F476604

General Info

Members Datasets Scaffolds Average Seq Length
708 300 1416 274

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0013659|Ga0395900_0013659_5778_6770
Length 330
Sequence VDSIPVSWLCATGEGAGNDIPLSNEIHEAHRCPIGANLGGGVEEGVSLNMLRKAFAVATLGLAFLAGPALSATTREEPRNIHWSFEGPLGKFDQAQLQRGYKMYREVCSACHPMSLLSFRNLGQKGGPFYDPKYPNPNDNPYVKSLAKDIQVGDIDSETGDAIKRPATSADRFPSPFPNEAAARASNGGALPPDLSVIAKAREGGPAYIYSLLTGYHAAPAGLTVTPGKYYNPFFPGDLASFWSGAKDKVPKGGVIAMPPPLAPNKVTFDDGTKSTVENQARDVAAFLMWAAEPKMEERKQFGLGAMIYLALFTGLLYASYRRIWRDVAH

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
272 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
279 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
280 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
281 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
282 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
292 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
293 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
294 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
295 2643221583 Caulobacter sp. Root655 Isolate Unclassified
296 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
297 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
298 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
299 2818991435 Caulobacter henricii 536 Isolate Unclassified
300 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0.56
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 0.14
Rhizoplane 1.69
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0013659 3300037418 Bacteria 8292
2 JGI25165J46597_1000246 3300003214 Bacteria 73461
3 rootH2_10076543 3300003320 Bacteria 2034
4 rootH2_10091432 3300003320 Bacteria 1663
5 rootH2_10215532 3300003320 Bacteria 1159
6 rootH1_10147226 3300003323 Bacteria 1079
7 Ga0055530_10002084 3300003791 Bacteria 13381
8 Ga0055531_10018190 3300003794 Bacteria 2916
9 Ga0055531_10024884 3300003794 Bacteria 2193
10 Ga0065165_1001609 3300005262 Bacteria 23073
11 Ga0065165_1033482 3300005262 Bacteria 1599
12 Ga0070658_10031693 3300005327 Bacteria 4247
13 Ga0070658_10053126 3300005327 Bacteria 3288
14 Ga0070658_10092982 3300005327 Bacteria 2487
15 Ga0070658_10158845 3300005327 Bacteria 1896
16 Ga0070658_10615499 3300005327 Bacteria 941
17 Ga0070676_10020754 3300005328 Bacteria 3672
18 Ga0070676_10058323 3300005328 Bacteria 2287
19 Ga0070683_100033946 3300005329 Bacteria 4656
20 Ga0070683_100431826 3300005329 Bacteria 1257
21 Ga0070690_100189341 3300005330 Bacteria 1426
22 Ga0070670_100000032 3300005331 Bacteria 158514
23 Ga0070670_100381439 3300005331 Bacteria 1242
24 Ga0068869_100115684 3300005334 Bacteria 2045
25 Ga0070666_10000876 3300005335 Bacteria 18244
26 Ga0070666_10045197 3300005335 Bacteria 2952
27 Ga0070680_100000023 3300005336 Bacteria 78765
28 Ga0070680_100008042 3300005336 Bacteria 8055
29 Ga0070680_100028667 3300005336 Bacteria 4467
30 Ga0070680_100083497 3300005336 Bacteria 2638
31 Ga0070680_100447786 3300005336 Bacteria 1103
32 Ga0068868_100051414 3300005338 Bacteria 3241
33 Ga0068868_100153216 3300005338 Bacteria 1899
34 Ga0070660_100016351 3300005339 Bacteria 5384
35 Ga0070691_10007450 3300005341 Bacteria 5016
36 Ga0070661_100041966 3300005344 Bacteria 3338
37 Ga0070661_100115097 3300005344 Bacteria 2011
38 Ga0070661_100293516 3300005344 Bacteria 1264
39 Ga0070661_100434325 3300005344 Bacteria 1043
40 Ga0070668_100006777 3300005347 Bacteria 8492
41 Ga0070668_100042587 3300005347 Bacteria 3480
42 Ga0070668_100197444 3300005347 Bacteria 1651
43 Ga0070671_100016016 3300005355 Bacteria 6057
44 Ga0070671_100062735 3300005355 Bacteria 3094
45 Ga0070671_100072799 3300005355 Bacteria 2870
46 Ga0070671_100240560 3300005355 Bacteria 1536
47 Ga0070673_100086794 3300005364 Bacteria 2550
48 Ga0070673_100315123 3300005364 Bacteria 1381
49 Ga0070659_100000638 3300005366 Bacteria 25690
50 Ga0070659_100002173 3300005366 Bacteria 13970
51 Ga0070659_100122823 3300005366 Bacteria 2105
52 Ga0070659_100315024 3300005366 Bacteria 1307
53 Ga0070667_100000110 3300005367 Bacteria 105201
54 Ga0070667_100039898 3300005367 Bacteria 3936
55 Ga0070667_100070166 3300005367 Bacteria 2982
56 Ga0070667_100263475 3300005367 Bacteria 1544
57 Ga0070714_100851993 3300005435 Bacteria 884
58 Ga0070710_10150255 3300005437 Bacteria 1436
59 Ga0070711_100044271 3300005439 Bacteria 3020
60 Ga0070678_100080752 3300005456 Bacteria 2463
61 Ga0070678_100447518 3300005456 Bacteria 1131
62 Ga0070662_100156567 3300005457 Bacteria 1779
63 Ga0070681_10000002 3300005458 Bacteria 821814
64 Ga0070681_10020584 3300005458 Bacteria 6611
65 Ga0070681_10054201 3300005458 Bacteria 3995
66 Ga0070681_10087050 3300005458 Bacteria 3077
67 Ga0068867_100010512 3300005459 Bacteria 6531
68 Ga0070685_10154056 3300005466 Bacteria 1459
69 Ga0070679_100000714 3300005530 Bacteria 28591
70 Ga0070679_100024422 3300005530 Bacteria 5922
71 Ga0070679_100130619 3300005530 Bacteria 2493
72 Ga0070679_100138407 3300005530 Bacteria 2415
73 Ga0070684_100025106 3300005535 Bacteria 5005
74 Ga0070684_100217300 3300005535 Bacteria 1743
75 Ga0068853_100076100 3300005539 Bacteria 2930
76 Ga0068853_100103458 3300005539 Bacteria 2520
77 Ga0068853_100118538 3300005539 Bacteria 2359
78 Ga0068853_100211549 3300005539 Bacteria 1768
79 Ga0068853_100225246 3300005539 Bacteria 1714
80 Ga0068853_100338462 3300005539 Bacteria 1398
81 Ga0070693_100112240 3300005547 Bacteria 1679
82 Ga0070693_100138614 3300005547 Bacteria 1529
83 Ga0070665_100000433 3300005548 Bacteria 60988
84 Ga0070665_100003422 3300005548 Bacteria 16956
85 Ga0070665_100006669 3300005548 Bacteria 11740
86 Ga0070665_100046328 3300005548 Bacteria 4368
87 Ga0070665_100054383 3300005548 Bacteria 4015
88 Ga0070665_100057028 3300005548 Bacteria 3916
89 Ga0070665_100188852 3300005548 Bacteria 2061
90 Ga0068855_100000301 3300005563 Bacteria 61661
91 Ga0068855_100027861 3300005563 Bacteria 6758
92 Ga0068855_100036970 3300005563 Bacteria 5809
93 Ga0068855_100196366 3300005563 Bacteria 2273
94 Ga0068855_100232531 3300005563 Bacteria 2063
95 Ga0068855_100240169 3300005563 Bacteria 2025
96 Ga0068855_100246001 3300005563 Bacteria 1996
97 Ga0068855_100535394 3300005563 Bacteria 1269
98 Ga0070664_100182755 3300005564 Bacteria 1865
99 Ga0068856_100194577 3300005614 Bacteria 2042
100 Ga0068856_100280345 3300005614 Bacteria 1683
101 Ga0068856_100440895 3300005614 Bacteria 1323
102 Ga0068856_100829929 3300005614 Bacteria 944
103 Ga0068852_100052440 3300005616 Bacteria 3506
104 Ga0068852_100058395 3300005616 Bacteria 3342
105 Ga0068852_100122392 3300005616 Bacteria 2385
106 Ga0068859_100191817 3300005617 Bacteria 2128
