F476644

General Info

Members Datasets Scaffolds Average Seq Length
709 246 1418 148

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100444102|Ga0068853_1004441022
Length 163
Sequence MTDAERRASAPSIMAFPLPPPMRRALDLAAVAAEAGEVPVGAVVTYGDEIIAEARNAMRGSTDPTAHAEMVAIRAAGEKLGSSRLDECTIWVTLEPCAMCAAAIGLARFKELRFGAEDPKGGGVVHGARIFAQPTCHHRPDLLGGIGEAESAELLRGFFAERR

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 2.26
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100444102 3300005539 Bacteria 1219
2 JGI24741J21665_1001190 3300001915 Bacteria 7686
3 JGI24747J21853_1001204 3300001978 Bacteria 1891
4 JGI24740J21852_10021129 3300001979 Bacteria 2261
5 JGI24739J22299_10001986 3300001989 Bacteria 7829
6 JGI24737J22298_10001142 3300001990 Bacteria 9352
7 JGI24735J21928_10008736 3300002067 Bacteria 3268
8 JGI24735J21928_10017080 3300002067 Bacteria 2245
9 JGI24738J21930_10001221 3300002075 Bacteria 7217
10 Ga0070658_10017631 3300005327 Bacteria 5711
11 Ga0070658_10021372 3300005327 Bacteria 5187
12 Ga0070658_10077136 3300005327 Bacteria 2733
13 Ga0070658_10092947 3300005327 Bacteria 2488
14 Ga0070658_10116471 3300005327 Bacteria 2217
15 Ga0070658_10171532 3300005327 Bacteria 1822
16 Ga0070658_10199298 3300005327 Bacteria 1689
17 Ga0070658_10211679 3300005327 Bacteria 1638
18 Ga0070658_10790353 3300005327 Bacteria 824
19 Ga0070658_11242161 3300005327 Bacteria 647
20 Ga0070676_10008273 3300005328 Bacteria 5601
21 Ga0070676_10020742 3300005328 Bacteria 3673
22 Ga0070676_10128776 3300005328 Unclassified 1598
23 Ga0070676_10129193 3300005328 Bacteria 1596
24 Ga0070683_100049425 3300005329 Bacteria 3890
25 Ga0070683_100060298 3300005329 Bacteria 3526
26 Ga0070690_100031336 3300005330 Bacteria 3312
27 Ga0070690_101306190 3300005330 Bacteria 581
28 Ga0070677_10004122 3300005333 Bacteria 4717
29 Ga0070677_10047120 3300005333 Bacteria 1727
30 Ga0068869_100001204 3300005334 Bacteria 15210
31 Ga0068869_100034373 3300005334 Bacteria 3585
32 Ga0068869_100048277 3300005334 Bacteria 3077
33 Ga0068869_100217301 3300005334 Bacteria 1514
34 Ga0070666_10000175 3300005335 Bacteria 43927
35 Ga0070666_10059542 3300005335 Bacteria 2583
36 Ga0070680_100000197 3300005336 Bacteria 39326
37 Ga0070680_100058606 3300005336 Bacteria 3149
38 Ga0070680_100174746 3300005336 Bacteria 1808
39 Ga0070682_100325723 3300005337 Bacteria 1137
40 Ga0068868_100008744 3300005338 Bacteria 7253
41 Ga0070660_100002605 3300005339 Bacteria 12382
42 Ga0070660_100006738 3300005339 Bacteria 7969
43 Ga0070660_100010434 3300005339 Bacteria 6564
44 Ga0070660_100017678 3300005339 Bacteria 5198
45 Ga0070660_100029310 3300005339 Bacteria 4124
46 Ga0070660_100105220 3300005339 Bacteria 2239
47 Ga0070660_100194333 3300005339 Bacteria 1644
48 Ga0070660_100260407 3300005339 Unclassified 1416
49 Ga0070660_100496689 3300005339 Bacteria 1015
50 Ga0070660_100620346 3300005339 Bacteria 905
51 Ga0070689_100402430 3300005340 Bacteria 1157
52 Ga0070691_10078781 3300005341 Bacteria 1610
53 Ga0070661_100004129 3300005344 Bacteria 10013
54 Ga0070661_100006179 3300005344 Bacteria 8257
55 Ga0070661_100074586 3300005344 Bacteria 2498
56 Ga0070661_100078669 3300005344 Bacteria 2433
57 Ga0070661_100112810 3300005344 Bacteria 2031
58 Ga0070661_100304353 3300005344 Bacteria 1242
59 Ga0070661_100544663 3300005344 Bacteria 933
60 Ga0070661_100682610 3300005344 Bacteria 836
61 Ga0070692_10005132 3300005345 Bacteria 5542
62 Ga0070692_10017094 3300005345 Bacteria 3462
63 Ga0070668_100003013 3300005347 Bacteria 12454
64 Ga0070668_100028225 3300005347 Bacteria 4261
65 Ga0070668_101177291 3300005347 Bacteria 694
66 Ga0070669_100000586 3300005353 Bacteria 27126
67 Ga0070669_100062099 3300005353 Bacteria 2746
68 Ga0070669_100087092 3300005353 Bacteria 2335
69 Ga0070669_100224449 3300005353 Bacteria 1486
70 Ga0070675_100042818 3300005354 Bacteria 3700
71 Ga0070671_100019486 3300005355 Bacteria 5523
72 Ga0070671_100067691 3300005355 Bacteria 2977
73 Ga0070671_100585952 3300005355 Bacteria 963
74 Ga0070671_101004556 3300005355 Unclassified 731
75 Ga0070674_100006182 3300005356 Bacteria 6964
76 Ga0070673_100002689 3300005364 Bacteria 10890
77 Ga0070673_100005010 3300005364 Bacteria 8447
78 Ga0070673_100013723 3300005364 Bacteria 5617
79 Ga0070673_100133059 3300005364 Bacteria 2089
80 Ga0070673_100136474 3300005364 Bacteria 2065
81 Ga0070659_100001641 3300005366 Bacteria 16121
82 Ga0070659_100024042 3300005366 Bacteria 4668
83 Ga0070659_100051572 3300005366 Bacteria 3235
84 Ga0070659_100080812 3300005366 Bacteria 2595
85 Ga0070659_100091613 3300005366 Bacteria 2437
86 Ga0070659_100099657 3300005366 Bacteria 2337
87 Ga0070659_100131229 3300005366 Bacteria 2035
88 Ga0070659_100178192 3300005366 Bacteria 1743
89 Ga0070659_100257540 3300005366 Bacteria 1447
90 Ga0070659_100314582 3300005366 Bacteria 1308
91 Ga0070659_100360929 3300005366 Bacteria 1220
92 Ga0070659_100368375 3300005366 Bacteria 1208
93 Ga0070667_100003196 3300005367 Bacteria 14038
94 Ga0070667_101298569 3300005367 Bacteria 682
95 Ga0070701_10412474 3300005438 Unclassified 858
96 Ga0070705_100530109 3300005440 Bacteria 899
97 Ga0070663_100024805 3300005455 Bacteria 4040
98 Ga0070663_100027273 3300005455 Bacteria 3877
99 Ga0070663_100603668 3300005455 Unclassified 923
100 Ga0070663_100755308 3300005455 Bacteria 831
101 Ga0070663_100802757 3300005455 Unclassified 807
102 Ga0070663_100883115 3300005455 Unclassified 771
103 Ga0070662_100002851 3300005457 Bacteria 10717
104 Ga0070662_100002999 3300005457 Bacteria 10498
105 Ga0070662_100005622 3300005457 Bacteria 8016
106 Ga0070662_100006598 3300005457 Bacteria 7491
107 Ga0070662_100051215 3300005457 Bacteria 2981
108 Ga0070662_100327208 3300005457 Unclassified 1251
109 Ga0070681_10003859 3300005458 Bacteria 14106
110 Ga0070681_10083594 3300005458 Bacteria 3146
111 Ga0070681_10131832 3300005458 Bacteria 2431
112 Ga0070681_10134891 3300005458 Bacteria 2399
113 Ga0070681_11435593 3300005458 Bacteria 614
114 Ga0068867_100001360 3300005459 Bacteria 16886
115 Ga0068867_100052811 3300005459 Bacteria 3000
116 Ga0068867_100216397 3300005459 Bacteria 1541
117 Ga0070679_100036499 3300005530 Bacteria 4877
118 Ga0070679_100186597 3300005530 Bacteria 2044
119 Ga0070679_100294236 3300005530 Unclassified 1575
120 Ga0070679_101485342 3300005530 Bacteria 624
121 Ga0070684_100041428 3300005535 Bacteria 3970
122 Ga0070684_100067146 3300005535 Bacteria 3149
123 Ga0068853_100002189 3300005539 Bacteria 14573
124 Ga0068853_100014666 3300005539 Bacteria 6427
125 Ga0068853_100061747 3300005539 Bacteria 3242
126 Ga0068853_100218562 3300005539 Bacteria 1739
127 Ga0068853_100323642 3300005539 Bacteria 1430
128 Ga0068853_101135217 3300005539 Bacteria 754
