F476648

General Info

Members Datasets Scaffolds Average Seq Length
709 282 707 222

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10001998|Ga0075365_100019989
Length 252
Sequence MTGRDGANGAGDGAPASEREGGAGGAKLTGDVKIAPSLLSADFARLGDAIAIAERAGADMIHFDVMDGHFVPNITIGPPVLKSLARISRLPIDVHLMIENPDRYVEAFVEAGAASVTVHAEAAVHLHRVVALIKSLGAKAGVALNPGTPVSALEQIAGDLDYVLVMTVNPGFGGQTFIPRSESKVRAVRELLRREGSTAPIEVDGGIDLRTAPRIVAAGAGILVAGNAVFGSPDPERAIRDLRAAADAAVAS

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
203 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
204 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
205 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
206 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 1.41
Rhizosphere 94.5
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10018453 3300002459 Bacteria 1443
2 JGI25406J46586_10007722 3300003203 Bacteria 4893
3 Ga0065704_10004255 3300005289 Bacteria 5601
4 Ga0065712_10091706 3300005290 Bacteria 2361
5 Ga0065712_10119184 3300005290 Bacteria 1695
6 Ga0065715_10095823 3300005293 Bacteria 3998
7 Ga0065715_10123633 3300005293 Bacteria 2171
8 Ga0065715_10125501 3300005293 Bacteria 2129
9 Ga0065715_10145282 3300005293 Bacteria 1788
10 Ga0065707_10013372 3300005295 Bacteria 1959
11 Ga0065707_10086593 3300005295 Bacteria 5391
12 Ga0065707_10114347 3300005295 Bacteria 2299
13 Ga0070658_10167972 3300005327 Bacteria 1842
14 Ga0070658_10445547 3300005327 Bacteria 1115
15 Ga0070676_10027050 3300005328 Bacteria 3251
16 Ga0070676_10080427 3300005328 Bacteria 1975
17 Ga0070683_100041342 3300005329 Bacteria 4241
18 Ga0070690_100016164 3300005330 Bacteria 4465
19 Ga0070690_100587910 3300005330 Bacteria 844
20 Ga0070670_100001697 3300005331 Bacteria 17921
21 Ga0070670_100010775 3300005331 Bacteria 7810
22 Ga0070670_100071634 3300005331 Bacteria 2976
23 Ga0070677_10082361 3300005333 Bacteria 1380
24 Ga0070677_10097759 3300005333 Bacteria 1289
25 Ga0070677_10129051 3300005333 Bacteria 1152
26 Ga0070677_10273705 3300005333 Bacteria 848
27 Ga0068869_100037657 3300005334 Bacteria 3440
28 Ga0068869_100164040 3300005334 Bacteria 1731
29 Ga0068869_100393231 3300005334 Bacteria 1139
30 Ga0070680_100543053 3300005336 Bacteria 996
31 Ga0070680_100664250 3300005336 Bacteria 896
32 Ga0070682_100124406 3300005337 Bacteria 1736
33 Ga0070682_100320152 3300005337 Bacteria 1145
34 Ga0070689_100195013 3300005340 Bacteria 1651
35 Ga0070691_10036282 3300005341 Bacteria 2323
36 Ga0070687_100102897 3300005343 Bacteria 1602
37 Ga0070687_100144082 3300005343 Bacteria 1391
38 Ga0070661_100096402 3300005344 Bacteria 2195
39 Ga0070661_100130333 3300005344 Bacteria 1888
40 Ga0070661_100277839 3300005344 Bacteria 1298
41 Ga0070661_100432110 3300005344 Bacteria 1045
42 Ga0070669_100001038 3300005353 Bacteria 20282
43 Ga0070669_100048750 3300005353 Bacteria 3092
44 Ga0070669_100155340 3300005353 Bacteria 1774
45 Ga0070669_100162072 3300005353 Bacteria 1738