107 Ga0068859_100378215 3300005617 Bacteria 1512
108 Ga0068864_100000184 3300005618 Bacteria 57553
109 Ga0068864_100000321 3300005618 Bacteria 42230
110 Ga0068866_10065240 3300005718 Bacteria 1904
111 Ga0068861_100363900 3300005719 Bacteria 1273
112 Ga0068861_100552193 3300005719 Bacteria 1050
113 Ga0068863_100000037 3300005841 Bacteria 162638
114 Ga0068863_100001377 3300005841 Bacteria 24126
115 Ga0068858_100000029 3300005842 Bacteria 144691
116 Ga0068858_100006036 3300005842 Bacteria 11808
117 Ga0068858_100128417 3300005842 Bacteria 2376
118 Ga0068858_100129465 3300005842 Bacteria 2365
119 Ga0068860_100000100 3300005843 Bacteria 144580
120 Ga0068860_100000167 3300005843 Bacteria 108234
121 Ga0068860_100148872 3300005843 Bacteria 2253
122 Ga0068862_100008644 3300005844 Bacteria 8423
123 Ga0068862_100103621 3300005844 Bacteria 2492
124 Ga0068862_100717426 3300005844 Bacteria 970
125 Ga0075366_10148732 3300006195 Bacteria 1418
126 Ga0097621_100001198 3300006237 Bacteria 17958
127 Ga0097621_100075644 3300006237 Bacteria 2792
128 Ga0097621_100078408 3300006237 Bacteria 2744
129 Ga0097621_100124335 3300006237 Bacteria 2190
130 Ga0097621_100159729 3300006237 Bacteria 1937
131 Ga0068871_100001487 3300006358 Bacteria 15708
132 Ga0068871_100044818 3300006358 Bacteria 3558
133 Ga0068871_100095041 3300006358 Bacteria 2488
134 Ga0068871_100159533 3300006358 Bacteria 1928
135 Ga0068871_100217893 3300006358 Bacteria 1653
136 Ga0068871_100605204 3300006358 Bacteria 997
137 Ga0068865_100000664 3300006881 Bacteria 19413
138 Ga0068865_100030073 3300006881 Bacteria 3609
139 Ga0097620_100191818 3300006931 Bacteria 2128
140 Ga0097620_100378199 3300006931 Bacteria 1512
141 Ga0079104_1016322 3300006946 Bacteria 2175
142 Ga0105250_10006833 3300009092 Bacteria 4954
143 Ga0105240_10000564 3300009093 Bacteria 68685
144 Ga0105240_10000944 3300009093 Bacteria 51695
145 Ga0105240_10013845 3300009093 Bacteria 11045
146 Ga0105240_10119623 3300009093 Bacteria 3173
147 Ga0105240_10157507 3300009093 Bacteria 2700
148 Ga0105240_10189179 3300009093 Bacteria 2422
149 Ga0105240_10254003 3300009093 Bacteria 2031
150 Ga0105240_10349912 3300009093 Bacteria 1677
151 Ga0105240_10394542 3300009093 Bacteria 1560
152 Ga0105240_10527564 3300009093 Bacteria 1309
153 Ga0105240_10534774 3300009093 Bacteria 1299
154 Ga0105245_10046489 3300009098 Bacteria 3879
155 Ga0105245_10053099 3300009098 Bacteria 3637
156 Ga0105245_10109674 3300009098 Bacteria 2565
157 Ga0105245_10225300 3300009098 Bacteria 1811
158 Ga0105247_10051693 3300009101 Bacteria 2532
159 Ga0105247_10120373 3300009101 Bacteria 1700
160 Ga0105243_10008311 3300009148 Bacteria 7972
161 Ga0105241_10050241 3300009174 Bacteria 3177
162 Ga0105241_10106864 3300009174 Bacteria 2234
163 Ga0105241_10125529 3300009174 Bacteria 2072
164 Ga0105242_10043224 3300009176 Bacteria 3644
165 Ga0105242_10104462 3300009176 Bacteria 2405
166 Ga0105242_10696980 3300009176 Bacteria 993
167 Ga0105242_10806888 3300009176 Bacteria 929
168 Ga0105248_10000280 3300009177 Bacteria 60247
169 Ga0105248_10022042 3300009177 Bacteria 7059
170 Ga0105248_10022642 3300009177 Bacteria 6973
171 Ga0105248_10024868 3300009177 Bacteria 6656
172 Ga0105248_10099751 3300009177 Bacteria 3272
173 Ga0105248_10740840 3300009177 Bacteria 1109
174 Ga0105237_10108918 3300009545 Bacteria 2761
175 Ga0105237_10144627 3300009545 Bacteria 2372
176 Ga0105237_10153769 3300009545 Bacteria 2297
177 Ga0105237_10387513 3300009545 Bacteria 1402
178 Ga0105238_10005585 3300009551 Bacteria 12425
179 Ga0105238_10007619 3300009551 Bacteria 10846
180 Ga0105238_10024527 3300009551 Bacteria 6147
181 Ga0105238_10069310 3300009551 Bacteria 3527
182 Ga0105238_10078904 3300009551 Bacteria 3282
183 Ga0105238_10164055 3300009551 Bacteria 2197
184 Ga0105238_10236576 3300009551 Bacteria 1804
185 Ga0105238_10374770 3300009551 Bacteria 1414
186 Ga0105238_10399171 3300009551 Bacteria 1368
187 Ga0105238_10528973 3300009551 Bacteria 1182
188 Ga0105238_10782230 3300009551 Bacteria 969
189 Ga0105249_10010828 3300009553 Bacteria 8014
190 Ga0105249_10073283 3300009553 Bacteria 3168
191 Ga0105249_10094935 3300009553 Bacteria 2796
192 Ga0105249_10261115 3300009553 Bacteria 1721
193 Ga0105249_10270726 3300009553 Bacteria 1692
194 Ga0105249_10767843 3300009553 Bacteria 1027
195 Ga0105239_10003451 3300010375 Bacteria 19346
196 Ga0105239_10052496 3300010375 Bacteria 4471
197 Ga0105239_10082819 3300010375 Bacteria 3533
198 Ga0105239_10102209 3300010375 Bacteria 3172
199 Ga0105239_10124257 3300010375 Bacteria 2867
200 Ga0105239_10326146 3300010375 Bacteria 1732
201 Ga0105239_10503921 3300010375 Bacteria 1376
202 Ga0105246_10261917 3300011119 Bacteria 1378
203 Ga0157373_10001320 3300013100 Bacteria 18973
204 Ga0157373_10012399 3300013100 Bacteria 6268
205 Ga0157373_10066755 3300013100 Bacteria 2544
206 Ga0157370_10037032 3300013104 Bacteria 4732
207 Ga0157370_10063705 3300013104 Bacteria 3492
208 Ga0157370_10214089 3300013104 Bacteria 1785
209 Ga0157370_10390438 3300013104 Bacteria 1281
210 Ga0157370_10733469 3300013104 Bacteria 901
211 Ga0157369_10033563 3300013105 Bacteria 5639
212 Ga0157369_10043173 3300013105 Bacteria 4915
213 Ga0157369_10129964 3300013105 Bacteria 2670
214 Ga0157369_10356992 3300013105 Bacteria 1518
215 Ga0157369_10414959 3300013105 Bacteria 1396
216 Ga0157374_10349054 3300013296 Bacteria 1470
217 Ga0157378_10093553 3300013297 Bacteria 2737
218 Ga0157378_10122253 3300013297 Bacteria 2401
219 Ga0157378_10504369 3300013297 Bacteria 1209
220 Ga0163162_10498463 3300013306 Bacteria 1348
221 Ga0157372_10137960 3300013307 Bacteria 2809
222 Ga0157372_10240479 3300013307 Bacteria 2101
223 Ga0157372_10294097 3300013307 Bacteria 1889
224 Ga0157375_10082401 3300013308 Bacteria 3259
225 Ga0157375_11204393 3300013308 Bacteria 888
226 Ga0163163_10000004 3300014325 Bacteria 416569
227 Ga0163163_10105669 3300014325 Bacteria 2841
228 Ga0163163_10123295 3300014325 Bacteria 2627
229 Ga0163163_10170425 3300014325 Bacteria 2223
230 Ga0163163_10224747 3300014325 Bacteria 1926
231 Ga0163163_10320712 3300014325 Bacteria 1603
232 Ga0157379_10005280 3300014968 Bacteria 11093
233 Ga0157379_10016863 3300014968 Bacteria 6429
234 Ga0157379_10023062 3300014968 Bacteria 5518
235 Ga0157376_10452485 3300014969 Bacteria 1253
236 Ga0157376_10490741 3300014969 Bacteria 1205
237 Ga0163161_10027011 3300017792 Bacteria 4071
238 Ga0207427_103528 3300025231 Bacteria 3218
239 Ga0209026_1000851 3300025250 Bacteria 16010
240 Ga0209233_1000006 3300025261 Bacteria 1473685
241 Ga0209564_1006954 3300025295 Bacteria 5943
242 Ga0209758_1000008 3300025297 Bacteria 1215263
243 Ga0209758_1000331 3300025297 Bacteria 88922