129 Ga0068853_101153810 3300005539 Bacteria 748
130 Ga0068853_101553185 3300005539 Bacteria 641
131 Ga0070672_100001067 3300005543 Bacteria 16705
132 Ga0070672_100078686 3300005543 Bacteria 2638
133 Ga0070672_100098914 3300005543 Bacteria 2363
134 Ga0070672_100176737 3300005543 Bacteria 1778
135 Ga0070672_100275654 3300005543 Bacteria 1421
136 Ga0070686_100322114 3300005544 Bacteria 1153
137 Ga0070696_100005040 3300005546 Bacteria 8824
138 Ga0070696_100119712 3300005546 Bacteria 1904
139 Ga0070696_100495282 3300005546 Bacteria 971
140 Ga0070693_100178519 3300005547 Bacteria 1365
141 Ga0070693_100303574 3300005547 Bacteria 1077
142 Ga0070693_100329721 3300005547 Unclassified 1038
143 Ga0070665_100001939 3300005548 Bacteria 23328
144 Ga0070665_100074258 3300005548 Bacteria 3406
145 Ga0070665_100322700 3300005548 Unclassified 1548
146 Ga0070665_100484472 3300005548 Unclassified 1248
147 Ga0070665_100503439 3300005548 Bacteria 1222
148 Ga0068855_100002788 3300005563 Bacteria 21511
149 Ga0068855_100006176 3300005563 Bacteria 14605
150 Ga0068855_100057239 3300005563 Bacteria 4570
151 Ga0068855_100079701 3300005563 Bacteria 3797
152 Ga0068855_100591580 3300005563 Bacteria 1197
153 Ga0070664_100004161 3300005564 Bacteria 11622
154 Ga0070664_100019879 3300005564 Bacteria 5527
155 Ga0070664_100038219 3300005564 Bacteria 4040
156 Ga0070664_100061767 3300005564 Bacteria 3194
157 Ga0070664_100119694 3300005564 Bacteria 2304
158 Ga0070664_100126821 3300005564 Bacteria 2239
159 Ga0070664_100725154 3300005564 Bacteria 927
160 Ga0070664_101355199 3300005564 Bacteria 672
161 Ga0068857_100000338 3300005577 Bacteria 32330
162 Ga0068857_100016516 3300005577 Bacteria 6467
163 Ga0068857_100049085 3300005577 Bacteria 3745
164 Ga0068857_100197026 3300005577 Bacteria 1835
165 Ga0068857_100515326 3300005577 Bacteria 1123
166 Ga0068854_100003108 3300005578 Bacteria 10326
167 Ga0068854_100016378 3300005578 Bacteria 4941
168 Ga0068854_100020745 3300005578 Bacteria 4452
169 Ga0068854_100020959 3300005578 Bacteria 4429
170 Ga0068854_100170890 3300005578 Bacteria 1691
171 Ga0068854_100425710 3300005578 Bacteria 1104
172 Ga0068854_100923078 3300005578 Bacteria 768
173 Ga0068856_100106737 3300005614 Bacteria 2795
174 Ga0068856_100266925 3300005614 Bacteria 1727
175 Ga0068856_100316184 3300005614 Bacteria 1579
176 Ga0068856_100949826 3300005614 Unclassified 878
177 Ga0068852_100000335 3300005616 Bacteria 31883
178 Ga0068852_100001883 3300005616 Bacteria 14288
179 Ga0068852_100026751 3300005616 Bacteria 4695
180 Ga0068852_100038128 3300005616 Bacteria 4036
181 Ga0068852_100046139 3300005616 Bacteria 3711
182 Ga0068852_100048513 3300005616 Bacteria 3628
183 Ga0068852_100121895 3300005616 Bacteria 2389
184 Ga0068852_100198753 3300005616 Bacteria 1896
185 Ga0068852_100353871 3300005616 Bacteria 1435
186 Ga0068852_100625658 3300005616 Bacteria 1082
187 Ga0068852_101006510 3300005616 Bacteria 852
188 Ga0068859_100000464 3300005617 Bacteria 40106
189 Ga0068859_100006502 3300005617 Bacteria 11862
190 Ga0068859_100064789 3300005617 Bacteria 3687
191 Ga0068859_100073920 3300005617 Bacteria 3447
192 Ga0068864_100001187 3300005618 Bacteria 21670
193 Ga0068864_100003779 3300005618 Bacteria 12491
194 Ga0068864_100010362 3300005618 Bacteria 7698
195 Ga0068864_100457566 3300005618 Bacteria 1221
196 Ga0068866_10031388 3300005718 Bacteria 2559
197 Ga0068866_10336468 3300005718 Bacteria 955
198 Ga0068861_100037371 3300005719 Bacteria 3610
199 Ga0068861_100120211 3300005719 Bacteria 2118
200 Ga0068851_10028162 3300005834 Bacteria 2774
201 Ga0068851_10098632 3300005834 Unclassified 1547
202 Ga0068870_10147950 3300005840 Bacteria 1381
203 Ga0068870_10382949 3300005840 Bacteria 911
204 Ga0068870_10929263 3300005840 Bacteria 616
205 Ga0068863_100004975 3300005841 Bacteria 13100
206 Ga0068863_100007450 3300005841 Bacteria 10711
207 Ga0068863_100049793 3300005841 Bacteria 3972
208 Ga0068863_100050771 3300005841 Bacteria 3931
209 Ga0068863_100142195 3300005841 Bacteria 2293
210 Ga0068858_100008523 3300005842 Bacteria 9852
211 Ga0068858_100009768 3300005842 Bacteria 9133
212 Ga0068858_100028517 3300005842 Bacteria 5185
213 Ga0068858_100059866 3300005842 Bacteria 3520
214 Ga0068858_100767013 3300005842 Unclassified 940
215 Ga0068860_100004974 3300005843 Bacteria 13548
216 Ga0068860_100008094 3300005843 Bacteria 10470
217 Ga0068860_100009092 3300005843 Bacteria 9886
218 Ga0068860_100155529 3300005843 Bacteria 2203
219 Ga0068860_100158731 3300005843 Bacteria 2180
220 Ga0068860_100571860 3300005843 Bacteria 1133
221 Ga0068862_100001250 3300005844 Bacteria 23893
222 Ga0068862_100035570 3300005844 Bacteria 4219
223 Ga0068862_100118485 3300005844 Bacteria 2331
224 Ga0068862_100759683 3300005844 Bacteria 944
225 Ga0075368_10000064 3300006042 Bacteria 25622
226 Ga0075363_100001102 3300006048 Bacteria 9799
227 Ga0075364_10033605 3300006051 Bacteria 3304
228 Ga0075362_10004003 3300006177 Bacteria 5243
229 Ga0075367_10002036 3300006178 Bacteria 9045
230 Ga0075369_10004485 3300006186 Bacteria 5161
231 Ga0075366_10002117 3300006195 Bacteria 10100
232 Ga0097621_100219468 3300006237 Bacteria 1656
233 Ga0097621_101517291 3300006237 Bacteria 636
234 Ga0075370_10104787 3300006353 Bacteria 1639
235 Ga0068871_100031738 3300006358 Bacteria 4168
236 Ga0068871_100342734 3300006358 Bacteria 1320
237 Ga0075433_10140138 3300006852 Bacteria 2149
238 Ga0075434_100259265 3300006871 Bacteria 1757
239 Ga0068865_100010731 3300006881 Bacteria 5710
240 Ga0068865_100100709 3300006881 Bacteria 2114
241 Ga0068865_100145241 3300006881 Bacteria 1793
242 Ga0068865_100202007 3300006881 Bacteria 1543
243 Ga0097620_100000464 3300006931 Bacteria 40106
244 Ga0097620_100006502 3300006931 Bacteria 11862
245 Ga0097620_100064791 3300006931 Bacteria 3687
246 Ga0097620_100073918 3300006931 Bacteria 3447
247 Ga0105251_10001250 3300009011 Bacteria 22028
248 Ga0105250_10005567 3300009092 Bacteria 5633
249 Ga0105240_10050522 3300009093 Bacteria 5241
250 Ga0105240_10076519 3300009093 Bacteria 4125
251 Ga0111539_10297835 3300009094 Bacteria 1877
252 Ga0105245_10000128 3300009098 Bacteria 72249
253 Ga0105245_10154113 3300009098 Bacteria 2175
254 Ga0105247_10176916 3300009101 Bacteria 1422
255 Ga0105247_10243827 3300009101 Bacteria 1225
256 Ga0105247_10282335 3300009101 Bacteria 1146
257 Ga0105243_10137854 3300009148 Bacteria 2078
258 Ga0105241_10011856 3300009174 Bacteria 6404
259 Ga0105241_10033902 3300009174 Bacteria 3834
260 Ga0105241_10083224 3300009174 Bacteria 2510
261 Ga0105242_10405407 3300009176 Unclassified 1274
262 Ga0105248_10000787 3300009177 Bacteria 35583
263 Ga0105248_10001529 3300009177 Bacteria 25755
264 Ga0105248_10013511 3300009177 Bacteria 8989
