917 | |||
| 911 | Ga0157373_10001320 | |||
| 912 | Ga0157373_10012399 | |||
| 913 | Ga0157373_10066755 | |||
| 914 | Ga0157370_10037032 | |||
| 915 | Ga0157370_10063705 | |||
| 916 | Ga0157370_10214089 | |||
| 917 | Ga0157370_10390438 | |||
| 918 | Ga0157370_10733469 | |||
| 919 | Ga0157369_10033563 | |||
| 920 | Ga0157369_10043173 | |||
| 921 | Ga0157369_10129964 | |||
| 922 | Ga0157369_10356992 | |||
| 923 | Ga0157369_10414959 | |||
| 924 | Ga0157374_10349054 | |||
| 925 | Ga0157378_10093553 | |||
| 926 | Ga0157378_10122253 | |||
| 927 | Ga0157378_10504369 | |||
| 928 | Ga0163162_10498463 | |||
| 929 | Ga0157372_10137960 | |||
| 930 | Ga0157372_10240479 | |||
| 931 | Ga0157372_10294097 | |||
| 932 | Ga0157375_10082401 | |||
| 933 | Ga0157375_11204393 | |||
| 934 | Ga0163163_10000004 | |||
| 935 | Ga0163163_10105669 | |||
| 936 | Ga0163163_10123295 | |||
| 937 | Ga0163163_10170425 | |||
| 938 | Ga0163163_10224747 | |||
| 939 | Ga0163163_10320712 | |||
| 940 | Ga0157379_10005280 | |||
| 941 | Ga0157379_10016863 | |||
| 942 | Ga0157379_10023062 | |||
| 943 | Ga0157376_10452485 | |||
| 944 | Ga0157376_10490741 | |||
| 945 | Ga0163161_10027011 | |||
| 946 | Ga0207427_103528 | |||
| 947 | Ga0209026_1000851 | |||
| 948 | Ga0209233_1000006 | |||
| 949 | Ga0209564_1006954 | |||
| 950 | Ga0209758_1000008 | |||
| 951 | Ga0209758_1000331 | |||
| 952 | Ga0209758_1065746 | |||
| 953 | Ga0209050_1000130 | |||
| 954 | Ga0209257_1000059 | |||
| 955 | Ga0209257_1000246 | |||
| 956 | Ga0209257_1001754 | |||
| 957 | Ga0207696_1040002 | |||
| 958 | Ga0207710_10141812 | |||
| 959 | Ga0207688_10072794 | |||
| 960 | Ga0207680_10001291 | |||
| 961 | Ga0207680_10156008 | |||
| 962 | Ga0207680_10164460 | |||
| 963 | Ga0207647_10137483 | |||
| 964 | Ga0207705_10000970 | |||
| 965 | Ga0207705_10034055 | |||
| 966 | Ga0207705_10232506 | |||
| 967 | Ga0207705_10442734 | |||
| 968 | Ga0207654_10093549 | |||
| 969 | Ga0207654_10233109 | |||
| 970 | Ga0207707_10000002 | |||
| 971 | Ga0207707_10037873 | |||
| 972 | Ga0207695_10000003 | |||
| 973 | Ga0207695_10004245 | |||
| 974 | Ga0207695_10010734 | |||
| 975 | Ga0207695_10011375 | |||
| 976 | Ga0207695_10069921 | |||
| 977 | Ga0207695_10092691 | |||
| 978 | Ga0207695_10132018 | |||
| 979 | Ga0207695_10205673 | |||
| 980 | Ga0207695_10303416 | |||
| 981 | Ga0207695_10321870 | |||
| 982 | Ga0207695_10387917 | |||
| 983 | Ga0207695_10441565 | |||
| 984 | Ga0207671_10230063 | |||
| 985 | Ga0207660_10003432 | |||
| 986 | Ga0207660_10015133 | |||
| 987 | Ga0207660_10374695 | |||
| 988 | Ga0207649_10099121 | |||
| 989 | Ga0207649_10191177 | |||
| 990 | Ga0207649_10304239 | |||
| 991 | Ga0207652_10000641 | |||