244 Ga0209758_1065746 3300025297 Bacteria 1168
245 Ga0209050_1000130 3300025298 Bacteria 186070
246 Ga0209257_1000059 3300025304 Bacteria 378097
247 Ga0209257_1000246 3300025304 Bacteria 125942
248 Ga0209257_1001754 3300025304 Bacteria 24058
249 Ga0207696_1040002 3300025711 Bacteria 1375
250 Ga0207710_10141812 3300025900 Bacteria 1160
251 Ga0207688_10072794 3300025901 Bacteria 1953
252 Ga0207680_10001291 3300025903 Bacteria 11864
253 Ga0207680_10156008 3300025903 Bacteria 1526
254 Ga0207680_10164460 3300025903 Bacteria 1490
255 Ga0207647_10137483 3300025904 Bacteria 1433
256 Ga0207705_10000970 3300025909 Bacteria 23483
257 Ga0207705_10034055 3300025909 Bacteria 3641
258 Ga0207705_10232506 3300025909 Bacteria 1403
259 Ga0207705_10442734 3300025909 Bacteria 1007
260 Ga0207654_10093549 3300025911 Bacteria 1838
261 Ga0207654_10233109 3300025911 Bacteria 1227
262 Ga0207707_10000002 3300025912 Bacteria 1142054
263 Ga0207707_10037873 3300025912 Bacteria 4213
264 Ga0207695_10000003 3300025913 Bacteria 1368691
265 Ga0207695_10004245 3300025913 Bacteria 19683
266 Ga0207695_10010734 3300025913 Bacteria 11177
267 Ga0207695_10011375 3300025913 Bacteria 10785
268 Ga0207695_10069921 3300025913 Bacteria 3591
269 Ga0207695_10092691 3300025913 Bacteria 3031
270 Ga0207695_10132018 3300025913 Bacteria 2454
271 Ga0207695_10205673 3300025913 Bacteria 1881
272 Ga0207695_10303416 3300025913 Bacteria 1488
273 Ga0207695_10321870 3300025913 Bacteria 1436
274 Ga0207695_10387917 3300025913 Bacteria 1282
275 Ga0207695_10441565 3300025913 Bacteria 1185
276 Ga0207671_10230063 3300025914 Bacteria 1454
277 Ga0207660_10003432 3300025917 Bacteria 10338
278 Ga0207660_10015133 3300025917 Bacteria 5087
279 Ga0207660_10374695 3300025917 Bacteria 1143
280 Ga0207649_10099121 3300025920 Bacteria 1924
281 Ga0207649_10191177 3300025920 Bacteria 1440
282 Ga0207649_10304239 3300025920 Bacteria 1167
283 Ga0207652_10000641 3300025921 Bacteria 34615
284 Ga0207652_10004285 3300025921 Bacteria 11637
285 Ga0207652_10176631 3300025921 Bacteria 1918
286 Ga0207652_10197875 3300025921 Bacteria 1808
287 Ga0207694_10000016 3300025924 Bacteria 349087
288 Ga0207694_10020349 3300025924 Bacteria 5019
289 Ga0207694_10059819 3300025924 Bacteria 2964
290 Ga0207694_10208300 3300025924 Bacteria 1592
291 Ga0207694_10251364 3300025924 Bacteria 1447
292 Ga0207694_10252963 3300025924 Bacteria 1442
293 Ga0207694_10261294 3300025924 Bacteria 1418
294 Ga0207694_10444388 3300025924 Bacteria 1082
295 Ga0207650_10000074 3300025925 Bacteria 134837
296 Ga0207650_10152295 3300025925 Bacteria 1826
297 Ga0207650_10349449 3300025925 Bacteria 1216
298 Ga0207659_10008634 3300025926 Bacteria 6338
299 Ga0207687_10072593 3300025927 Bacteria 2462
300 Ga0207687_10075128 3300025927 Bacteria 2424
301 Ga0207687_10143736 3300025927 Bacteria 1813
302 Ga0207687_10338732 3300025927 Bacteria 1222
303 Ga0207644_10012414 3300025931 Bacteria 5658
304 Ga0207644_10119076 3300025931 Bacteria 2007
305 Ga0207644_10180958 3300025931 Bacteria 1652
306 Ga0207644_10407319 3300025931 Bacteria 1112
307 Ga0207690_10000159 3300025932 Bacteria 52852
308 Ga0207690_10006522 3300025932 Bacteria 6918
309 Ga0207690_10060485 3300025932 Bacteria 2571
310 Ga0207690_10574778 3300025932 Bacteria 918
311 Ga0207706_10049653 3300025933 Bacteria 3707
312 Ga0207706_10492146 3300025933 Bacteria 1059
313 Ga0207686_10044035 3300025934 Bacteria 2738
314 Ga0207686_10070243 3300025934 Bacteria 2249
315 Ga0207709_10012017 3300025935 Bacteria 4774
316 Ga0207669_10011030 3300025937 Bacteria 4378
317 Ga0207704_10001590 3300025938 Bacteria 10203
318 Ga0207704_10008398 3300025938 Bacteria 4937
319 Ga0207691_10356149 3300025940 Bacteria 1252
320 Ga0207711_10007049 3300025941 Bacteria 9418
321 Ga0207711_10022124 3300025941 Bacteria 5315
322 Ga0207711_10037615 3300025941 Bacteria 4112
323 Ga0207711_10365278 3300025941 Bacteria 1338
324 Ga0207689_10050504 3300025942 Bacteria 3429
325 Ga0207679_10011413 3300025945 Bacteria 5754
326 Ga0207679_10133980 3300025945 Bacteria 1992
327 Ga0207667_10000021 3300025949 Bacteria 370524
328 Ga0207667_10046655 3300025949 Bacteria 4588
329 Ga0207667_10049413 3300025949 Bacteria 4441
330 Ga0207667_10107498 3300025949 Bacteria 2878
331 Ga0207667_10125211 3300025949 Bacteria 2646
332 Ga0207667_10127520 3300025949 Bacteria 2621
333 Ga0207667_10202470 3300025949 Bacteria 2036
334 Ga0207667_10221876 3300025949 Bacteria 1937
335 Ga0207712_10006330 3300025961 Bacteria 7468
336 Ga0207712_10049994 3300025961 Bacteria 2917
337 Ga0207712_10064732 3300025961 Bacteria 2608
338 Ga0207668_10000001 3300025972 Bacteria 266091
339 Ga0207668_10000246 3300025972 Bacteria 36387
340 Ga0207640_10096969 3300025981 Bacteria 2057
341 Ga0207658_10000275 3300025986 Bacteria 53906
342 Ga0207658_10026953 3300025986 Bacteria 4033
343 Ga0207658_10031695 3300025986 Bacteria 3756
344 Ga0207658_10289521 3300025986 Bacteria 1407
345 Ga0207677_10032925 3300026023 Bacteria 3337
346 Ga0207703_10001093 3300026035 Bacteria 25768
347 Ga0207703_10054178 3300026035 Bacteria 3261
348 Ga0207703_10086103 3300026035 Bacteria 2631
349 Ga0207703_10360642 3300026035 Bacteria 1340
350 Ga0207639_10014523 3300026041 Bacteria 5542
351 Ga0207639_10043000 3300026041 Bacteria 3389
352 Ga0207639_10061463 3300026041 Bacteria 2901
353 Ga0207639_10094891 3300026041 Bacteria 2396
354 Ga0207639_10166908 3300026041 Bacteria 1860
355 Ga0207639_10211323 3300026041 Bacteria 1670
356 Ga0207639_10245397 3300026041 Bacteria 1559
357 Ga0207639_10320795 3300026041 Bacteria 1375
358 Ga0207639_10609170 3300026041 Bacteria 1008
359 Ga0207708_10068878 3300026075 Bacteria 2709
360 Ga0207702_10095020 3300026078 Bacteria 2618
361 Ga0207702_10316832 3300026078 Bacteria 1484
362 Ga0207702_10572709 3300026078 Bacteria 1106
363 Ga0207702_10923761 3300026078 Bacteria 865
364 Ga0207641_10000034 3300026088 Bacteria 217752
365 Ga0207641_10001917 3300026088 Bacteria 19953
366 Ga0207648_10016983 3300026089 Bacteria 6632
367 Ga0207648_10047240 3300026089 Bacteria 3774
368 Ga0207676_10000202 3300026095 Bacteria 51825
369 Ga0207676_10001101 3300026095 Bacteria 20425
370 Ga0207676_10004781 3300026095 Bacteria 9608
371 Ga0207674_10052452 3300026116 Bacteria 4159
372 Ga0207674_10164284 3300026116 Bacteria 2174
373 Ga0207674_10286716 3300026116 Bacteria 1595
374 Ga0207674_10418990 3300026116 Bacteria 1294
375 Ga0207675_100444220 3300026118 Bacteria 1284
376 Ga0207698_10034015 3300026142 Bacteria 3710
377 Ga0207698_10064132 3300026142 Bacteria 2878
378 Ga0209981_1003305 3300027378 Bacteria 2089
379 Ga0209999_1005248 3300027543 Bacteria 2329
380 Ga0268266_10000003 3300028379 Bacteria 1701703