265 Ga0105248_10018199 3300009177 Bacteria 7760
266 Ga0105248_10018309 3300009177 Bacteria 7734
267 Ga0105248_10035216 3300009177 Bacteria 5601
268 Ga0105248_10044913 3300009177 Bacteria 4955
269 Ga0105248_10605093 3300009177 Bacteria 1237
270 Ga0105248_11318720 3300009177 Bacteria 816
271 Ga0105237_10035733 3300009545 Bacteria 5027
272 Ga0105237_10211935 3300009545 Bacteria 1937
273 Ga0105238_10012788 3300009551 Bacteria 8470
274 Ga0105238_10019525 3300009551 Bacteria 6903
275 Ga0105238_10084096 3300009551 Bacteria 3171
276 Ga0105238_10159997 3300009551 Bacteria 2227
277 Ga0105238_10175459 3300009551 Bacteria 2120
278 Ga0105249_10239906 3300009553 Bacteria 1792
279 Ga0105239_10065114 3300010375 Bacteria 4002
280 Ga0105246_10036675 3300011119 Bacteria 3286
281 Ga0105246_10117371 3300011119 Bacteria 1966
282 Ga0157373_10014869 3300013100 Bacteria 5699
283 Ga0157373_10016966 3300013100 Bacteria 5304
284 Ga0157373_10033090 3300013100 Bacteria 3721
285 Ga0157373_10040381 3300013100 Bacteria 3339
286 Ga0157373_10180436 3300013100 Bacteria 1486
287 Ga0157373_10290247 3300013100 Bacteria 1160
288 Ga0157373_11059331 3300013100 Bacteria 607
289 Ga0157371_10004039 3300013102 Bacteria 12981
290 Ga0157371_10007577 3300013102 Bacteria 8760
291 Ga0157371_10017242 3300013102 Bacteria 5369
292 Ga0157371_10023947 3300013102 Bacteria 4461
293 Ga0157371_10025055 3300013102 Bacteria 4352
294 Ga0157370_10019454 3300013104 Bacteria 6810
295 Ga0157370_10048370 3300013104 Bacteria 4074
296 Ga0157370_10054080 3300013104 Bacteria 3827
297 Ga0157369_10002034 3300013105 Bacteria 24368
298 Ga0157369_10035028 3300013105 Bacteria 5505
299 Ga0157369_10047306 3300013105 Bacteria 4672
300 Ga0157369_10461271 3300013105 Bacteria 1315
301 Ga0157369_10651321 3300013105 Bacteria 1086
302 Ga0157374_10775479 3300013296 Bacteria 974
303 Ga0157378_10007423 3300013297 Bacteria 9576
304 Ga0157378_10168760 3300013297 Bacteria 2051
305 Ga0163162_10022111 3300013306 Bacteria 6267
306 Ga0163162_10075184 3300013306 Bacteria 3438
307 Ga0163162_10234721 3300013306 Bacteria 1965
308 Ga0163162_11321651 3300013306 Bacteria 819
309 Ga0157372_10008694 3300013307 Bacteria 10782
310 Ga0157372_10036497 3300013307 Bacteria 5417
311 Ga0157372_10275895 3300013307 Bacteria 1954
312 Ga0157372_11386057 3300013307 Unclassified 811
313 Ga0157375_10040957 3300013308 Bacteria 4469
314 Ga0157375_10564883 3300013308 Bacteria 1299
315 Ga0157375_11336136 3300013308 Bacteria 843
316 Ga0163163_10000139 3300014325 Bacteria 75197
317 Ga0163163_10000187 3300014325 Bacteria 63661
318 Ga0157380_11666312 3300014326 Bacteria 695
319 Ga0182008_10230927 3300014497 Bacteria 949
320 Ga0157377_10020172 3300014745 Bacteria 3489
321 Ga0157377_10058180 3300014745 Bacteria 2200
322 Ga0157379_10373140 3300014968 Bacteria 1308
323 Ga0157379_11325617 3300014968 Bacteria 696
324 Ga0157376_11075932 3300014969 Unclassified 829
325 Ga0206356_10167397 3300020070 Unclassified 1498
326 Ga0206354_10600300 3300020081 Bacteria 2046
327 Ga0206354_10859774 3300020081 Bacteria 1066
328 Ga0206353_10137413 3300020082 Bacteria 5109
329 Ga0207697_10000461 3300025315 Bacteria 22887
330 Ga0207697_10004406 3300025315 Bacteria 6730
331 Ga0207656_10072929 3300025321 Unclassified 1529
332 Ga0207682_10044064 3300025893 Bacteria 1828
333 Ga0207642_10067709 3300025899 Bacteria 1686
334 Ga0207710_10144734 3300025900 Bacteria 1149
335 Ga0207688_10000063 3300025901 Bacteria 38711
336 Ga0207688_10012303 3300025901 Bacteria 4656
337 Ga0207688_10053736 3300025901 Bacteria 2259
338 Ga0207688_10054832 3300025901 Bacteria 2237
339 Ga0207680_10045079 3300025903 Bacteria 2598
340 Ga0207647_10000227 3300025904 Bacteria 46631
341 Ga0207647_10003088 3300025904 Bacteria 12521
342 Ga0207647_10042978 3300025904 Bacteria 2831
343 Ga0207647_10090138 3300025904 Bacteria 1830
344 Ga0207645_10009859 3300025907 Bacteria 6583
345 Ga0207645_10020369 3300025907 Bacteria 4342
346 Ga0207645_10092658 3300025907 Bacteria 1943
347 Ga0207645_10125101 3300025907 Unclassified 1671
348 Ga0207645_10916698 3300025907 Bacteria 595
349 Ga0207643_10788414 3300025908 Bacteria 615
350 Ga0207643_10983590 3300025908 Bacteria 546
351 Ga0207705_10004232 3300025909 Bacteria 10869
352 Ga0207705_10009263 3300025909 Bacteria 7161
353 Ga0207705_10015777 3300025909 Bacteria 5425
354 Ga0207705_10020472 3300025909 Bacteria 4726
355 Ga0207705_10038949 3300025909 Bacteria 3406
356 Ga0207705_10383505 3300025909 Bacteria 1086
357 Ga0207654_10054710 3300025911 Bacteria 2307
358 Ga0207707_10015803 3300025912 Bacteria 6581
359 Ga0207707_10026972 3300025912 Bacteria 5021
360 Ga0207707_10108020 3300025912 Bacteria 2432
361 Ga0207695_10023406 3300025913 Bacteria 6979
362 Ga0207695_10076129 3300025913 Bacteria 3412
363 Ga0207671_10077829 3300025914 Bacteria 2483
364 Ga0207660_10001690 3300025917 Bacteria 14788
365 Ga0207660_10007977 3300025917 Bacteria 6844
366 Ga0207660_10044149 3300025917 Bacteria 3135
367 Ga0207660_10213703 3300025917 Bacteria 1511
368 Ga0207657_10002137 3300025919 Bacteria 21415
369 Ga0207657_10003245 3300025919 Bacteria 17415
370 Ga0207657_10008835 3300025919 Bacteria 10192
371 Ga0207657_10012153 3300025919 Bacteria 8507
372 Ga0207657_10047615 3300025919 Bacteria 3747
373 Ga0207657_10123219 3300025919 Bacteria 2131
374 Ga0207657_10248781 3300025919 Unclassified 1418
375 Ga0207649_10001548 3300025920 Bacteria 13488
376 Ga0207649_10015721 3300025920 Bacteria 4253
377 Ga0207649_10027640 3300025920 Bacteria 3332
378 Ga0207649_10034463 3300025920 Bacteria 3033
379 Ga0207649_10080521 3300025920 Bacteria 2107
380 Ga0207649_10483699 3300025920 Bacteria 939
381 Ga0207652_10024826 3300025921 Bacteria 4974
382 Ga0207652_10028006 3300025921 Bacteria 4698
383 Ga0207652_10184151 3300025921 Bacteria 1878
384 Ga0207681_10012969 3300025923 Bacteria 5151
385 Ga0207681_10018505 3300025923 Bacteria 4389
386 Ga0207681_10020914 3300025923 Bacteria 4153
387 Ga0207681_10080967 3300025923 Bacteria 2291
388 Ga0207681_10189471 3300025923 Bacteria 1572
389 Ga0207681_10270618 3300025923 Bacteria 1333
390 Ga0207694_10014131 3300025924 Bacteria 6019
391 Ga0207694_10037467 3300025924 Bacteria 3725
392 Ga0207687_10003689 3300025927 Bacteria 10311
393 Ga0207687_10232898 3300025927 Bacteria 1456
394 Ga0207644_10019203 3300025931 Bacteria 4634
395 Ga0207644_10026614 3300025931 Bacteria 3987
396 Ga0207644_10290188 3300025931 Bacteria 1315
397 Ga0207644_10748554 3300025931 Bacteria 816
398 Ga0207690_10006255 3300025932 Bacteria 7051
399 Ga0207690_10017677 3300025932 Bacteria 4360
400 Ga0207690_10024623 3300025932 Bacteria 3771
401 Ga0207690_10051232 3300025932 Bacteria 2760
402 Ga0207690_10053454 3300025932 Bacteria 2710