| 992 | Ga0207652_10004285 | |||
| 993 | Ga0207652_10176631 | |||
| 994 | Ga0207652_10197875 | |||
| 995 | Ga0207694_10000016 | |||
| 996 | Ga0207694_10020349 | |||
| 997 | Ga0207694_10059819 | |||
| 998 | Ga0207694_10208300 | |||
| 999 | Ga0207694_10251364 | |||
| 1000 | Ga0207694_10252963 | |||
| 1001 | Ga0207694_10261294 | |||
| 1002 | Ga0207694_10444388 | |||
| 1003 | Ga0207650_10000074 | |||
| 1004 | Ga0207650_10152295 | |||
| 1005 | Ga0207650_10349449 | |||
| 1006 | Ga0207659_10008634 | |||
| 1007 | Ga0207687_10072593 | |||
| 1008 | Ga0207687_10075128 | |||
| 1009 | Ga0207687_10143736 | |||
| 1010 | Ga0207687_10338732 | |||
| 1011 | Ga0207644_10012414 | |||
| 1012 | Ga0207644_10119076 | |||
| 1013 | Ga0207644_10180958 | |||
| 1014 | Ga0207644_10407319 | |||
| 1015 | Ga0207690_10000159 | |||
| 1016 | Ga0207690_10006522 | |||
| 1017 | Ga0207690_10060485 | |||
| 1018 | Ga0207690_10574778 | |||
| 1019 | Ga0207706_10049653 | |||
| 1020 | Ga0207706_10492146 | |||
| 1021 | Ga0207686_10044035 | |||
| 1022 | Ga0207686_10070243 | |||
| 1023 | Ga0207709_10012017 | |||
| 1024 | Ga0207669_10011030 | |||
| 1025 | Ga0207704_10001590 | |||
| 1026 | Ga0207704_10008398 | |||
| 1027 | Ga0207691_10356149 | |||
| 1028 | Ga0207711_10007049 | |||
| 1029 | Ga0207711_10022124 | |||
| 1030 | Ga0207711_10037615 | |||
| 1031 | Ga0207711_10365278 | |||
| 1032 | Ga0207689_10050504 | |||
| 1033 | Ga0207679_10011413 | |||
| 1034 | Ga0207679_10133980 | |||
| 1035 | Ga0207667_10000021 | |||
| 1036 | Ga0207667_10046655 | |||
| 1037 | Ga0207667_10049413 | |||
| 1038 | Ga0207667_10107498 | |||
| 1039 | Ga0207667_10125211 | |||
| 1040 | Ga0207667_10127520 | |||
| 1041 | Ga0207667_10202470 | |||
| 1042 | Ga0207667_10221876 | |||
| 1043 | Ga0207712_10006330 | |||
| 1044 | Ga0207712_10049994 | |||
| 1045 | Ga0207712_10064732 | |||
| 1046 | Ga0207668_10000001 | |||
| 1047 | Ga0207668_10000246 | |||
| 1048 | Ga0207640_10096969 | |||
| 1049 | Ga0207658_10000275 | |||
| 1050 | Ga0207658_10026953 | |||
| 1051 | Ga0207658_10031695 | |||
| 1052 | Ga0207658_10289521 | |||
| 1053 | Ga0207677_10032925 | |||
| 1054 | Ga0207703_10001093 | |||
| 1055 | Ga0207703_10054178 | |||
| 1056 | Ga0207703_10086103 | |||
| 1057 | Ga0207703_10360642 | |||
| 1058 | Ga0207639_10014523 | |||
| 1059 | Ga0207639_10043000 | |||
| 1060 | Ga0207639_10061463 | |||
| 1061 | Ga0207639_10094891 | |||
| 1062 | Ga0207639_10166908 | |||
| 1063 | Ga0207639_10211323 | |||
| 1064 | Ga0207639_10245397 | |||
| 1065 | Ga0207639_10320795 | |||
| 1066 | Ga0207639_10609170 | |||
| 1067 | Ga0207708_10068878 | |||
| 1068 | Ga0207702_10095020 | |||
| 1069 | Ga0207702_10316832 | |||