381 Ga0268266_10000289 3300028379 Bacteria 82515
382 Ga0268266_10000746 3300028379 Bacteria 43523
383 Ga0268266_10012231 3300028379 Bacteria 7427
384 Ga0268266_10022231 3300028379 Bacteria 5404
385 Ga0268266_10038206 3300028379 Bacteria 4088
386 Ga0268266_10048721 3300028379 Bacteria 3632
387 Ga0268266_10090410 3300028379 Bacteria 2683
388 Ga0268266_10101306 3300028379 Bacteria 2538
389 Ga0268265_10000648 3300028380 Bacteria 34549
390 Ga0268265_10276562 3300028380 Bacteria 1500
391 Ga0268265_10560268 3300028380 Bacteria 1086
392 Ga0268264_10000002 3300028381 Bacteria 1153045
393 Ga0268264_10000068 3300028381 Bacteria 275708
394 Ga0268264_10459255 3300028381 Bacteria 1235
395 Ga0265318_10001360 3300028577 Bacteria 14524
396 Ga0307517_10002267 3300028786 Bacteria 31005
397 Ga0307517_10033152 3300028786 Bacteria 5946
398 Ga0307517_10074807 3300028786 Bacteria 2981
399 Ga0307517_10199204 3300028786 Bacteria 1255
400 Ga0307515_10012598 3300028794 Bacteria 15891
401 Ga0265338_10007293 3300028800 Bacteria 13796
402 Ga0307511_10030594 3300030521 Bacteria 4833
403 Ga0265760_10021543 3300031090 Bacteria 1866
404 Ga0265332_10011546 3300031238 Bacteria 3924
405 Ga0265325_10004954 3300031241 Bacteria 8299
406 Ga0265325_10050543 3300031241 Bacteria 2140
407 Ga0265340_10036654 3300031247 Bacteria 2430
408 Ga0265340_10050883 3300031247 Bacteria 2008
409 Ga0265339_10009253 3300031249 Bacteria 6209
410 Ga0265339_10047970 3300031249 Bacteria 2344
411 Ga0265339_10048746 3300031249 Bacteria 2322
412 Ga0265339_10090711 3300031249 Bacteria 1602
413 Ga0265331_10000080 3300031250 Bacteria 137743
414 Ga0265331_10007961 3300031250 Bacteria 6068
415 Ga0265331_10039691 3300031250 Bacteria 2294
416 Ga0265331_10045360 3300031250 Bacteria 2122
417 Ga0265327_10003877 3300031251 Bacteria 13777
418 Ga0265327_10008511 3300031251 Bacteria 7626
419 Ga0265327_10163968 3300031251 Bacteria 1025
420 Ga0265316_10075979 3300031344 Bacteria 2582
421 Ga0265316_10094004 3300031344 Bacteria 2284
422 Ga0307513_10000045 3300031456 Bacteria 158626
423 Ga0307513_10000790 3300031456 Bacteria 45976
424 Ga0307513_10004139 3300031456 Bacteria 19425
425 Ga0307513_10478974 3300031456 Bacteria 965
426 Ga0265313_10041225 3300031595 Bacteria 2276
427 Ga0265313_10042413 3300031595 Bacteria 2235
428 Ga0265313_10079895 3300031595 Bacteria 1487
429 Ga0265314_10007720 3300031711 Bacteria 9300
430 Ga0265314_10024020 3300031711 Bacteria 4631
431 Ga0265314_10043804 3300031711 Bacteria 3178
432 Ga0265314_10051744 3300031711 Bacteria 2860
433 Ga0265314_10066847 3300031711 Bacteria 2423
434 Ga0265314_10086198 3300031711 Bacteria 2057
435 Ga0265342_10029142 3300031712 Bacteria 3431
436 Ga0265342_10113010 3300031712 Bacteria 1535
437 Ga0307516_10078605 3300031730 Bacteria 3145
438 Ga0307516_10200559 3300031730 Bacteria 1715
439 Ga0307413_10272838 3300031824 Bacteria 1267
440 Ga0307510_10045879 3300033180 Bacteria 4708
441 Ga0307510_10160178 3300033180 Bacteria 1849
442 Ga0307510_10162304 3300033180 Bacteria 1829
443 Ga0373936_0002176 3300035113 Bacteria 7306
444 Ga0373936_0039837 3300035113 Bacteria 1881
445 Ga0373939_0068037 3300035114 Bacteria 1152
446 Ga0373942_0020166 3300035207 Bacteria 1672
447 Ga0373935_0174503 3300035692 Bacteria 1472
448 Ga0373927_0000479 3300035695 Bacteria 30749
449 Ga0373937_0504155 3300036401 Bacteria 1150
450 Ga0373937_0639173 3300036401 Bacteria 1009
451 Ga0373925_0005838 3300037068 Bacteria 9133
452 Ga0395899_0000373 3300037312 Bacteria 53717
453 Ga0395899_0021296 3300037312 Bacteria 4918
454 Ga0395899_0117039 3300037312 Bacteria 1912
455 Ga0395900_0000052 3300037418 Bacteria 223910
456 Ga0395900_0044791 3300037418 Bacteria 4558
457 Ga0395900_0268240 3300037418 Bacteria 1702
458 Ga0395900_0376441 3300037418 Bacteria 1389
459 Ga0395898_0003873 3300037466 Bacteria 16525
460 Ga0395898_0040701 3300037466 Bacteria 4593
461 Ga0395898_0287493 3300037466 Bacteria 1568
462 Ga0395905_0073275 3300037471 Bacteria 3210
463 Ga0395905_0223961 3300037471 Bacteria 1760
464 Ga0395901_0000001 3300038443 Bacteria 800383
465 Ga0395901_0132307 3300038443 Bacteria 2621
466 Ga0400483_099121 3300039062 Unclassified 3954
467 Ga0400483_273186 3300039062 Bacteria 1714
468 Ga0436365_0608786 3300039437 Bacteria 20013
469 Ga0436365_0822178 3300039437 Bacteria 2452
470 Ga0436365_1687427 3300039437 Bacteria 16468
471 Ga0439446_0012843 3300042156 Bacteria 2291
472 Ga0466966_0205851 3300044684 Bacteria 1190
473 Ga0466961_0298343 3300044693 Bacteria 985
474 Ga0466964_0066934 3300044706 Bacteria 1509
475 Ga0466957_0244773 3300044842 Bacteria 1191
476 Ga0466957_0370449 3300044842 Bacteria 975
477 Ga0466967_0115764 3300045976 Bacteria 2469
478 Ga0495627_008977 3300046453 Bacteria 3697
479 Ga0495629_0026670 3300046459 Bacteria 4104
480 Ga0495638_0000588 3300046460 Bacteria 41034
481 Ga0495638_0009677 3300046460 Bacteria 6739
482 Ga0495650_0038545 3300046471 Bacteria 2070
483 Ga0495664_0065179 3300046477 Bacteria 2171
484 Ga0495584_0113063 3300046491 Bacteria 1374
485 Ga0495585_0051526 3300046492 Bacteria 2281
486 Ga0495607_0010068 3300046501 Bacteria 6367
487 Ga0495583_0000013 3300046506 Bacteria 323372
488 Ga0495583_0124545 3300046506 Bacteria 1082
489 Ga0495606_0060947 3300046507 Bacteria 2415
490 Ga0495608_0232412 3300046511 Bacteria 1154
491 Ga0495610_0070618 3300046512 Bacteria 1630
492 Ga0495616_0000053 3300046513 Bacteria 104389
493 Ga0495618_0385616 3300046514 Bacteria 859
494 Ga0495628_0199012 3300046516 Bacteria 1510
495 Ga0495632_0016614 3300046519 Bacteria 4087
496 Ga0495637_0033144 3300046520 Bacteria 2271
497 Ga0495643_0023418 3300046522 Bacteria 3511
498 Ga0495648_0120483 3300046524 Bacteria 1411
499 Ga0495652_0060966 3300046529 Bacteria 3186
500 Ga0495652_0149310 3300046529 Bacteria 1828
501 Ga0495609_0008702 3300046538 Bacteria 4951
502 Ga0495609_0012485 3300046538 Bacteria 4030
503 Ga0495609_0059539 3300046538 Bacteria 1689
504 Ga0495645_0043892 3300046543 Bacteria 3261
505 Ga0495622_0005584 3300046557 Bacteria 5832
506 Ga0495656_0102852 3300046615 Bacteria 1324
507 Ga0495668_0020755 3300046616 Bacteria 3775
508 Ga0495668_0220258 3300046616 Bacteria 1039
509 Ga0495625_0000290 3300046660 Bacteria 77650
510 Ga0495625_0010575 3300046660 Bacteria 7620
511 Ga0495659_0130996 3300046664 Bacteria 994
512 Ga0495661_0122720 3300046665 Bacteria 1433
513 Ga0495669_0000012 3300046684 Bacteria 157373
514 Ga0495669_0000329 3300046684 Bacteria 25520
515 Ga0495669_0006242 3300046684 Bacteria 4974
516 Ga0495669_0010908 3300046684 Bacteria 3846
517 Ga0495669_0083777 3300046684 Bacteria 1466
518 Ga0495613_0001323 3300046689 Bacteria 18949