403 Ga0207690_10089215 3300025932 Bacteria 2173
404 Ga0207690_10096115 3300025932 Bacteria 2106
405 Ga0207690_10136904 3300025932 Bacteria 1799
406 Ga0207690_10254579 3300025932 Unclassified 1358
407 Ga0207690_10320632 3300025932 Bacteria 1218
408 Ga0207706_10002393 3300025933 Bacteria 18312
409 Ga0207706_10002814 3300025933 Bacteria 16888
410 Ga0207706_10009958 3300025933 Bacteria 8711
411 Ga0207706_10049613 3300025933 Bacteria 3709
412 Ga0207706_10068642 3300025933 Bacteria 3118
413 Ga0207706_10072375 3300025933 Bacteria 3032
414 Ga0207706_10094862 3300025933 Bacteria 2625
415 Ga0207706_10352522 3300025933 Unclassified 1279
416 Ga0207686_10392038 3300025934 Unclassified 1056
417 Ga0207709_10082236 3300025935 Bacteria 2079
418 Ga0207709_11487508 3300025935 Bacteria 562
419 Ga0207670_10482960 3300025936 Bacteria 1004
420 Ga0207669_10015845 3300025937 Bacteria 3813
421 Ga0207669_10318408 3300025937 Bacteria 1189
422 Ga0207704_10084370 3300025938 Bacteria 2064
423 Ga0207704_10086033 3300025938 Bacteria 2049
424 Ga0207691_10000447 3300025940 Bacteria 40805
425 Ga0207691_10044505 3300025940 Bacteria 4086
426 Ga0207711_10000258 3300025941 Bacteria 57473
427 Ga0207711_10001621 3300025941 Bacteria 20768
428 Ga0207711_10001739 3300025941 Bacteria 19976
429 Ga0207711_10004550 3300025941 Bacteria 11798
430 Ga0207711_10162439 3300025941 Bacteria 2023
431 Ga0207689_10001047 3300025942 Bacteria 26563
432 Ga0207689_10024317 3300025942 Bacteria 5084
433 Ga0207689_10028026 3300025942 Bacteria 4712
434 Ga0207689_10039645 3300025942 Bacteria 3899
435 Ga0207689_10542198 3300025942 Bacteria 977
436 Ga0207661_10163499 3300025944 Bacteria 1932
437 Ga0207661_10467180 3300025944 Bacteria 1151
438 Ga0207679_10028104 3300025945 Bacteria 3898
439 Ga0207679_10031750 3300025945 Bacteria 3700
440 Ga0207679_10095214 3300025945 Bacteria 2314
441 Ga0207679_10149429 3300025945 Bacteria 1899
442 Ga0207679_10326738 3300025945 Bacteria 1330
443 Ga0207679_10386987 3300025945 Bacteria 1227
444 Ga0207679_10605830 3300025945 Bacteria 987
445 Ga0207679_11630047 3300025945 Bacteria 591
446 Ga0207667_10013030 3300025949 Bacteria 9544
447 Ga0207667_10046456 3300025949 Bacteria 4598
448 Ga0207667_10075191 3300025949 Bacteria 3508
449 Ga0207667_10137569 3300025949 Bacteria 2515
450 Ga0207667_10149293 3300025949 Bacteria 2406
451 Ga0207667_10476181 3300025949 Bacteria 1268
452 Ga0207651_10008150 3300025960 Bacteria 5638
453 Ga0207651_10031999 3300025960 Bacteria 3371
454 Ga0207651_10044445 3300025960 Bacteria 2973
455 Ga0207651_10149034 3300025960 Bacteria 1818
456 Ga0207668_10001204 3300025972 Bacteria 15359
457 Ga0207668_10021749 3300025972 Bacteria 4094
458 Ga0207668_10091865 3300025972 Bacteria 2232
459 Ga0207668_10434240 3300025972 Bacteria 1117
460 Ga0207668_11341908 3300025972 Bacteria 644
461 Ga0207640_10003003 3300025981 Bacteria 9075
462 Ga0207640_10008369 3300025981 Bacteria 5748
463 Ga0207640_10014529 3300025981 Bacteria 4536
464 Ga0207658_10010721 3300025986 Bacteria 6231
465 Ga0207658_10349833 3300025986 Bacteria 1286
466 Ga0207658_11700162 3300025986 Bacteria 576
467 Ga0207677_10004522 3300026023 Bacteria 7480
468 Ga0207677_10117697 3300026023 Bacteria 1992
469 Ga0207677_10232790 3300026023 Bacteria 1485
470 Ga0207703_10002385 3300026035 Bacteria 16335
471 Ga0207703_10012883 3300026035 Bacteria 6521
472 Ga0207703_10256339 3300026035 Bacteria 1579
473 Ga0207703_10445710 3300026035 Bacteria 1208
474 Ga0207639_10002841 3300026041 Bacteria 11622
475 Ga0207639_10008347 3300026041 Bacteria 7099
476 Ga0207639_10024197 3300026041 Bacteria 4391
477 Ga0207639_10051493 3300026041 Bacteria 3132
478 Ga0207639_10150952 3300026041 Bacteria 1946
479 Ga0207678_10002287 3300026067 Bacteria 17343
480 Ga0207678_10011714 3300026067 Bacteria 7696
481 Ga0207678_10318949 3300026067 Bacteria 1337
482 Ga0207678_10423963 3300026067 Unclassified 1154
483 Ga0207678_10468845 3300026067 Bacteria 1096
484 Ga0207678_10491457 3300026067 Bacteria 1069
485 Ga0207678_10812083 3300026067 Unclassified 826
486 Ga0207678_11110825 3300026067 Bacteria 700
487 Ga0207678_11412988 3300026067 Bacteria 615
488 Ga0207702_10033876 3300026078 Bacteria 4268
489 Ga0207702_10239868 3300026078 Bacteria 1698
490 Ga0207702_10856271 3300026078 Unclassified 900
491 Ga0207641_10000621 3300026088 Bacteria 38687
492 Ga0207641_10013785 3300026088 Bacteria 6629
493 Ga0207641_10128473 3300026088 Bacteria 2272
494 Ga0207641_10132511 3300026088 Bacteria 2239
495 Ga0207641_10135879 3300026088 Bacteria 2213
496 Ga0207641_10280072 3300026088 Bacteria 1568
497 Ga0207648_10001177 3300026089 Bacteria 29264
498 Ga0207648_10010576 3300026089 Bacteria 8730
499 Ga0207648_10082790 3300026089 Bacteria 2798
500 Ga0207648_10257095 3300026089 Bacteria 1558
501 Ga0207648_11995567 3300026089 Bacteria 541
502 Ga0207676_10003397 3300026095 Bacteria 11248
503 Ga0207676_10004545 3300026095 Bacteria 9820
504 Ga0207676_10007577 3300026095 Bacteria 7702
505 Ga0207676_10408779 3300026095 Bacteria 1270
506 Ga0207674_10001201 3300026116 Bacteria 33701
507 Ga0207674_10004331 3300026116 Bacteria 17119
508 Ga0207674_10007432 3300026116 Bacteria 12769
509 Ga0207674_10022616 3300026116 Bacteria 6747
510 Ga0207674_10028041 3300026116 Bacteria 5950
511 Ga0207674_10029023 3300026116 Bacteria 5831
512 Ga0207674_10340331 3300026116 Bacteria 1450
513 Ga0207675_100025062 3300026118 Bacteria 5551
514 Ga0207675_100088882 3300026118 Bacteria 2902
515 Ga0207675_100113772 3300026118 Bacteria 2555
516 Ga0207675_100787496 3300026118 Bacteria 963
517 Ga0207683_10039638 3300026121 Bacteria 4110
518 Ga0207698_10001817 3300026142 Bacteria 12468
519 Ga0207698_10002511 3300026142 Bacteria 10880
520 Ga0207698_10003933 3300026142 Bacteria 8998
521 Ga0207698_10010461 3300026142 Bacteria 5963
522 Ga0207698_10057313 3300026142 Bacteria 3013
523 Ga0207698_10076400 3300026142 Bacteria 2681
524 Ga0207698_10104327 3300026142 Bacteria 2358
525 Ga0207698_10210416 3300026142 Bacteria 1749
526 Ga0207698_10713491 3300026142 Bacteria 999
527 Ga0209813_10000027 3300027866 Bacteria 69637
528 Ga0268266_10002361 3300028379 Bacteria 20409
529 Ga0268266_10096415 3300028379 Bacteria 2599
530 Ga0268266_10107292 3300028379 Bacteria 2469
531 Ga0268266_10169599 3300028379 Bacteria 1980
532 Ga0268265_10002831 3300028380 Bacteria 12756
533 Ga0268265_10004187 3300028380 Bacteria 10096
534 Ga0268265_10005424 3300028380 Bacteria 8724
535 Ga0268265_10154473 3300028380 Bacteria 1940
536 Ga0268265_10215330 3300028380 Bacteria 1677
537 Ga0268265_10738975 3300028380 Bacteria 954
538 Ga0268264_10006616 3300028381 Bacteria 9747
539 Ga0268264_10007537 3300028381 Bacteria 9079
540 Ga0268264_10013078 3300028381 Bacteria 6823