| 1070 | Ga0207702_10572709 | |||
| 1071 | Ga0207702_10923761 | |||
| 1072 | Ga0207641_10000034 | |||
| 1073 | Ga0207641_10001917 | |||
| 1074 | Ga0207648_10016983 | |||
| 1075 | Ga0207648_10047240 | |||
| 1076 | Ga0207676_10000202 | |||
| 1077 | Ga0207676_10001101 | |||
| 1078 | Ga0207676_10004781 | |||
| 1079 | Ga0207674_10052452 | |||
| 1080 | Ga0207674_10164284 | |||
| 1081 | Ga0207674_10286716 | |||
| 1082 | Ga0207674_10418990 | |||
| 1083 | Ga0207675_100444220 | |||
| 1084 | Ga0207698_10034015 | |||
| 1085 | Ga0207698_10064132 | |||
| 1086 | Ga0209981_1003305 | |||
| 1087 | Ga0209999_1005248 | |||
| 1088 | Ga0268266_10000003 | |||
| 1089 | Ga0268266_10000289 | |||
| 1090 | Ga0268266_10000746 | |||
| 1091 | Ga0268266_10012231 | |||
| 1092 | Ga0268266_10022231 | |||
| 1093 | Ga0268266_10038206 | |||
| 1094 | Ga0268266_10048721 | |||
| 1095 | Ga0268266_10090410 | |||
| 1096 | Ga0268266_10101306 | |||
| 1097 | Ga0268265_10000648 | |||
| 1098 | Ga0268265_10276562 | |||
| 1099 | Ga0268265_10560268 | |||
| 1100 | Ga0268264_10000002 | |||
| 1101 | Ga0268264_10000068 | |||
| 1102 | Ga0268264_10459255 | |||
| 1103 | Ga0265318_10001360 | |||
| 1104 | Ga0307517_10002267 | |||
| 1105 | Ga0307517_10033152 | |||
| 1106 | Ga0307517_10074807 | |||
| 1107 | Ga0307517_10199204 | |||
| 1108 | Ga0307515_10012598 | |||
| 1109 | Ga0265338_10007293 | |||
| 1110 | Ga0307511_10030594 | |||
| 1111 | Ga0265760_10021543 | |||
| 1112 | Ga0265332_10011546 | |||
| 1113 | Ga0265325_10004954 | |||
| 1114 | Ga0265325_10050543 | |||
| 1115 | Ga0265340_10036654 | |||
| 1116 | Ga0265340_10050883 | |||
| 1117 | Ga0265339_10009253 | |||
| 1118 | Ga0265339_10047970 | |||
| 1119 | Ga0265339_10048746 | |||
| 1120 | Ga0265339_10090711 | |||
| 1121 | Ga0265331_10000080 | |||
| 1122 | Ga0265331_10007961 | |||
| 1123 | Ga0265331_10039691 | |||
| 1124 | Ga0265331_10045360 | |||
| 1125 | Ga0265327_10003877 | |||
| 1126 | Ga0265327_10008511 | |||
| 1127 | Ga0265327_10163968 | |||
| 1128 | Ga0265316_10075979 | |||
| 1129 | Ga0265316_10094004 | |||
| 1130 | Ga0307513_10000045 | |||
| 1131 | Ga0307513_10000790 | |||
| 1132 | Ga0307513_10004139 | |||
| 1133 | Ga0307513_10478974 | |||
| 1134 | Ga0265313_10041225 | |||
| 1135 | Ga0265313_10042413 | |||
| 1136 | Ga0265313_10079895 | |||
| 1137 | Ga0265314_10007720 | |||
| 1138 | Ga0265314_10024020 | |||
| 1139 | Ga0265314_10043804 | |||
| 1140 | Ga0265314_10051744 | |||
| 1141 | Ga0265314_10066847 | |||
| 1142 | Ga0265314_10086198 | |||
| 1143 | Ga0265342_10029142 | |||
| 1144 | Ga0265342_10113010 | |||
| 1145 | Ga0307516_10078605 | |||
| 1146 | Ga0307516_10200559 | |||
| 1147 | Ga0307413_10272838 | |||