519 Ga0495670_0083012 3300046691 Bacteria 1634
520 Ga0495589_0017961 3300046794 Bacteria 3628
521 Ga0495589_0027872 3300046794 Bacteria 2855
522 Ga0495660_0051302 3300046810 Bacteria 2245
523 Ga0495581_0089676 3300047315 Bacteria 1783
524 Ga0495636_0010312 3300047318 Bacteria 3688
525 Ga0495674_0087567 3300047319 Bacteria 2665
526 Ga0495672_0020752 3300047320 Bacteria 4299
527 Ga0495683_0099212 3300047323 Bacteria 1402
528 Ga0495683_0171908 3300047323 Bacteria 995
529 Ga0495675_0026630 3300047444 Bacteria 3688
530 Ga0495677_0049925 3300047445 Bacteria 1539
531 Ga0495679_009102 3300047446 Bacteria 3999
532 Ga0495673_0000025 3300047469 Bacteria 512352
533 Ga0495686_0004501 3300047472 Bacteria 11443
534 Ga0495686_0006929 3300047472 Bacteria 8570
535 Ga0495593_0024764 3300047673 Bacteria 3323
536 Ga0495602_0061766 3300048088 Bacteria 3255
537 Ga0496100_0252034 3300048903 Bacteria 1306
538 Ga0496102_0109303 3300048905 Bacteria 2576
539 Ga0496103_0085277 3300048906 Bacteria 1990
540 Ga0496103_0094179 3300048906 Bacteria 1892
541 Ga0496106_0107999 3300048909 Bacteria 2164
542 Ga0496107_0000329 3300048910 Bacteria 25658
543 Ga0496109_0007918 3300048912 Bacteria 9006
544 Ga0496112_0012967 3300048915 Bacteria 7681
545 Ga0496112_0038361 3300048915 Bacteria 4677
546 Ga0496112_0098500 3300048915 Bacteria 2893
547 Ga0496113_0257013 3300048916 Bacteria 1395
548 Ga0496115_0021383 3300048918 Bacteria 4998
549 Ga0496116_0100460 3300048919 Bacteria 1730
550 Ga0496117_0012409 3300048920 Bacteria 7515
551 Ga0496118_0005681 3300048921 Bacteria 14053
552 Ga0496119_0015319 3300048922 Bacteria 5914
553 Ga0496121_0000323 3300048924 Bacteria 100188
554 Ga0496121_0001066 3300048924 Bacteria 48544
555 Ga0496121_0001417 3300048924 Bacteria 40646
556 Ga0496126_0022200 3300048929 Bacteria 6180
557 Ga0495682_0001343 3300049460 Bacteria 13591
558 Ga0495682_0062588 3300049460 Bacteria 1343
559 Ga0501031_0000410 3300049568 Bacteria 24834
560 Ga0501032_0057586 3300049569 Bacteria 2611
561 Ga0501032_0082237 3300049569 Bacteria 2142
562 Ga0501032_0086002 3300049569 Bacteria 2090
563 Ga0501033_0015415 3300049570 Bacteria 5797
564 Ga0501033_0034540 3300049570 Bacteria 3792
565 Ga0501033_0066291 3300049570 Bacteria 2655
566 Ga0501033_0096994 3300049570 Bacteria 2154
567 Ga0501033_0149405 3300049570 Bacteria 1686
568 Ga0501033_0249566 3300049570 Bacteria 1258
569 Ga0501033_0354024 3300049570 Bacteria 1028
570 Ga0501034_0003773 3300049571 Bacteria 17105
571 Ga0501034_0028085 3300049571 Bacteria 5722
572 Ga0501034_0117073 3300049571 Bacteria 2652
573 Ga0501034_0147231 3300049571 Bacteria 2332
574 Ga0501036_0155901 3300049572 Bacteria 1926
575 Ga0501036_0203336 3300049572 Bacteria 1666
576 Ga0501036_0253542 3300049572 Bacteria 1474
577 Ga0501037_0006688 3300049573 Bacteria 8432
578 Ga0501037_0014739 3300049573 Bacteria 5749
579 Ga0501038_0008309 3300049574 Bacteria 9555
580 Ga0501038_0029932 3300049574 Bacteria 4820
581 Ga0501038_0099217 3300049574 Bacteria 2428
582 Ga0501038_0170045 3300049574 Bacteria 1765
583 Ga0501038_0209717 3300049574 Bacteria 1559
584 Ga0501039_0000235 3300049575 Bacteria 40369
585 Ga0501039_0283619 3300049575 Bacteria 1302
586 Ga0501042_0133852 3300049578 Bacteria 1787
587 Ga0501043_0005296 3300049579 Bacteria 10428
588 Ga0501043_0022404 3300049579 Bacteria 4955
589 Ga0501043_0073969 3300049579 Bacteria 2676
590 Ga0501043_0106634 3300049579 Bacteria 2201
591 Ga0501043_0109852 3300049579 Bacteria 2165
592 Ga0501043_0163059 3300049579 Bacteria 1741
593 Ga0501043_0213720 3300049579 Bacteria 1494
594 Ga0501046_0011825 3300049580 Bacteria 7451
595 Ga0501046_0046363 3300049580 Bacteria 3450
596 Ga0501046_0101159 3300049580 Bacteria 2211
597 Ga0501046_0147548 3300049580 Bacteria 1776
598 Ga0501047_0008942 3300049581 Bacteria 9457
599 Ga0501047_0014685 3300049581 Bacteria 7452
600 Ga0501047_0015297 3300049581 Bacteria 7309
601 Ga0501047_0038426 3300049581 Bacteria 4631
602 Ga0501047_0039375 3300049581 Bacteria 4572
603 Ga0501047_0116475 3300049581 Bacteria 2554
604 Ga0501047_0180847 3300049581 Bacteria 1975
605 Ga0501047_0204412 3300049581 Bacteria 1835
606 Ga0501047_0205926 3300049581 Bacteria 1826
607 Ga0501047_0229493 3300049581 Bacteria 1710
608 Ga0501047_0230844 3300049581 Bacteria 1704
609 Ga0501047_0256700 3300049581 Bacteria 1596
610 Ga0501047_0282870 3300049581 Bacteria 1503
611 Ga0501047_0292524 3300049581 Bacteria 1472
612 Ga0501047_0316856 3300049581 Bacteria 1400
613 Ga0501047_0534070 3300049581 Bacteria 998
614 Ga0501047_0575218 3300049581 Bacteria 950
615 Ga0501048_0029706 3300049582 Bacteria 3961
616 Ga0501067_0016841 3300049583 Bacteria 4037
617 Ga0501067_0079155 3300049583 Bacteria 1821
618 Ga0501068_0093034 3300049584 Bacteria 1862
619 Ga0501068_0158142 3300049584 Bacteria 1427
620 Ga0501069_0001790 3300049585 Bacteria 10750
621 Ga0501070_0001994 3300049586 Bacteria 17942
622 Ga0501070_0186086 3300049586 Bacteria 1708
623 Ga0501073_0051923 3300049589 Bacteria 2871
624 Ga0501073_0056303 3300049589 Bacteria 2750
625 Ga0501073_0066239 3300049589 Bacteria 2518
626 Ga0501073_0187747 3300049589 Bacteria 1430
627 Ga0501073_0246221 3300049589 Bacteria 1234
628 Ga0501074_0010076 3300049590 Bacteria 6862
629 Ga0501079_0002251 3300049741 Bacteria 13917
630 Ga0501080_0000748 3300049742 Bacteria 26257
631 Ga0501080_0025188 3300049742 Bacteria 5521
632 Ga0501080_0107922 3300049742 Bacteria 2580
633 Ga0501080_0118789 3300049742 Bacteria 2451
634 Ga0501080_0253297 3300049742 Bacteria 1605
635 Ga0501080_0295341 3300049742 Bacteria 1470
636 Ga0501083_0030847 3300049744 Bacteria 3679
637 Ga0501083_0044781 3300049744 Bacteria 2995
638 Ga0501035_0017113 3300049822 Bacteria 6680
639 Ga0501035_0018463 3300049822 Bacteria 6425
640 Ga0501035_0118020 3300049822 Bacteria 2321
641 Ga0501035_0156589 3300049822 Bacteria 1974
642 Ga0501035_0165350 3300049822 Bacteria 1913
643 Ga0501035_0178421 3300049822 Bacteria 1831
644 Ga0501035_0183071 3300049822 Bacteria 1804
645 Ga0501044_0004024 3300049823 Bacteria 16477
646 Ga0501044_0005225 3300049823 Bacteria 14446
647 Ga0501044_0007695 3300049823 Bacteria 11848
648 Ga0501044_0013403 3300049823 Bacteria 8866
649 Ga0501044_0017089 3300049823 Bacteria 7785
650 Ga0501044_0024916 3300049823 Bacteria 6345
651 Ga0501044_0034581 3300049823 Bacteria 5298
652 Ga0501044_0063978 3300049823 Bacteria 3756
653 Ga0501044_0177572 3300049823 Bacteria 2098
654 Ga0501044_0362358 3300049823 Bacteria 1367
655 Ga0501044_0469118 3300049823 Bacteria 1163
656 Ga0500635_0000045 3300053080 Bacteria 87314
657 Ga0500643_001557 3300053087 Bacteria 12986
658 Ga0500643_056137 3300053087 Bacteria 1114