541 Ga0268264_10099468 3300028381 Bacteria 2524
542 Ga0268264_10270592 3300028381 Bacteria 1587
543 Ga0268264_11105335 3300028381 Bacteria 801
544 Ga0316182_1226341 3300030745 Bacteria 954
545 Ga0307408_100717433 3300031548 Bacteria 900
546 Ga0307405_10067257 3300031731 Bacteria 2288
547 Ga0307413_10080226 3300031824 Bacteria 2089
548 Ga0307413_10133996 3300031824 Bacteria 1700
549 Ga0307413_10277660 3300031824 Bacteria 1258
550 Ga0307413_11004373 3300031824 Bacteria 715
551 Ga0307410_10169564 3300031852 Bacteria 1643
552 Ga0307410_11073958 3300031852 Bacteria 697
553 Ga0307406_10030019 3300031901 Bacteria 3296
554 Ga0307407_10045317 3300031903 Bacteria 2484
555 Ga0307412_10602319 3300031911 Bacteria 931
556 Ga0307412_11456970 3300031911 Bacteria 621
557 Ga0307409_100056457 3300031995 Bacteria 3036
558 Ga0307409_101135112 3300031995 Bacteria 803
559 Ga0307416_100036781 3300032002 Bacteria 3759
560 Ga0307414_10130841 3300032004 Bacteria 1948
561 Ga0307414_10212160 3300032004 Bacteria 1583
562 Ga0307414_10373564 3300032004 Bacteria 1230
563 Ga0307411_10016541 3300032005 Bacteria 4176
564 Ga0307411_10245639 3300032005 Bacteria 1404
565 Ga0307411_10506935 3300032005 Bacteria 1021
566 Ga0307415_100069168 3300032126 Bacteria 2474
567 Ga0307415_100298433 3300032126 Bacteria 1333
568 Ga0373958_0126356 3300034819 Bacteria 622
569 Ga0373949_0304188 3300035090 Bacteria 507
570 Ga0373951_0039767 3300035091 Bacteria 1131
571 Ga0373952_0007088 3300035092 Bacteria 2093
572 Ga0373960_0124901 3300035121 Bacteria 857
573 Ga0373961_0016425 3300035241 Bacteria 1907
574 Ga0373962_0023443 3300035242 Bacteria 1644
575 Ga0373931_0001553 3300035691 Bacteria 9906
576 Ga0395899_0000820 3300037312 Bacteria 30249
577 Ga0395899_0005996 3300037312 Bacteria 9441
578 Ga0395899_0055200 3300037312 Bacteria 2939
579 Ga0395899_0232674 3300037312 Bacteria 1271
580 Ga0395900_0000192 3300037418 Bacteria 98186
581 Ga0395900_0061249 3300037418 Bacteria 3869
582 Ga0395900_0125796 3300037418 Bacteria 2629
583 Ga0395900_0211268 3300037418 Bacteria 1959
584 Ga0395900_0284468 3300037418 Bacteria 1644
585 Ga0395900_0646162 3300037418 Bacteria 995
586 Ga0395900_0759961 3300037418 Bacteria 899
587 Ga0395898_0000055 3300037466 Bacteria 278557
588 Ga0395898_0170362 3300037466 Bacteria 2081
589 Ga0395898_0304395 3300037466 Bacteria 1520
590 Ga0395898_0382433 3300037466 Bacteria 1342
591 Ga0395898_0433077 3300037466 Bacteria 1253
592 Ga0395905_0000067 3300037471 Bacteria 181887
593 Ga0395905_0068409 3300037471 Bacteria 3326
594 Ga0395905_0114626 3300037471 Bacteria 2532
595 Ga0395905_0193377 3300037471 Bacteria 1908
596 Ga0395905_0209738 3300037471 Bacteria 1825
597 Ga0395905_0222496 3300037471 Bacteria 1766
598 Ga0395905_0222984 3300037471 Bacteria 1764
599 Ga0395905_0254340 3300037471 Bacteria 1641
600 Ga0395905_0404255 3300037471 Bacteria 1260
601 Ga0395905_0496439 3300037471 Bacteria 1120
602 Ga0395905_0536613 3300037471 Bacteria 1071
603 Ga0395905_0826874 3300037471 Bacteria 829
604 Ga0395905_0990370 3300037471 Bacteria 744
605 Ga0395905_1295838 3300037471 Bacteria 632
606 Ga0395901_0001001 3300038443 Bacteria 30549
607 Ga0395901_0003575 3300038443 Bacteria 15679
608 Ga0395901_0046420 3300038443 Bacteria 4512
609 Ga0395901_0104636 3300038443 Bacteria 2970
610 Ga0395901_0125192 3300038443 Bacteria 2700
611 Ga0395901_0336324 3300038443 Bacteria 1560
612 Ga0395901_1345251 3300038443 Bacteria 674
613 Ga0436365_0921885 3300039437 Bacteria 1674
614 Ga0439446_0189387 3300042156 Bacteria 691
615 Ga0439464_0001072 3300042439 Bacteria 6283
616 Ga0466969_0029957 3300044656 Bacteria 2775
617 Ga0466972_0154403 3300044658 Bacteria 1078
618 Ga0466972_0175979 3300044658 Bacteria 1004
619 Ga0466966_0052554 3300044684 Bacteria 2587
620 Ga0466961_0339762 3300044693 Bacteria 914
621 Ga0466963_0001535 3300044694 Bacteria 12521
622 Ga0466963_0009623 3300044694 Bacteria 5825
623 Ga0466963_0099262 3300044694 Bacteria 1991
624 Ga0466963_0332761 3300044694 Bacteria 1069
625 Ga0466964_0116317 3300044706 Bacteria 1199
626 Ga0466964_0230208 3300044706 Bacteria 904
627 Ga0466971_0011736 3300044719 Bacteria 3837
628 Ga0466971_0565662 3300044719 Bacteria 565
629 Ga0466970_0046717 3300044765 Bacteria 2306
630 Ga0466970_0302043 3300044765 Bacteria 903
631 Ga0466957_0003303 3300044842 Bacteria 8830
632 Ga0466957_0045360 3300044842 Bacteria 2666
633 Ga0466957_0051081 3300044842 Bacteria 2516
634 Ga0466960_0029873 3300044901 Bacteria 2504
635 Ga0466960_0183773 3300044901 Bacteria 1134
636 Ga0466958_0151961 3300045836 Bacteria 1460
637 Ga0466967_0000100 3300045976 Bacteria 31122
638 Ga0466967_0001609 3300045976 Bacteria 13321
639 Ga0466967_0031149 3300045976 Bacteria 4487
640 Ga0466967_0045626 3300045976 Bacteria 3809
641 Ga0466967_0048139 3300045976 Bacteria 3721
642 Ga0466967_0081702 3300045976 Bacteria 2919
643 Ga0466967_0247849 3300045976 Bacteria 1701
644 Ga0466967_0408997 3300045976 Bacteria 1321
645 Ga0466967_0436959 3300045976 Bacteria 1277
646 Ga0466967_0576245 3300045976 Bacteria 1109
647 Ga0466967_0580968 3300045976 Bacteria 1105
648 Ga0466967_1137607 3300045976 Bacteria 778
649 Ga0495584_0069944 3300046491 Bacteria 1764
650 Ga0495663_0111766 3300046525 Unclassified 908
651 Ga0495642_0072095 3300046528 Bacteria 1446
652 Ga0495642_0194739 3300046528 Bacteria 883
653 Ga0495625_0411413 3300046660 Bacteria 843
654 Ga0495659_0067174 3300046664 Bacteria 1337
655 Ga0495669_0004734 3300046684 Bacteria 5645
656 Ga0495669_0114662 3300046684 Unclassified 1260
657 Ga0495677_0371768 3300047445 Unclassified 565
658 Ga0496100_0041775 3300048903 Bacteria 2925
659 Ga0496100_0451025 3300048903 Bacteria 986
660 Ga0496101_0321238 3300048904 Bacteria 1214
661 Ga0496105_0643532 3300048908 Unclassified 819
662 Ga0496106_0021614 3300048909 Bacteria 4777
663 Ga0496107_0223317 3300048910 Bacteria 1401
664 Ga0496108_0035800 3300048911 Bacteria 4128
665 Ga0496109_0064325 3300048912 Bacteria 3356
666 Ga0496109_0269498 3300048912 Bacteria 1604
667 Ga0496110_0018451 3300048913 Bacteria 5851
668 Ga0496110_0147841 3300048913 Unclassified 2126
669 Ga0496111_0084697 3300048914 Unclassified 2317
670 Ga0496111_0266161 3300048914 Bacteria 1272
671 Ga0496112_0015898 3300048915 Bacteria 7033
672 Ga0496113_0032420 3300048916 Bacteria 3798
673 Ga0496113_1415133 3300048916 Bacteria 538
674 Ga0496116_0000149 3300048919 Bacteria 141841
675 Ga0496116_0052646 3300048919 Bacteria 2695
676 Ga0496117_0022024 3300048920 Bacteria 5125
677 Ga0496117_0031047 3300048920 Bacteria 4087
678 Ga0496118_0015986 3300048921 Bacteria 6911
679 Ga0496118_0085631 3300048921 Bacteria 2193
680 Ga0496121_0001586 3300048924 Bacteria 37825