| 1148 | Ga0307510_10045879 | |||
| 1149 | Ga0307510_10160178 | |||
| 1150 | Ga0307510_10162304 | |||
| 1151 | Ga0373936_0002176 | |||
| 1152 | Ga0373936_0039837 | |||
| 1153 | Ga0373939_0068037 | |||
| 1154 | Ga0373942_0020166 | |||
| 1155 | Ga0373935_0174503 | |||
| 1156 | Ga0373927_0000479 | |||
| 1157 | Ga0373937_0504155 | |||
| 1158 | Ga0373937_0639173 | |||
| 1159 | Ga0373925_0005838 | |||
| 1160 | Ga0395899_0000373 | |||
| 1161 | Ga0395899_0021296 | |||
| 1162 | Ga0395899_0117039 | |||
| 1163 | Ga0395900_0000052 | |||
| 1164 | Ga0395900_0044791 | |||
| 1165 | Ga0395900_0268240 | |||
| 1166 | Ga0395900_0376441 | |||
| 1167 | Ga0395898_0003873 | |||
| 1168 | Ga0395898_0040701 | |||
| 1169 | Ga0395898_0287493 | |||
| 1170 | Ga0395905_0073275 | |||
| 1171 | Ga0395905_0223961 | |||
| 1172 | Ga0395901_0000001 | |||
| 1173 | Ga0395901_0132307 | |||
| 1174 | Ga0400483_099121 | |||
| 1175 | Ga0400483_273186 | |||
| 1176 | Ga0436365_0608786 | |||
| 1177 | Ga0436365_0822178 | |||
| 1178 | Ga0436365_1687427 | |||
| 1179 | Ga0439446_0012843 | |||
| 1180 | Ga0466966_0205851 | |||
| 1181 | Ga0466961_0298343 | |||
| 1182 | Ga0466964_0066934 | |||
| 1183 | Ga0466957_0244773 | |||
| 1184 | Ga0466957_0370449 | |||
| 1185 | Ga0466967_0115764 | |||
| 1186 | Ga0495627_008977 | |||
| 1187 | Ga0495629_0026670 | |||
| 1188 | Ga0495638_0000588 | |||
| 1189 | Ga0495638_0009677 | |||
| 1190 | Ga0495650_0038545 | |||
| 1191 | Ga0495664_0065179 | |||
| 1192 | Ga0495584_0113063 | |||
| 1193 | Ga0495585_0051526 | |||
| 1194 | Ga0495607_0010068 | |||
| 1195 | Ga0495583_0000013 | |||
| 1196 | Ga0495583_0124545 | |||
| 1197 | Ga0495606_0060947 | |||
| 1198 | Ga0495608_0232412 | |||
| 1199 | Ga0495610_0070618 | |||
| 1200 | Ga0495616_0000053 | |||
| 1201 | Ga0495618_0385616 | |||
| 1202 | Ga0495628_0199012 | |||
| 1203 | Ga0495632_0016614 | |||
| 1204 | Ga0495637_0033144 | |||
| 1205 | Ga0495643_0023418 | |||
| 1206 | Ga0495648_0120483 | |||
| 1207 | Ga0495652_0060966 | |||
| 1208 | Ga0495652_0149310 | |||
| 1209 | Ga0495609_0008702 | |||
| 1210 | Ga0495609_0012485 | |||
| 1211 | Ga0495609_0059539 | |||
| 1212 | Ga0495645_0043892 | |||
| 1213 | Ga0495622_0005584 | |||
| 1214 | Ga0495656_0102852 | |||
| 1215 | Ga0495668_0020755 | |||
| 1216 | Ga0495668_0220258 | |||
| 1217 | Ga0495625_0000290 | |||
| 1218 | Ga0495625_0010575 | |||
| 1219 | Ga0495659_0130996 | |||
| 1220 | Ga0495661_0122720 | |||
| 1221 | Ga0495669_0000012 | |||
| 1222 | Ga0495669_0000329 | |||
| 1223 | Ga0495669_0006242 | |||
| 1224 | Ga0495669_0010908 | |||
| 1225 | Ga0495669_0083777 | |||
| 1226 | Ga0495613_0001323 | |||
| 1227 | Ga0495670_0083012 | |||
| 1228 | Ga0495589_0017961 | |||