659 Ga0500647_0012997 3300053091 Bacteria 3758
660 Ga0500651_0041537 3300053093 Bacteria 2899
661 Ga0500566_0065888 3300053094 Bacteria 2042
662 Ga0500555_057557 3300053103 Bacteria 1052
663 Ga0500556_0000558 3300053104 Bacteria 24866
664 Ga0500562_000146 3300053108 Bacteria 20862
665 Ga0500562_002766 3300053108 Bacteria 4364
666 Ga0500569_003672 3300053109 Bacteria 3164
667 Ga0500595_000109 3300053119 Bacteria 55874
668 Ga0500595_005023 3300053119 Bacteria 5823
669 Ga0500595_025427 3300053119 Bacteria 2052
670 Ga0500595_042868 3300053119 Bacteria 1444
671 Ga0500608_007195 3300053122 Bacteria 4588
672 Ga0500608_138252 3300053122 Bacteria 1083
673 Ga0500614_000738 3300053123 Bacteria 8335
674 Ga0500614_002916 3300053123 Bacteria 3750
675 Ga0500618_000319 3300053125 Bacteria 35375
676 Ga0500642_0048951 3300053130 Bacteria 1858
677 Ga0500559_0000010 3300053136 Bacteria 165569
678 Ga0500559_0000280 3300053136 Bacteria 39387
679 Ga0500559_0002775 3300053136 Bacteria 8869
680 Ga0500559_0022050 3300053136 Bacteria 2701
681 Ga0500573_0000060 3300053140 Bacteria 68257
682 Ga0500577_0056064 3300053142 Bacteria 1498
683 Ga0500590_019652 3300053148 Bacteria 3501
684 Ga0500603_017944 3300053150 Bacteria 1698
685 Ga0500619_043785 3300053154 Bacteria 1424
686 Ga0500624_006347 3300053157 Bacteria 1596
687 Ga0500638_024821 3300053162 Bacteria 2862
688 Ga0500636_0015065 3300053177 Bacteria 4552
689 Ga0500637_0026874 3300053178 Bacteria 3173
690 Ga0500596_001528 3300053735 Bacteria 4685
691 Ga0501084_0001533 3300054114 Bacteria 18366
692 Ga0501084_0317101 3300054114 Bacteria 1317
693 Ga0587106_001307 3300059605 Bacteria 2163
694 Ga0587115_001276 3300059626 Bacteria 2245
695 Ga0587111_0006226 3300060346 Bacteria 1884
696 Ga0501082_0007247 3300060353 Bacteria 9566
697 Ga0501082_0087600 3300060353 Bacteria 2686
698 Ga0501082_0095496 3300060353 Bacteria 2569
699 2511121725 2510917020 Bacteria 5657507
700 2585148988 2582581279 Bacteria 4980720
701 2585151606 2582581280 Bacteria 5994497
702 2585195520 2582581293 Bacteria 5907401
703 2643922933 2643221583 Bacteria 5218014
704 2644086731 2643221614 Bacteria 4260023
705 2644341685 2643221661 Bacteria 4267604
706 2644367972 2643221666 Bacteria 4265935
707 2819536336 2818991435 Bacteria 5433759
708 2819644591 2818991454 Bacteria 5563326
709 Ga0395900_0013659
710 JGI25165J46597_1000246
711 rootH2_10076543
712 rootH2_10091432
713 rootH2_10215532
714 rootH1_10147226
715 Ga0055530_10002084
716 Ga0055531_10018190
717 Ga0055531_10024884
718 Ga0065165_1001609
719 Ga0065165_1033482
720 Ga0070658_10031693
721 Ga0070658_10053126
722 Ga0070658_10092982
723 Ga0070658_10158845
724 Ga0070658_10615499
725 Ga0070676_10020754
726 Ga0070676_10058323
727 Ga0070683_100033946
728 Ga0070683_100431826
729 Ga0070690_100189341
730 Ga0070670_100000032
731 Ga0070670_100381439
732 Ga0068869_100115684
733 Ga0070666_10000876
734 Ga0070666_10045197
735 Ga0070680_100000023
736 Ga0070680_100008042
737 Ga0070680_100028667
738 Ga0070680_100083497
739 Ga0070680_100447786
740 Ga0068868_100051414
741 Ga0068868_100153216
742 Ga0070660_100016351
743 Ga0070691_10007450
744 Ga0070661_100041966
745 Ga0070661_100115097
746 Ga0070661_100293516
747 Ga0070661_100434325
748 Ga0070668_100006777
749 Ga0070668_100042587
750 Ga0070668_100197444
751 Ga0070671_100016016
752 Ga0070671_100062735
753 Ga0070671_100072799
754 Ga0070671_100240560
755 Ga0070673_100086794
756 Ga0070673_100315123
757 Ga0070659_100000638
758 Ga0070659_100002173
759 Ga0070659_100122823
760 Ga0070659_100315024
761 Ga0070667_100000110
762 Ga0070667_100039898
763 Ga0070667_100070166
764 Ga0070667_100263475
765 Ga0070714_100851993
766 Ga0070710_10150255
767 Ga0070711_100044271
768 Ga0070678_100080752
769 Ga0070678_100447518
770 Ga0070662_100156567
771 Ga0070681_10000002
772 Ga0070681_10020584
773 Ga0070681_10054201
774 Ga0070681_10087050
775 Ga0068867_100010512
776 Ga0070685_10154056
777 Ga0070679_100000714
778 Ga0070679_100024422
779 Ga0070679_100130619
780 Ga0070679_100138407
781 Ga0070684_100025106
782 Ga0070684_100217300
783 Ga0068853_100076100
784 Ga0068853_100103458
785 Ga0068853_100118538
786 Ga0068853_100211549
787 Ga0068853_100225246
788 Ga0068853_100338462
789 Ga0070693_100112240
790 Ga0070693_100138614
791 Ga0070665_100000433
792 Ga0070665_100003422
793 Ga0070665_100006669
794 Ga0070665_100046328
795 Ga0070665_100054383
796 Ga0070665_100057028
797 Ga0070665_100188852
798 Ga0068855_100000301
799 Ga0068855_100027861
800 Ga0068855_100036970
801 Ga0068855_100196366
802 Ga0068855_100232531
803 Ga0068855_100240169
804 Ga0068855_100246001
805 Ga0068855_100535394
806 Ga0070664_100182755
807 Ga0068856_100194577
808 Ga0068856_100280345
809 Ga0068856_100440895
810 Ga0068856_100829929
811 Ga0068852_100052440
812 Ga0068852_100058395
813 Ga0068852_100122392
814 Ga0068859_100191817
815 Ga0068859_100378215
816 Ga0068864_100000184
817 Ga0068864_100000321
818 Ga0068866_10065240
819 Ga0068861_100363900
820 Ga0068861_100552193
821 Ga0068863_100000037
822 Ga0068863_100001377
823 Ga0068858_100000029
824 Ga0068858_100006036
825 Ga0068858_100128417
826 Ga0068858_100129465
827 Ga0068860_100000100
828 Ga0068860_100000167
829 Ga0068860_100148872
830 Ga0068862_100008644
831 Ga0068862_100103621
832 Ga0068862_100717426
833 Ga0075366_10148732
834 Ga0097621_100001198
835 Ga0097621_100075644
836 Ga0097621_100078408
837 Ga0097621_100124335
838 Ga0097621_100159729
839 Ga0068871_100001487
840 Ga0068871_100044818
841 Ga0068871_100095041
842 Ga0068871_100159533
843 Ga0068871_100217893
844 Ga0068871_100605204
845 Ga0068865_100000664
846 Ga0068865_100030073
847 Ga0097620_100191818
848 Ga0097620_100378199
849 Ga0079104_1016322
850 Ga0105250_10006833
851 Ga0105240_10000564
852 Ga0105240_10000944
853 Ga0105240_10013845
854 Ga0105240_10119623
855 Ga0105240_10157507
856 Ga0105240_10189179
857 Ga0105240_10254003
858 Ga0105240_10349912
859 Ga0105240_10394542
860 Ga0105240_10527564
861 Ga0105240_10534774
862 Ga0105245_10046489
863 Ga0105245_10053099
864 Ga0105245_10109674
865 Ga0105245_10225300
866 Ga0105247_10051693
867 Ga0105247_10120373
868 Ga0105243_10008311
869 Ga0105241_10050241
870 Ga0105241_10106864
871 Ga0105241_10125529
872 Ga0105242_10043224
873 Ga0105242_10104462
874 Ga0105242_10696980
875 Ga0105242_10806888
876 Ga0105248_10000280
877 Ga0105248_10022042
878 Ga0105248_10022642
879 Ga0105248_10024868
880 Ga0105248_10099751
881 Ga0105248_10740840
882 Ga0105237_10108918
883 Ga0105237_10144627
884 Ga0105237_10153769
885 Ga0105237_10387513
886 Ga0105238_10005585
887 Ga0105238_10007619
888 Ga0105238_10024527
889 Ga0105238_10069310
890 Ga0105238_10078904
891 Ga0105238_10164055
892 Ga0105238_10236576