681 Ga0496121_0016397 3300048924 Bacteria 7654
682 Ga0496123_0011597 3300048926 Bacteria 7619
683 Ga0496124_0066468 3300048927 Bacteria 3002
684 Ga0496124_0282400 3300048927 Bacteria 1209
685 Ga0496124_0393428 3300048927 Bacteria 964
686 Ga0496124_0402623 3300048927 Bacteria 949
687 Ga0496124_0449201 3300048927 Bacteria 879
688 Ga0496125_0121118 3300048928 Bacteria 1866
689 Ga0496125_0458142 3300048928 Bacteria 728
690 Ga0496126_0000261 3300048929 Bacteria 112027
691 Ga0501067_0006187 3300049583 Bacteria 6637
692 Ga0501067_0469171 3300049583 Bacteria 703
693 Ga0501068_0076295 3300049584 Bacteria 2051
694 nmdc:mga03683_2498_c1 3300050489 Bacteria 5722
695 nmdc:mga03n38_9632_c1 3300050490 Bacteria 3522
696 nmdc:mga00v17_9217_c1 3300050491 Bacteria 5333
697 nmdc:mga0yw44_85715_c1 3300050492 Bacteria 1983
698 nmdc:mga0k408_17147_c1 3300050493 Bacteria 4031
699 nmdc:mga0k408_272306_c1 3300050493 Bacteria 1011
700 nmdc:mga06z11_824_c1 3300050494 Bacteria 11347
701 nmdc:mga04h51_48_c1 3300050495 Bacteria 38959
702 nmdc:mga07m45_211_c1 3300050496 Bacteria 23070
703 nmdc:mga08y16_287493_c1 3300050511 Bacteria 1695
704 nmdc:mga0rr50_211609_c1 3300050513 Bacteria 1597
705 nmdc:mga0rr50_472048_c1 3300050513 Bacteria 1065
706 nmdc:mga0a205_62891_c1 3300050515 Bacteria 3586
707 nmdc:mga0sz30_55_c1 3300050516 Bacteria 42452
708 Ga0500607_026523 3300053121 Bacteria 3220
709 Ga0466962_0037732 3300061719 Bacteria 2314
710 Ga0068853_100444102
711 JGI24741J21665_1001190
712 JGI24747J21853_1001204
713 JGI24740J21852_10021129
714 JGI24739J22299_10001986
715 JGI24737J22298_10001142
716 JGI24735J21928_10008736
717 JGI24735J21928_10017080
718 JGI24738J21930_10001221
719 Ga0070658_10017631
720 Ga0070658_10021372
721 Ga0070658_10077136
722 Ga0070658_10092947
723 Ga0070658_10116471
724 Ga0070658_10171532
725 Ga0070658_10199298
726 Ga0070658_10211679
727 Ga0070658_10790353
728 Ga0070658_11242161
729 Ga0070676_10008273
730 Ga0070676_10020742
731 Ga0070676_10128776
732 Ga0070676_10129193
733 Ga0070683_100049425
734 Ga0070683_100060298
735 Ga0070690_100031336
736 Ga0070690_101306190
737 Ga0070677_10004122
738 Ga0070677_10047120
739 Ga0068869_100001204
740 Ga0068869_100034373
741 Ga0068869_100048277
742 Ga0068869_100217301
743 Ga0070666_10000175
744 Ga0070666_10059542
745 Ga0070680_100000197
746 Ga0070680_100058606
747 Ga0070680_100174746
748 Ga0070682_100325723
749 Ga0068868_100008744
750 Ga0070660_100002605
751 Ga0070660_100006738
752 Ga0070660_100010434
753 Ga0070660_100017678
754 Ga0070660_100029310
755 Ga0070660_100105220
756 Ga0070660_100194333
757 Ga0070660_100260407
758 Ga0070660_100496689
759 Ga0070660_100620346
760 Ga0070689_100402430
761 Ga0070691_10078781
762 Ga0070661_100004129
763 Ga0070661_100006179
764 Ga0070661_100074586
765 Ga0070661_100078669
766 Ga0070661_100112810
767 Ga0070661_100304353
768 Ga0070661_100544663
769 Ga0070661_100682610
770 Ga0070692_10005132
771 Ga0070692_10017094
772 Ga0070668_100003013
773 Ga0070668_100028225
774 Ga0070668_101177291
775 Ga0070669_100000586
776 Ga0070669_100062099
777 Ga0070669_100087092
778 Ga0070669_100224449
779 Ga0070675_100042818
780 Ga0070671_100019486
781 Ga0070671_100067691
782 Ga0070671_100585952
783 Ga0070671_101004556
784 Ga0070674_100006182
785 Ga0070673_100002689
786 Ga0070673_100005010
787 Ga0070673_100013723
788 Ga0070673_100133059
789 Ga0070673_100136474
790 Ga0070659_100001641
791 Ga0070659_100024042
792 Ga0070659_100051572
793 Ga0070659_100080812
794 Ga0070659_100091613
795 Ga0070659_100099657
796 Ga0070659_100131229
797 Ga0070659_100178192
798 Ga0070659_100257540
799 Ga0070659_100314582
800 Ga0070659_100360929
801 Ga0070659_100368375
802 Ga0070667_100003196
803 Ga0070667_101298569
804 Ga0070701_10412474
805 Ga0070705_100530109
806 Ga0070663_100024805
807 Ga0070663_100027273
808 Ga0070663_100603668
809 Ga0070663_100755308
810 Ga0070663_100802757
811 Ga0070663_100883115
812 Ga0070662_100002851
813 Ga0070662_100002999
814 Ga0070662_100005622
815 Ga0070662_100006598
816 Ga0070662_100051215
817 Ga0070662_100327208
818 Ga0070681_10003859
819 Ga0070681_10083594
820 Ga0070681_10131832
821 Ga0070681_10134891
822 Ga0070681_11435593
823 Ga0068867_100001360
824 Ga0068867_100052811
825 Ga0068867_100216397
826 Ga0070679_100036499
827 Ga0070679_100186597
828 Ga0070679_100294236
829 Ga0070679_101485342
830 Ga0070684_100041428
831 Ga0070684_100067146
832 Ga0068853_100002189
833 Ga0068853_100014666
834 Ga0068853_100061747
835 Ga0068853_100218562
836 Ga0068853_100323642
837 Ga0068853_101135217
838 Ga0068853_101153810
839 Ga0068853_101553185
840 Ga0070672_100001067
841 Ga0070672_100078686
842 Ga0070672_100098914
843 Ga0070672_100176737
844 Ga0070672_100275654
845 Ga0070686_100322114
846 Ga0070696_100005040
847 Ga0070696_100119712
848 Ga0070696_100495282
849 Ga0070693_100178519
850 Ga0070693_100303574
851 Ga0070693_100329721
852 Ga0070665_100001939
853 Ga0070665_100074258
854 Ga0070665_100322700
855 Ga0070665_100484472
856 Ga0070665_100503439
857 Ga0068855_100002788
858 Ga0068855_100006176
859 Ga0068855_100057239
860 Ga0068855_100079701
861 Ga0068855_100591580
862 Ga0070664_100004161
863 Ga0070664_100019879
864 Ga0070664_100038219
865 Ga0070664_100061767
866 Ga0070664_100119694
867 Ga0070664_100126821
868 Ga0070664_100725154
869 Ga0070664_101355199
870 Ga0068857_100000338
871 Ga0068857_100016516
872 Ga0068857_100049085
873 Ga0068857_100197026
874 Ga0068857_100515326
875 Ga0068854_100003108
876 Ga0068854_100016378
877 Ga0068854_100020745
878 Ga0068854_100020959
879 Ga0068854_100170890
880 Ga0068854_100425710
881 Ga0068854_100923078
882 Ga0068856_100106737
883 Ga0068856_100266925
884 Ga0068856_100316184
885 Ga0068856_100949826
886 Ga0068852_100000335
887 Ga0068852_100001883
888 Ga0068852_100026751
889 Ga0068852_100038128
890 Ga0068852_100046139
891 Ga0068852_100048513
892 Ga0068852_100121895
893 Ga0068852_100198753
894 Ga0068852_100353871
895 Ga0068852_100625658
896 Ga0068852_101006510
897 Ga0068859_100000464
898 Ga0068859_100006502
899 Ga0068859_100064789
900 Ga0068859_100073920
901 Ga0068864_100001187
902 Ga0068864_100003779
903 Ga0068864_100010362
904 Ga0068864_100457566
905 Ga0068866_10031388
906 Ga0068866_10336468
907 Ga0068861_100037371
908 Ga0068861_100120211
909 Ga0068851_10028162
910 Ga0068851_10098632
911 Ga0068870_10147950
912 Ga0068870_10382949
913 Ga0068870_10929263
914 Ga0068863_100004975
915 Ga0068863_100007450
916 Ga0068863_100049793
917 Ga0068863_100050771
918 Ga0068863_100142195
919 Ga0068858_100008523
920 Ga0068858_100009768
921 Ga0068858_100028517
922 Ga0068858_100059866
923 Ga0068858_100767013
924 Ga0068860_100004974
925 Ga0068860_100008094
926 Ga0068860_100009092
927 Ga0068860_100155529