| 1229 | Ga0495589_0027872 | |||
| 1230 | Ga0495660_0051302 | |||
| 1231 | Ga0495581_0089676 | |||
| 1232 | Ga0495636_0010312 | |||
| 1233 | Ga0495674_0087567 | |||
| 1234 | Ga0495672_0020752 | |||
| 1235 | Ga0495683_0099212 | |||
| 1236 | Ga0495683_0171908 | |||
| 1237 | Ga0495675_0026630 | |||
| 1238 | Ga0495677_0049925 | |||
| 1239 | Ga0495679_009102 | |||
| 1240 | Ga0495673_0000025 | |||
| 1241 | Ga0495686_0004501 | |||
| 1242 | Ga0495686_0006929 | |||
| 1243 | Ga0495593_0024764 | |||
| 1244 | Ga0495602_0061766 | |||
| 1245 | Ga0496100_0252034 | |||
| 1246 | Ga0496102_0109303 | |||
| 1247 | Ga0496103_0085277 | |||
| 1248 | Ga0496103_0094179 | |||
| 1249 | Ga0496106_0107999 | |||
| 1250 | Ga0496107_0000329 | |||
| 1251 | Ga0496109_0007918 | |||
| 1252 | Ga0496112_0012967 | |||
| 1253 | Ga0496112_0038361 | |||
| 1254 | Ga0496112_0098500 | |||
| 1255 | Ga0496113_0257013 | |||
| 1256 | Ga0496115_0021383 | |||
| 1257 | Ga0496116_0100460 | |||
| 1258 | Ga0496117_0012409 | |||
| 1259 | Ga0496118_0005681 | |||
| 1260 | Ga0496119_0015319 | |||
| 1261 | Ga0496121_0000323 | |||
| 1262 | Ga0496121_0001066 | |||
| 1263 | Ga0496121_0001417 | |||
| 1264 | Ga0496126_0022200 | |||
| 1265 | Ga0495682_0001343 | |||
| 1266 | Ga0495682_0062588 | |||
| 1267 | Ga0501031_0000410 | |||
| 1268 | Ga0501032_0057586 | |||
| 1269 | Ga0501032_0082237 | |||
| 1270 | Ga0501032_0086002 | |||
| 1271 | Ga0501033_0015415 | |||
| 1272 | Ga0501033_0034540 | |||
| 1273 | Ga0501033_0066291 | |||
| 1274 | Ga0501033_0096994 | |||
| 1275 | Ga0501033_0149405 | |||
| 1276 | Ga0501033_0249566 | |||
| 1277 | Ga0501033_0354024 | |||
| 1278 | Ga0501034_0003773 | |||
| 1279 | Ga0501034_0028085 | |||
| 1280 | Ga0501034_0117073 | |||
| 1281 | Ga0501034_0147231 | |||
| 1282 | Ga0501036_0155901 | |||
| 1283 | Ga0501036_0203336 | |||
| 1284 | Ga0501036_0253542 | |||
| 1285 | Ga0501037_0006688 | |||
| 1286 | Ga0501037_0014739 | |||
| 1287 | Ga0501038_0008309 | |||
| 1288 | Ga0501038_0029932 | |||
| 1289 | Ga0501038_0099217 | |||
| 1290 | Ga0501038_0170045 | |||
| 1291 | Ga0501038_0209717 | |||
| 1292 | Ga0501039_0000235 | |||
| 1293 | Ga0501039_0283619 | |||
| 1294 | Ga0501042_0133852 | |||
| 1295 | Ga0501043_0005296 | |||
| 1296 | Ga0501043_0022404 | |||
| 1297 | Ga0501043_0073969 | |||
| 1298 | Ga0501043_0106634 | |||
| 1299 | Ga0501043_0109852 | |||
| 1300 | Ga0501043_0163059 | |||
| 1301 | Ga0501043_0213720 | |||
| 1302 | Ga0501046_0011825 | |||
| 1303 | Ga0501046_0046363 | |||
| 1304 | Ga0501046_0101159 | |||
| 1305 | Ga0501046_0147548 | |||
| 1306 | Ga0501047_0008942 | |||
| 1307 | Ga0501047_0014685 | |||
| 1308 | Ga0501047_0015297 | |||