893 Ga0105238_10374770
894 Ga0105238_10399171
895 Ga0105238_10528973
896 Ga0105238_10782230
897 Ga0105249_10010828
898 Ga0105249_10073283
899 Ga0105249_10094935
900 Ga0105249_10261115
901 Ga0105249_10270726
902 Ga0105249_10767843
903 Ga0105239_10003451
904 Ga0105239_10052496
905 Ga0105239_10082819
906 Ga0105239_10102209
907 Ga0105239_10124257
908 Ga0105239_10326146
909 Ga0105239_10503921
910 Ga0105246_10261917
911 Ga0157373_10001320
912 Ga0157373_10012399
913 Ga0157373_10066755
914 Ga0157370_10037032
915 Ga0157370_10063705
916 Ga0157370_10214089
917 Ga0157370_10390438
918 Ga0157370_10733469
919 Ga0157369_10033563
920 Ga0157369_10043173
921 Ga0157369_10129964
922 Ga0157369_10356992
923 Ga0157369_10414959
924 Ga0157374_10349054
925 Ga0157378_10093553
926 Ga0157378_10122253
927 Ga0157378_10504369
928 Ga0163162_10498463
929 Ga0157372_10137960
930 Ga0157372_10240479
931 Ga0157372_10294097
932 Ga0157375_10082401
933 Ga0157375_11204393
934 Ga0163163_10000004
935 Ga0163163_10105669
936 Ga0163163_10123295
937 Ga0163163_10170425
938 Ga0163163_10224747
939 Ga0163163_10320712
940 Ga0157379_10005280
941 Ga0157379_10016863
942 Ga0157379_10023062
943 Ga0157376_10452485
944 Ga0157376_10490741
945 Ga0163161_10027011
946 Ga0207427_103528
947 Ga0209026_1000851
948 Ga0209233_1000006
949 Ga0209564_1006954
950 Ga0209758_1000008
951 Ga0209758_1000331
952 Ga0209758_1065746
953 Ga0209050_1000130
954 Ga0209257_1000059
955 Ga0209257_1000246
956 Ga0209257_1001754
957 Ga0207696_1040002
958 Ga0207710_10141812
959 Ga0207688_10072794
960 Ga0207680_10001291
961 Ga0207680_10156008
962 Ga0207680_10164460
963 Ga0207647_10137483
964 Ga0207705_10000970
965 Ga0207705_10034055
966 Ga0207705_10232506
967 Ga0207705_10442734
968 Ga0207654_10093549
969 Ga0207654_10233109
970 Ga0207707_10000002
971 Ga0207707_10037873
972 Ga0207695_10000003
973 Ga0207695_10004245
974 Ga0207695_10010734
975 Ga0207695_10011375
976 Ga0207695_10069921
977 Ga0207695_10092691
978 Ga0207695_10132018
979 Ga0207695_10205673
980 Ga0207695_10303416
981 Ga0207695_10321870
982 Ga0207695_10387917
983 Ga0207695_10441565
984 Ga0207671_10230063
985 Ga0207660_10003432
986 Ga0207660_10015133
987 Ga0207660_10374695
988 Ga0207649_10099121
989 Ga0207649_10191177
990 Ga0207649_10304239
991 Ga0207652_10000641
992 Ga0207652_10004285
993 Ga0207652_10176631
994 Ga0207652_10197875
995 Ga0207694_10000016
996 Ga0207694_10020349
997 Ga0207694_10059819
998 Ga0207694_10208300
999 Ga0207694_10251364
1000 Ga0207694_10252963
1001 Ga0207694_10261294
1002 Ga0207694_10444388
1003 Ga0207650_10000074
1004 Ga0207650_10152295
1005 Ga0207650_10349449
1006 Ga0207659_10008634
1007 Ga0207687_10072593
1008 Ga0207687_10075128
1009 Ga0207687_10143736
1010 Ga0207687_10338732
1011 Ga0207644_10012414
1012 Ga0207644_10119076
1013 Ga0207644_10180958
1014 Ga0207644_10407319
1015 Ga0207690_10000159
1016 Ga0207690_10006522
1017 Ga0207690_10060485
1018 Ga0207690_10574778
1019 Ga0207706_10049653
1020 Ga0207706_10492146
1021 Ga0207686_10044035
1022 Ga0207686_10070243
1023 Ga0207709_10012017
1024 Ga0207669_10011030
1025 Ga0207704_10001590
1026 Ga0207704_10008398
1027 Ga0207691_10356149
1028 Ga0207711_10007049
1029 Ga0207711_10022124
1030 Ga0207711_10037615
1031 Ga0207711_10365278
1032 Ga0207689_10050504
1033 Ga0207679_10011413
1034 Ga0207679_10133980
1035 Ga0207667_10000021
1036 Ga0207667_10046655
1037 Ga0207667_10049413
1038 Ga0207667_10107498
1039 Ga0207667_10125211
1040 Ga0207667_10127520
1041 Ga0207667_10202470
1042 Ga0207667_10221876
1043 Ga0207712_10006330
1044 Ga0207712_10049994
1045 Ga0207712_10064732
1046 Ga0207668_10000001
1047 Ga0207668_10000246
1048 Ga0207640_10096969
1049 Ga0207658_10000275
1050 Ga0207658_10026953
1051 Ga0207658_10031695
1052 Ga0207658_10289521
1053 Ga0207677_10032925
1054 Ga0207703_10001093
1055 Ga0207703_10054178
1056 Ga0207703_10086103
1057 Ga0207703_10360642
1058 Ga0207639_10014523
1059 Ga0207639_10043000
1060 Ga0207639_10061463
1061 Ga0207639_10094891
1062 Ga0207639_10166908
1063 Ga0207639_10211323
1064 Ga0207639_10245397
1065 Ga0207639_10320795
1066 Ga0207639_10609170
1067 Ga0207708_10068878
1068 Ga0207702_10095020
1069 Ga0207702_10316832
1070 Ga0207702_10572709
1071 Ga0207702_10923761
1072 Ga0207641_10000034
1073 Ga0207641_10001917
1074 Ga0207648_10016983
1075 Ga0207648_10047240
1076 Ga0207676_10000202
1077 Ga0207676_10001101
1078 Ga0207676_10004781
1079 Ga0207674_10052452
1080 Ga0207674_10164284
1081 Ga0207674_10286716
1082 Ga0207674_10418990
1083 Ga0207675_100444220
1084 Ga0207698_10034015
1085 Ga0207698_10064132
1086 Ga0209981_1003305
1087 Ga0209999_1005248
1088 Ga0268266_10000003
1089 Ga0268266_10000289
1090 Ga0268266_10000746
1091 Ga0268266_10012231
1092 Ga0268266_10022231
1093 Ga0268266_10038206
1094 Ga0268266_10048721
1095 Ga0268266_10090410
1096 Ga0268266_10101306
1097 Ga0268265_10000648
1098 Ga0268265_10276562
1099 Ga0268265_10560268
1100 Ga0268264_10000002
1101 Ga0268264_10000068
1102 Ga0268264_10459255
1103 Ga0265318_10001360
1104 Ga0307517_10002267
1105 Ga0307517_10033152
1106 Ga0307517_10074807
1107 Ga0307517_10199204
1108 Ga0307515_10012598
1109 Ga0265338_10007293
1110 Ga0307511_10030594
1111 Ga0265760_10021543
1112 Ga0265332_10011546
1113 Ga0265325_10004954
1114 Ga0265325_10050543
1115 Ga0265340_10036654
1116 Ga0265340_10050883
1117 Ga0265339_10009253
1118 Ga0265339_10047970
1119 Ga0265339_10048746
1120 Ga0265339_10090711
1121 Ga0265331_10000080
1122 Ga0265331_10007961
1123 Ga0265331_10039691
1124 Ga0265331_10045360
1125 Ga0265327_10003877
1126 Ga0265327_10008511
1127 Ga0265327_10163968
1128 Ga0265316_10075979
1129 Ga0265316_10094004
1130 Ga0307513_10000045
1131 Ga0307513_10000790
1132 Ga0307513_10004139
1133 Ga0307513_10478974
1134 Ga0265313_10041225
1135 Ga0265313_10042413
1136 Ga0265313_10079895
1137 Ga0265314_10007720
1138 Ga0265314_10024020
1139 Ga0265314_10043804
1140 Ga0265314_10051744
1141 Ga0265314_10066847
1142 Ga0265314_10086198
1143 Ga0265342_10029142
1144 Ga0265342_10113010
1145 Ga0307516_10078605
1146 Ga0307516_10200559
1147 Ga0307413_10272838
1148 Ga0307510_10045879
1149 Ga0307510_10160178
1150 Ga0307510_10162304
1151 Ga0373936_0002176
1152 Ga0373936_0039837
1153 Ga0373939_0068037
1154 Ga0373942_0020166
1155 Ga0373935_0174503
1156 Ga0373927_0000479
1157 Ga0373937_0504155
1158 Ga0373937_0639173
1159 Ga0373925_0005838
1160 Ga0395899_0000373
1161 Ga0395899_0021296
1162 Ga0395899_0117039
1163 Ga0395900_0000052
1164 Ga0395900_0044791
1165 Ga0395900_0268240
1166 Ga0395900_0376441
1167 Ga0395898_0003873
1168 Ga0395898_0040701
1169 Ga0395898_0287493
1170 Ga0395905_0073275
1171 Ga0395905_0223961
1172 Ga0395901_0000001
1173 Ga0395901_0132307