928 Ga0068860_100158731
929 Ga0068860_100571860
930 Ga0068862_100001250
931 Ga0068862_100035570
932 Ga0068862_100118485
933 Ga0068862_100759683
934 Ga0075368_10000064
935 Ga0075363_100001102
936 Ga0075364_10033605
937 Ga0075362_10004003
938 Ga0075367_10002036
939 Ga0075369_10004485
940 Ga0075366_10002117
941 Ga0097621_100219468
942 Ga0097621_101517291
943 Ga0075370_10104787
944 Ga0068871_100031738
945 Ga0068871_100342734
946 Ga0075433_10140138
947 Ga0075434_100259265
948 Ga0068865_100010731
949 Ga0068865_100100709
950 Ga0068865_100145241
951 Ga0068865_100202007
952 Ga0097620_100000464
953 Ga0097620_100006502
954 Ga0097620_100064791
955 Ga0097620_100073918
956 Ga0105251_10001250
957 Ga0105250_10005567
958 Ga0105240_10050522
959 Ga0105240_10076519
960 Ga0111539_10297835
961 Ga0105245_10000128
962 Ga0105245_10154113
963 Ga0105247_10176916
964 Ga0105247_10243827
965 Ga0105247_10282335
966 Ga0105243_10137854
967 Ga0105241_10011856
968 Ga0105241_10033902
969 Ga0105241_10083224
970 Ga0105242_10405407
971 Ga0105248_10000787
972 Ga0105248_10001529
973 Ga0105248_10013511
974 Ga0105248_10018199
975 Ga0105248_10018309
976 Ga0105248_10035216
977 Ga0105248_10044913
978 Ga0105248_10605093
979 Ga0105248_11318720
980 Ga0105237_10035733
981 Ga0105237_10211935
982 Ga0105238_10012788
983 Ga0105238_10019525
984 Ga0105238_10084096
985 Ga0105238_10159997
986 Ga0105238_10175459
987 Ga0105249_10239906
988 Ga0105239_10065114
989 Ga0105246_10036675
990 Ga0105246_10117371
991 Ga0157373_10014869
992 Ga0157373_10016966
993 Ga0157373_10033090
994 Ga0157373_10040381
995 Ga0157373_10180436
996 Ga0157373_10290247
997 Ga0157373_11059331
998 Ga0157371_10004039
999 Ga0157371_10007577
1000 Ga0157371_10017242
1001 Ga0157371_10023947
1002 Ga0157371_10025055
1003 Ga0157370_10019454
1004 Ga0157370_10048370
1005 Ga0157370_10054080
1006 Ga0157369_10002034
1007 Ga0157369_10035028
1008 Ga0157369_10047306
1009 Ga0157369_10461271
1010 Ga0157369_10651321
1011 Ga0157374_10775479
1012 Ga0157378_10007423
1013 Ga0157378_10168760
1014 Ga0163162_10022111
1015 Ga0163162_10075184
1016 Ga0163162_10234721
1017 Ga0163162_11321651
1018 Ga0157372_10008694
1019 Ga0157372_10036497
1020 Ga0157372_10275895
1021 Ga0157372_11386057
1022 Ga0157375_10040957
1023 Ga0157375_10564883
1024 Ga0157375_11336136
1025 Ga0163163_10000139
1026 Ga0163163_10000187
1027 Ga0157380_11666312
1028 Ga0182008_10230927
1029 Ga0157377_10020172
1030 Ga0157377_10058180
1031 Ga0157379_10373140
1032 Ga0157379_11325617
1033 Ga0157376_11075932
1034 Ga0206356_10167397
1035 Ga0206354_10600300
1036 Ga0206354_10859774
1037 Ga0206353_10137413
1038 Ga0207697_10000461
1039 Ga0207697_10004406
1040 Ga0207656_10072929
1041 Ga0207682_10044064
1042 Ga0207642_10067709
1043 Ga0207710_10144734
1044 Ga0207688_10000063
1045 Ga0207688_10012303
1046 Ga0207688_10053736
1047 Ga0207688_10054832
1048 Ga0207680_10045079
1049 Ga0207647_10000227
1050 Ga0207647_10003088
1051 Ga0207647_10042978
1052 Ga0207647_10090138
1053 Ga0207645_10009859
1054 Ga0207645_10020369
1055 Ga0207645_10092658
1056 Ga0207645_10125101
1057 Ga0207645_10916698
1058 Ga0207643_10788414
1059 Ga0207643_10983590
1060 Ga0207705_10004232
1061 Ga0207705_10009263
1062 Ga0207705_10015777
1063 Ga0207705_10020472
1064 Ga0207705_10038949
1065 Ga0207705_10383505
1066 Ga0207654_10054710
1067 Ga0207707_10015803
1068 Ga0207707_10026972
1069 Ga0207707_10108020
1070 Ga0207695_10023406
1071 Ga0207695_10076129
1072 Ga0207671_10077829
1073 Ga0207660_10001690
1074 Ga0207660_10007977
1075 Ga0207660_10044149
1076 Ga0207660_10213703
1077 Ga0207657_10002137
1078 Ga0207657_10003245
1079 Ga0207657_10008835
1080 Ga0207657_10012153
1081 Ga0207657_10047615
1082 Ga0207657_10123219
1083 Ga0207657_10248781
1084 Ga0207649_10001548
1085 Ga0207649_10015721
1086 Ga0207649_10027640
1087 Ga0207649_10034463
1088 Ga0207649_10080521
1089 Ga0207649_10483699
1090 Ga0207652_10024826
1091 Ga0207652_10028006
1092 Ga0207652_10184151
1093 Ga0207681_10012969
1094 Ga0207681_10018505
1095 Ga0207681_10020914
1096 Ga0207681_10080967
1097 Ga0207681_10189471
1098 Ga0207681_10270618
1099 Ga0207694_10014131
1100 Ga0207694_10037467
1101 Ga0207687_10003689
1102 Ga0207687_10232898
1103 Ga0207644_10019203
1104 Ga0207644_10026614
1105 Ga0207644_10290188
1106 Ga0207644_10748554
1107 Ga0207690_10006255
1108 Ga0207690_10017677
1109 Ga0207690_10024623
1110 Ga0207690_10051232
1111 Ga0207690_10053454
1112 Ga0207690_10089215
1113 Ga0207690_10096115
1114 Ga0207690_10136904
1115 Ga0207690_10254579
1116 Ga0207690_10320632
1117 Ga0207706_10002393
1118 Ga0207706_10002814
1119 Ga0207706_10009958
1120 Ga0207706_10049613
1121 Ga0207706_10068642
1122 Ga0207706_10072375
1123 Ga0207706_10094862
1124 Ga0207706_10352522
1125 Ga0207686_10392038
1126 Ga0207709_10082236
1127 Ga0207709_11487508
1128 Ga0207670_10482960
1129 Ga0207669_10015845
1130 Ga0207669_10318408
1131 Ga0207704_10084370
1132 Ga0207704_10086033
1133 Ga0207691_10000447
1134 Ga0207691_10044505
1135 Ga0207711_10000258
1136 Ga0207711_10001621
1137 Ga0207711_10001739
1138 Ga0207711_10004550
1139 Ga0207711_10162439
1140 Ga0207689_10001047
1141 Ga0207689_10024317
1142 Ga0207689_10028026
1143 Ga0207689_10039645
1144 Ga0207689_10542198
1145 Ga0207661_10163499
1146 Ga0207661_10467180
1147 Ga0207679_10028104
1148 Ga0207679_10031750
1149 Ga0207679_10095214
1150 Ga0207679_10149429
1151 Ga0207679_10326738
1152 Ga0207679_10386987
1153 Ga0207679_10605830
1154 Ga0207679_11630047
1155 Ga0207667_10013030
1156 Ga0207667_10046456
1157 Ga0207667_10075191
1158 Ga0207667_10137569
1159 Ga0207667_10149293
1160 Ga0207667_10476181
1161 Ga0207651_10008150
1162 Ga0207651_10031999
1163 Ga0207651_10044445
1164 Ga0207651_10149034
1165 Ga0207668_10001204
1166 Ga0207668_10021749
1167 Ga0207668_10091865
1168 Ga0207668_10434240
1169 Ga0207668_11341908
1170 Ga0207640_10003003
1171 Ga0207640_10008369
1172 Ga0207640_10014529
1173 Ga0207658_10010721
1174 Ga0207658_10349833
1175 Ga0207658_11700162
1176 Ga0207677_10004522
1177 Ga0207677_10117697
1178 Ga0207677_10232790
1179 Ga0207703_10002385
1180 Ga0207703_10012883
1181 Ga0207703_10256339
1182 Ga0207703_10445710
1183 Ga0207639_10002841
1184 Ga0207639_10008347
1185 Ga0207639_10024197
1186 Ga0207639_10051493
1187 Ga0207639_10150952
1188 Ga0207678_10002287
1189 Ga0207678_10011714
1190 Ga0207678_10318949
1191 Ga0207678_10423963
1192 Ga0207678_10468845
1193 Ga0207678_10491457
1194 Ga0207678_10812083
1195 Ga0207678_11110825
1196 Ga0207678_11412988
1197 Ga0207702_10033876
1198 Ga0207702_10239868
1199 Ga0207702_10856271
1200 Ga0207641_10000621
1201 Ga0207641_10013785
1202 Ga0207641_10128473
1203 Ga0207641_10132511
1204 Ga0207641_10135879
1205 Ga0207641_10280072
1206 Ga0207648_10001177
1207 Ga0207648_10010576