| 1309 | Ga0501047_0038426 | |||
| 1310 | Ga0501047_0039375 | |||
| 1311 | Ga0501047_0116475 | |||
| 1312 | Ga0501047_0180847 | |||
| 1313 | Ga0501047_0204412 | |||
| 1314 | Ga0501047_0205926 | |||
| 1315 | Ga0501047_0229493 | |||
| 1316 | Ga0501047_0230844 | |||
| 1317 | Ga0501047_0256700 | |||
| 1318 | Ga0501047_0282870 | |||
| 1319 | Ga0501047_0292524 | |||
| 1320 | Ga0501047_0316856 | |||
| 1321 | Ga0501047_0534070 | |||
| 1322 | Ga0501047_0575218 | |||
| 1323 | Ga0501048_0029706 | |||
| 1324 | Ga0501067_0016841 | |||
| 1325 | Ga0501067_0079155 | |||
| 1326 | Ga0501068_0093034 | |||
| 1327 | Ga0501068_0158142 | |||
| 1328 | Ga0501069_0001790 | |||
| 1329 | Ga0501070_0001994 | |||
| 1330 | Ga0501070_0186086 | |||
| 1331 | Ga0501073_0051923 | |||
| 1332 | Ga0501073_0056303 | |||
| 1333 | Ga0501073_0066239 | |||
| 1334 | Ga0501073_0187747 | |||
| 1335 | Ga0501073_0246221 | |||
| 1336 | Ga0501074_0010076 | |||
| 1337 | Ga0501079_0002251 | |||
| 1338 | Ga0501080_0000748 | |||
| 1339 | Ga0501080_0025188 | |||
| 1340 | Ga0501080_0107922 | |||
| 1341 | Ga0501080_0118789 | |||
| 1342 | Ga0501080_0253297 | |||
| 1343 | Ga0501080_0295341 | |||
| 1344 | Ga0501083_0030847 | |||
| 1345 | Ga0501083_0044781 | |||
| 1346 | Ga0501035_0017113 | |||
| 1347 | Ga0501035_0018463 | |||
| 1348 | Ga0501035_0118020 | |||
| 1349 | Ga0501035_0156589 | |||
| 1350 | Ga0501035_0165350 | |||
| 1351 | Ga0501035_0178421 | |||
| 1352 | Ga0501035_0183071 | |||
| 1353 | Ga0501044_0004024 | |||
| 1354 | Ga0501044_0005225 | |||
| 1355 | Ga0501044_0007695 | |||
| 1356 | Ga0501044_0013403 | |||
| 1357 | Ga0501044_0017089 | |||
| 1358 | Ga0501044_0024916 | |||
| 1359 | Ga0501044_0034581 | |||
| 1360 | Ga0501044_0063978 | |||
| 1361 | Ga0501044_0177572 | |||
| 1362 | Ga0501044_0362358 | |||
| 1363 | Ga0501044_0469118 | |||
| 1364 | Ga0500635_0000045 | |||
| 1365 | Ga0500643_001557 | |||
| 1366 | Ga0500643_056137 | |||
| 1367 | Ga0500647_0012997 | |||
| 1368 | Ga0500651_0041537 | |||
| 1369 | Ga0500566_0065888 | |||
| 1370 | Ga0500555_057557 | |||
| 1371 | Ga0500556_0000558 | |||
| 1372 | Ga0500562_000146 | |||
| 1373 | Ga0500562_002766 | |||
| 1374 | Ga0500569_003672 | |||
| 1375 | Ga0500595_000109 | |||
| 1376 | Ga0500595_005023 | |||
| 1377 | Ga0500595_025427 | |||
| 1378 | Ga0500595_042868 | |||
| 1379 | Ga0500608_007195 | |||
| 1380 | Ga0500608_138252 | |||
| 1381 | Ga0500614_000738 | |||
| 1382 | Ga0500614_002916 | |||
| 1383 | Ga0500618_000319 | |||
| 1384 | Ga0500642_0048951 | |||
| 1385 | Ga0500559_0000010 | |||
| 1386 | Ga0500559_0000280 | |||
| 1387 | Ga0500559_0002775 | |||
| 1388 | Ga0500559_0022050 | |||
| 1389 | Ga0500573_0000060 | |||