1174 Ga0400483_099121
1175 Ga0400483_273186
1176 Ga0436365_0608786
1177 Ga0436365_0822178
1178 Ga0436365_1687427
1179 Ga0439446_0012843
1180 Ga0466966_0205851
1181 Ga0466961_0298343
1182 Ga0466964_0066934
1183 Ga0466957_0244773
1184 Ga0466957_0370449
1185 Ga0466967_0115764
1186 Ga0495627_008977
1187 Ga0495629_0026670
1188 Ga0495638_0000588
1189 Ga0495638_0009677
1190 Ga0495650_0038545
1191 Ga0495664_0065179
1192 Ga0495584_0113063
1193 Ga0495585_0051526
1194 Ga0495607_0010068
1195 Ga0495583_0000013
1196 Ga0495583_0124545
1197 Ga0495606_0060947
1198 Ga0495608_0232412
1199 Ga0495610_0070618
1200 Ga0495616_0000053
1201 Ga0495618_0385616
1202 Ga0495628_0199012
1203 Ga0495632_0016614
1204 Ga0495637_0033144
1205 Ga0495643_0023418
1206 Ga0495648_0120483
1207 Ga0495652_0060966
1208 Ga0495652_0149310
1209 Ga0495609_0008702
1210 Ga0495609_0012485
1211 Ga0495609_0059539
1212 Ga0495645_0043892
1213 Ga0495622_0005584
1214 Ga0495656_0102852
1215 Ga0495668_0020755
1216 Ga0495668_0220258
1217 Ga0495625_0000290
1218 Ga0495625_0010575
1219 Ga0495659_0130996
1220 Ga0495661_0122720
1221 Ga0495669_0000012
1222 Ga0495669_0000329
1223 Ga0495669_0006242
1224 Ga0495669_0010908
1225 Ga0495669_0083777
1226 Ga0495613_0001323
1227 Ga0495670_0083012
1228 Ga0495589_0017961
1229 Ga0495589_0027872
1230 Ga0495660_0051302
1231 Ga0495581_0089676
1232 Ga0495636_0010312
1233 Ga0495674_0087567
1234 Ga0495672_0020752
1235 Ga0495683_0099212
1236 Ga0495683_0171908
1237 Ga0495675_0026630
1238 Ga0495677_0049925
1239 Ga0495679_009102
1240 Ga0495673_0000025
1241 Ga0495686_0004501
1242 Ga0495686_0006929
1243 Ga0495593_0024764
1244 Ga0495602_0061766
1245 Ga0496100_0252034
1246 Ga0496102_0109303
1247 Ga0496103_0085277
1248 Ga0496103_0094179
1249 Ga0496106_0107999
1250 Ga0496107_0000329
1251 Ga0496109_0007918
1252 Ga0496112_0012967
1253 Ga0496112_0038361
1254 Ga0496112_0098500
1255 Ga0496113_0257013
1256 Ga0496115_0021383
1257 Ga0496116_0100460
1258 Ga0496117_0012409
1259 Ga0496118_0005681
1260 Ga0496119_0015319
1261 Ga0496121_0000323
1262 Ga0496121_0001066
1263 Ga0496121_0001417
1264 Ga0496126_0022200
1265 Ga0495682_0001343
1266 Ga0495682_0062588
1267 Ga0501031_0000410
1268 Ga0501032_0057586
1269 Ga0501032_0082237
1270 Ga0501032_0086002
1271 Ga0501033_0015415
1272 Ga0501033_0034540
1273 Ga0501033_0066291
1274 Ga0501033_0096994
1275 Ga0501033_0149405
1276 Ga0501033_0249566
1277 Ga0501033_0354024
1278 Ga0501034_0003773
1279 Ga0501034_0028085
1280 Ga0501034_0117073
1281 Ga0501034_0147231
1282 Ga0501036_0155901
1283 Ga0501036_0203336
1284 Ga0501036_0253542
1285 Ga0501037_0006688
1286 Ga0501037_0014739
1287 Ga0501038_0008309
1288 Ga0501038_0029932
1289 Ga0501038_0099217
1290 Ga0501038_0170045
1291 Ga0501038_0209717
1292 Ga0501039_0000235
1293 Ga0501039_0283619
1294 Ga0501042_0133852
1295 Ga0501043_0005296
1296 Ga0501043_0022404
1297 Ga0501043_0073969
1298 Ga0501043_0106634
1299 Ga0501043_0109852
1300 Ga0501043_0163059
1301 Ga0501043_0213720
1302 Ga0501046_0011825
1303 Ga0501046_0046363
1304 Ga0501046_0101159
1305 Ga0501046_0147548
1306 Ga0501047_0008942
1307 Ga0501047_0014685
1308 Ga0501047_0015297
1309 Ga0501047_0038426
1310 Ga0501047_0039375
1311 Ga0501047_0116475
1312 Ga0501047_0180847
1313 Ga0501047_0204412
1314 Ga0501047_0205926
1315 Ga0501047_0229493
1316 Ga0501047_0230844
1317 Ga0501047_0256700
1318 Ga0501047_0282870
1319 Ga0501047_0292524
1320 Ga0501047_0316856
1321 Ga0501047_0534070
1322 Ga0501047_0575218
1323 Ga0501048_0029706
1324 Ga0501067_0016841
1325 Ga0501067_0079155
1326 Ga0501068_0093034
1327 Ga0501068_0158142
1328 Ga0501069_0001790
1329 Ga0501070_0001994
1330 Ga0501070_0186086
1331 Ga0501073_0051923
1332 Ga0501073_0056303
1333 Ga0501073_0066239
1334 Ga0501073_0187747
1335 Ga0501073_0246221
1336 Ga0501074_0010076
1337 Ga0501079_0002251
1338 Ga0501080_0000748
1339 Ga0501080_0025188
1340 Ga0501080_0107922
1341 Ga0501080_0118789
1342 Ga0501080_0253297
1343 Ga0501080_0295341
1344 Ga0501083_0030847
1345 Ga0501083_0044781
1346 Ga0501035_0017113
1347 Ga0501035_0018463
1348 Ga0501035_0118020
1349 Ga0501035_0156589
1350 Ga0501035_0165350
1351 Ga0501035_0178421
1352 Ga0501035_0183071
1353 Ga0501044_0004024
1354 Ga0501044_0005225
1355 Ga0501044_0007695
1356 Ga0501044_0013403
1357 Ga0501044_0017089
1358 Ga0501044_0024916
1359 Ga0501044_0034581
1360 Ga0501044_0063978
1361 Ga0501044_0177572
1362 Ga0501044_0362358
1363 Ga0501044_0469118
1364 Ga0500635_0000045
1365 Ga0500643_001557
1366 Ga0500643_056137
1367 Ga0500647_0012997
1368 Ga0500651_0041537
1369 Ga0500566_0065888
1370 Ga0500555_057557
1371 Ga0500556_0000558
1372 Ga0500562_000146
1373 Ga0500562_002766
1374 Ga0500569_003672
1375 Ga0500595_000109
1376 Ga0500595_005023
1377 Ga0500595_025427
1378 Ga0500595_042868
1379 Ga0500608_007195
1380 Ga0500608_138252
1381 Ga0500614_000738
1382 Ga0500614_002916
1383 Ga0500618_000319
1384 Ga0500642_0048951
1385 Ga0500559_0000010
1386 Ga0500559_0000280
1387 Ga0500559_0002775
1388 Ga0500559_0022050
1389 Ga0500573_0000060
1390 Ga0500577_0056064
1391 Ga0500590_019652
1392 Ga0500603_017944
1393 Ga0500619_043785
1394 Ga0500624_006347
1395 Ga0500638_024821
1396 Ga0500636_0015065
1397 Ga0500637_0026874
1398 Ga0500596_001528
1399 Ga0501084_0001533
1400 Ga0501084_0317101
1401 Ga0587106_001307
1402 Ga0587115_001276
1403 Ga0587111_0006226
1404 Ga0501082_0007247
1405 Ga0501082_0087600
1406 Ga0501082_0095496
1407 2511121725
1408 2585148988
1409 2585151606
1410 2585195520
1411 2643922933
1412 2644086731
1413 2644341685
1414 2644367972
1415 2819536336
1416 2819644591

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02167

Cytochrom_C1

Cytochrome C1 family

83

328

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d6u-assembly1.cif.gz_D cytochrome bc1 bound to the 4(1h)-pyridone gsk932121 0.9546 27 262
3h1k-assembly1.cif.gz_Q chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound 0.9535 27 264
1bcc-assembly1.cif.gz_D cytochrome bc1 complex from chicken 0.9527 25 264
7o3c-assembly1.cif.gz_D murine supercomplex ciii2civ in the mature unlocked conformation 0.9522 25 264
5xte-assembly1.cif.gz_H cryo-em structure of human respiratory complex iii (cytochrome bc1 complex) 0.9491 26 262
ID Description Score Start End Superfamily
1sqqD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9383 27 230 1.10.760.10
1sqqD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9201 27 230 1.10.760.10
2yiuE01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9151 32 230 1.10.760.10
2yiuE01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.91 32 230 1.10.760.10
af_Q4DU59_5_209_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8617 27 229 1.10.760.10

Map