1208 Ga0207648_10082790
1209 Ga0207648_10257095
1210 Ga0207648_11995567
1211 Ga0207676_10003397
1212 Ga0207676_10004545
1213 Ga0207676_10007577
1214 Ga0207676_10408779
1215 Ga0207674_10001201
1216 Ga0207674_10004331
1217 Ga0207674_10007432
1218 Ga0207674_10022616
1219 Ga0207674_10028041
1220 Ga0207674_10029023
1221 Ga0207674_10340331
1222 Ga0207675_100025062
1223 Ga0207675_100088882
1224 Ga0207675_100113772
1225 Ga0207675_100787496
1226 Ga0207683_10039638
1227 Ga0207698_10001817
1228 Ga0207698_10002511
1229 Ga0207698_10003933
1230 Ga0207698_10010461
1231 Ga0207698_10057313
1232 Ga0207698_10076400
1233 Ga0207698_10104327
1234 Ga0207698_10210416
1235 Ga0207698_10713491
1236 Ga0209813_10000027
1237 Ga0268266_10002361
1238 Ga0268266_10096415
1239 Ga0268266_10107292
1240 Ga0268266_10169599
1241 Ga0268265_10002831
1242 Ga0268265_10004187
1243 Ga0268265_10005424
1244 Ga0268265_10154473
1245 Ga0268265_10215330
1246 Ga0268265_10738975
1247 Ga0268264_10006616
1248 Ga0268264_10007537
1249 Ga0268264_10013078
1250 Ga0268264_10099468
1251 Ga0268264_10270592
1252 Ga0268264_11105335
1253 Ga0316182_1226341
1254 Ga0307408_100717433
1255 Ga0307405_10067257
1256 Ga0307413_10080226
1257 Ga0307413_10133996
1258 Ga0307413_10277660
1259 Ga0307413_11004373
1260 Ga0307410_10169564
1261 Ga0307410_11073958
1262 Ga0307406_10030019
1263 Ga0307407_10045317
1264 Ga0307412_10602319
1265 Ga0307412_11456970
1266 Ga0307409_100056457
1267 Ga0307409_101135112
1268 Ga0307416_100036781
1269 Ga0307414_10130841
1270 Ga0307414_10212160
1271 Ga0307414_10373564
1272 Ga0307411_10016541
1273 Ga0307411_10245639
1274 Ga0307411_10506935
1275 Ga0307415_100069168
1276 Ga0307415_100298433
1277 Ga0373958_0126356
1278 Ga0373949_0304188
1279 Ga0373951_0039767
1280 Ga0373952_0007088
1281 Ga0373960_0124901
1282 Ga0373961_0016425
1283 Ga0373962_0023443
1284 Ga0373931_0001553
1285 Ga0395899_0000820
1286 Ga0395899_0005996
1287 Ga0395899_0055200
1288 Ga0395899_0232674
1289 Ga0395900_0000192
1290 Ga0395900_0061249
1291 Ga0395900_0125796
1292 Ga0395900_0211268
1293 Ga0395900_0284468
1294 Ga0395900_0646162
1295 Ga0395900_0759961
1296 Ga0395898_0000055
1297 Ga0395898_0170362
1298 Ga0395898_0304395
1299 Ga0395898_0382433
1300 Ga0395898_0433077
1301 Ga0395905_0000067
1302 Ga0395905_0068409
1303 Ga0395905_0114626
1304 Ga0395905_0193377
1305 Ga0395905_0209738
1306 Ga0395905_0222496
1307 Ga0395905_0222984
1308 Ga0395905_0254340
1309 Ga0395905_0404255
1310 Ga0395905_0496439
1311 Ga0395905_0536613
1312 Ga0395905_0826874
1313 Ga0395905_0990370
1314 Ga0395905_1295838
1315 Ga0395901_0001001
1316 Ga0395901_0003575
1317 Ga0395901_0046420
1318 Ga0395901_0104636
1319 Ga0395901_0125192
1320 Ga0395901_0336324
1321 Ga0395901_1345251
1322 Ga0436365_0921885
1323 Ga0439446_0189387
1324 Ga0439464_0001072
1325 Ga0466969_0029957
1326 Ga0466972_0154403
1327 Ga0466972_0175979
1328 Ga0466966_0052554
1329 Ga0466961_0339762
1330 Ga0466963_0001535
1331 Ga0466963_0009623
1332 Ga0466963_0099262
1333 Ga0466963_0332761
1334 Ga0466964_0116317
1335 Ga0466964_0230208
1336 Ga0466971_0011736
1337 Ga0466971_0565662
1338 Ga0466970_0046717
1339 Ga0466970_0302043
1340 Ga0466957_0003303
1341 Ga0466957_0045360
1342 Ga0466957_0051081
1343 Ga0466960_0029873
1344 Ga0466960_0183773
1345 Ga0466958_0151961
1346 Ga0466967_0000100
1347 Ga0466967_0001609
1348 Ga0466967_0031149
1349 Ga0466967_0045626
1350 Ga0466967_0048139
1351 Ga0466967_0081702
1352 Ga0466967_0247849
1353 Ga0466967_0408997
1354 Ga0466967_0436959
1355 Ga0466967_0576245
1356 Ga0466967_0580968
1357 Ga0466967_1137607
1358 Ga0495584_0069944
1359 Ga0495663_0111766
1360 Ga0495642_0072095
1361 Ga0495642_0194739
1362 Ga0495625_0411413
1363 Ga0495659_0067174
1364 Ga0495669_0004734
1365 Ga0495669_0114662
1366 Ga0495677_0371768
1367 Ga0496100_0041775
1368 Ga0496100_0451025
1369 Ga0496101_0321238
1370 Ga0496105_0643532
1371 Ga0496106_0021614
1372 Ga0496107_0223317
1373 Ga0496108_0035800
1374 Ga0496109_0064325
1375 Ga0496109_0269498
1376 Ga0496110_0018451
1377 Ga0496110_0147841
1378 Ga0496111_0084697
1379 Ga0496111_0266161
1380 Ga0496112_0015898
1381 Ga0496113_0032420
1382 Ga0496113_1415133
1383 Ga0496116_0000149
1384 Ga0496116_0052646
1385 Ga0496117_0022024
1386 Ga0496117_0031047
1387 Ga0496118_0015986
1388 Ga0496118_0085631
1389 Ga0496121_0001586
1390 Ga0496121_0016397
1391 Ga0496123_0011597
1392 Ga0496124_0066468
1393 Ga0496124_0282400
1394 Ga0496124_0393428
1395 Ga0496124_0402623
1396 Ga0496124_0449201
1397 Ga0496125_0121118
1398 Ga0496125_0458142
1399 Ga0496126_0000261
1400 Ga0501067_0006187
1401 Ga0501067_0469171
1402 Ga0501068_0076295
1403 nmdc:mga03683_2498_c1
1404 nmdc:mga03n38_9632_c1
1405 nmdc:mga00v17_9217_c1
1406 nmdc:mga0yw44_85715_c1
1407 nmdc:mga0k408_17147_c1
1408 nmdc:mga0k408_272306_c1
1409 nmdc:mga06z11_824_c1
1410 nmdc:mga04h51_48_c1
1411 nmdc:mga07m45_211_c1
1412 nmdc:mga08y16_287493_c1
1413 nmdc:mga0rr50_211609_c1
1414 nmdc:mga0rr50_472048_c1
1415 nmdc:mga0a205_62891_c1
1416 nmdc:mga0sz30_55_c1
1417 Ga0500607_026523
1418 Ga0466962_0037732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

20

116

0.96

PF14437

MafB19-deam

MafB19-like deaminase

20

163

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8n-assembly1.cif.gz_B biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9778 8 142
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9775 8 147
2a8n-assembly1.cif.gz_A biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9741 8 132
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9711 8 150
1wwr-assembly1.cif.gz_A crystal structure of trna adenosine deaminase tada from aquifex aeolicus 0.9661 8 150
ID Description Score Start End Superfamily
af_Q9W1H6_33_142_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 1.003 27 40 2.60.40.10
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9958 49 103 3.40.140.10
af_F1QGG7_15_242_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9869 27 40 2.60.40.10
af_B4F6P2_28_129_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9842 27 42 2.60.40.10
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9741 8 132 3.40.140.10
ID Description Score Start End GO Terms
AF-M4RYQ1-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9902 9 150 GO:0002100
GO:0008270
GO:0052717
AF-A0A7S9Z836-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9893 9 150 GO:0002100
GO:0008270
GO:0052717
AF-A0A258RII7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9886 3 150 GO:0002100
GO:0008270
GO:0052717
AF-A0A0F7KUI0-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9883 9 150 GO:0002100
GO:0008270
GO:0052717
AF-A0A7W6SJ82-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9875 9 150 GO:0002100
GO:0008270
GO:0052717

Map