46 Ga0070669_100292179 3300005353 Bacteria 1309
47 Ga0070675_100000507 3300005354 Bacteria 26645
48 Ga0070675_100005848 3300005354 Bacteria 9422
49 Ga0070675_100018512 3300005354 Bacteria 5546
50 Ga0070675_100042144 3300005354 Bacteria 3729
51 Ga0070675_100082077 3300005354 Bacteria 2689
52 Ga0070675_100276395 3300005354 Bacteria 1475
53 Ga0070675_100278005 3300005354 Bacteria 1471
54 Ga0070675_100293529 3300005354 Bacteria 1431
55 Ga0070675_100325192 3300005354 Bacteria 1359
56 Ga0070675_100618289 3300005354 Bacteria 983
57 Ga0070671_100007203 3300005355 Bacteria 8894
58 Ga0070671_100007835 3300005355 Bacteria 8534
59 Ga0070671_100128670 3300005355 Bacteria 2132
60 Ga0070674_100006975 3300005356 Bacteria 6631
61 Ga0070674_100064208 3300005356 Bacteria 2572
62 Ga0070674_100111820 3300005356 Bacteria 2007
63 Ga0070674_100165627 3300005356 Bacteria 1681
64 Ga0070674_100370545 3300005356 Bacteria 1162
65 Ga0070673_100005587 3300005364 Bacteria 8065
66 Ga0070673_100017570 3300005364 Bacteria 5092
67 Ga0070673_100150870 3300005364 Bacteria 1968
68 Ga0070673_100207766 3300005364 Bacteria 1689
69 Ga0070673_100228049 3300005364 Bacteria 1615
70 Ga0070673_100439641 3300005364 Bacteria 1172
71 Ga0070673_100580737 3300005364 Bacteria 1021
72 Ga0070673_100912044 3300005364 Bacteria 815
73 Ga0070688_100024728 3300005365 Bacteria 3549
74 Ga0070688_100043058 3300005365 Bacteria 2780
75 Ga0070688_100425928 3300005365 Bacteria 987
76 Ga0070688_100489244 3300005365 Bacteria 926
77 Ga0070659_100041253 3300005366 Bacteria 3607
78 Ga0070659_100050970 3300005366 Bacteria 3254
79 Ga0070659_100113055 3300005366 Bacteria 2193
80 Ga0070659_100169075 3300005366 Bacteria 1790
81 Ga0070659_100351219 3300005366 Bacteria 1237
82 Ga0070667_100036013 3300005367 Bacteria 4148
83 Ga0070667_100055899 3300005367 Bacteria 3333
84 Ga0070667_100164100 3300005367 Bacteria 1958
85 Ga0070667_100280976 3300005367 Bacteria 1495
86 Ga0070709_10167110 3300005434 Bacteria 1534
87 Ga0070701_10004888 3300005438 Bacteria 5484
88 Ga0070701_10031025 3300005438 Bacteria 2650
89 Ga0070701_10037172 3300005438 Bacteria 2457
90 Ga0070701_10255049 3300005438 Bacteria 1061
91 Ga0070711_100222459 3300005439 Bacteria 1468
92 Ga0070705_100000088 3300005440 Bacteria 51329
93 Ga0070705_100215857 3300005440 Bacteria 1325
94 Ga0070700_100083824 3300005441 Bacteria 2064
95 Ga0070700_100245413 3300005441 Bacteria 1282
96 Ga0070694_100007737 3300005444 Bacteria 6557
97 Ga0070694_100081847 3300005444 Bacteria 2247
98 Ga0070694_100113810 3300005444 Bacteria 1931
99 Ga0070694_100309030 3300005444 Bacteria 1213
100 Ga0070663_100062034 3300005455 Bacteria 2693
101 Ga0070663_100282954 3300005455 Bacteria 1322
102 Ga0070663_100348092 3300005455 Bacteria 1199
103 Ga0070678_100761011 3300005456 Bacteria 877
104 Ga0070662_100241251 3300005457 Bacteria 1450
105 Ga0070662_100241511 3300005457 Bacteria 1449