| 1390 | Ga0500577_0056064 | |||
| 1391 | Ga0500590_019652 | |||
| 1392 | Ga0500603_017944 | |||
| 1393 | Ga0500619_043785 | |||
| 1394 | Ga0500624_006347 | |||
| 1395 | Ga0500638_024821 | |||
| 1396 | Ga0500636_0015065 | |||
| 1397 | Ga0500637_0026874 | |||
| 1398 | Ga0500596_001528 | |||
| 1399 | Ga0501084_0001533 | |||
| 1400 | Ga0501084_0317101 | |||
| 1401 | Ga0587106_001307 | |||
| 1402 | Ga0587115_001276 | |||
| 1403 | Ga0587111_0006226 | |||
| 1404 | Ga0501082_0007247 | |||
| 1405 | Ga0501082_0087600 | |||
| 1406 | Ga0501082_0095496 | |||
| 1407 | 2511121725 | |||
| 1408 | 2585148988 | |||
| 1409 | 2585151606 | |||
| 1410 | 2585195520 | |||
| 1411 | 2643922933 | |||
| 1412 | 2644086731 | |||
| 1413 | 2644341685 | |||
| 1414 | 2644367972 | |||
| 1415 | 2819536336 | |||
| 1416 | 2819644591 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4d6u-assembly1.cif.gz_D | cytochrome bc1 bound to the 4(1h)-pyridone gsk932121 | 0.9546 | 27 | 262 |
| 3h1k-assembly1.cif.gz_Q | chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound | 0.9535 | 27 | 264 |
| 1bcc-assembly1.cif.gz_D | cytochrome bc1 complex from chicken | 0.9527 | 25 | 264 |
| 7o3c-assembly1.cif.gz_D | murine supercomplex ciii2civ in the mature unlocked conformation | 0.9522 | 25 | 264 |
| 5xte-assembly1.cif.gz_H | cryo-em structure of human respiratory complex iii (cytochrome bc1 complex) | 0.9491 | 26 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sqqD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9383 | 27 | 230 | 1.10.760.10 |
| 1sqqD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9201 | 27 | 230 | 1.10.760.10 |
| 2yiuE01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9151 | 32 | 230 | 1.10.760.10 |
| 2yiuE01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.91 | 32 | 230 | 1.10.760.10 |
| af_Q4DU59_5_209_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8617 | 27 | 229 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6V7IE91-F1-model_v4 | Cytochrome c domain-containing protein | 0.9731 | 159 | 240 |
GO:0005739
GO:0006122 GO:0009055 GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A820M0P0-F1-model_v4 | Uncharacterized protein | 0.9651 | 153 | 223 |
GO:0005739
GO:0006122 GO:0009055 GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A851DGH8-F1-model_v4 | Cytochrome c | 0.9631 | 49 | 229 |
GO:0005739
GO:0006122 GO:0009055 GO:0016020 GO:0020037 GO:0046872 |
| AF-D0VX26-F1-model_v4 | Cytochrome c | 0.9625 | 27 | 263 |
GO:0005743
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A147B8G1-F1-model_v4 | Mitochondrial cytochrome c1 | 0.9595 | 63 | 242 |
GO:0005739
GO:0006122 GO:0009055 GO:0016020 GO:0020037 GO:0046872 |