106 Ga0070681_10011368 3300005458 Bacteria 8807
107 Ga0070681_10512166 3300005458 Bacteria 1113
108 Ga0068867_100000734 3300005459 Bacteria 21968
109 Ga0068867_100006574 3300005459 Bacteria 8213
110 Ga0068867_100010010 3300005459 Bacteria 6682
111 Ga0068867_100135236 3300005459 Bacteria 1921
112 Ga0070685_10007355 3300005466 Bacteria 5631
113 Ga0070706_100832332 3300005467 Bacteria 854
114 Ga0070707_100040267 3300005468 Bacteria 4471
115 Ga0070707_100076420 3300005468 Bacteria 3230
116 Ga0070707_100195861 3300005468 Bacteria 1970
117 Ga0070707_100243467 3300005468 Bacteria 1750
118 Ga0070707_100265784 3300005468 Bacteria 1668
119 Ga0070707_100534930 3300005468 Bacteria 1134
120 Ga0070698_100001713 3300005471 Bacteria 24457
121 Ga0070698_100242251 3300005471 Bacteria 1736
122 Ga0070698_100404942 3300005471 Bacteria 1298
123 Ga0070698_100591301 3300005471 Bacteria 1050
124 Ga0070699_100003923 3300005518 Bacteria 13135
125 Ga0070699_100012762 3300005518 Bacteria 7242
126 Ga0070699_100054229 3300005518 Bacteria 3470
127 Ga0070699_100091386 3300005518 Bacteria 2661
128 Ga0070679_100208385 3300005530 Bacteria 1919
129 Ga0070679_100568634 3300005530 Bacteria 1077
130 Ga0070697_100155654 3300005536 Bacteria 1929
131 Ga0068853_100226260 3300005539 Bacteria 1710
132 Ga0070672_100001095 3300005543 Bacteria 16521
133 Ga0070672_100009184 3300005543 Bacteria 6806
134 Ga0070672_100011132 3300005543 Bacteria 6265
135 Ga0070672_100258956 3300005543 Bacteria 1467
136 Ga0070686_100006552 3300005544 Bacteria 6480
137 Ga0070686_100112701 3300005544 Bacteria 1855
138 Ga0070686_100435394 3300005544 Bacteria 1005
139 Ga0070686_100542948 3300005544 Bacteria 908
140 Ga0070695_100000021 3300005545 Bacteria 60669
141 Ga0070695_100063380 3300005545 Bacteria 2403
142 Ga0070695_100248454 3300005545 Bacteria 1294
143 Ga0070695_100540290 3300005545 Bacteria 907
144 Ga0070696_100000016 3300005546 Bacteria 76371
145 Ga0070696_100023567 3300005546 Bacteria 4183
146 Ga0070696_100429362 3300005546 Bacteria 1039
147 Ga0070693_100037985 3300005547 Bacteria 2689
148 Ga0070665_100002913 3300005548 Bacteria 18496
149 Ga0070665_100301934 3300005548 Bacteria 1604
150 Ga0070704_100000384 3300005549 Bacteria 20178
151 Ga0070704_100062260 3300005549 Bacteria 2674
152 Ga0070704_100208573 3300005549 Bacteria 1582
153 Ga0070704_100350785 3300005549 Bacteria 1246
154 Ga0070704_100772804 3300005549 Bacteria 856
155 Ga0068855_100121796 3300005563 Unclassified 2985
156 Ga0070664_100002524 3300005564 Bacteria 14755
157 Ga0070664_100020483 3300005564 Bacteria 5446
158 Ga0070664_100042543 3300005564 Bacteria 3834
159 Ga0070664_100258460 3300005564 Bacteria 1567
160 Ga0070664_100492557 3300005564 Bacteria 1129
161 Ga0070664_100519406 3300005564 Bacteria 1099
162 Ga0068857_100042416 3300005577 Bacteria 4036
163 Ga0068857_100098931 3300005577 Unclassified 2616
164 Ga0068854_100170512 3300005578 Unclassified 1693
165 Ga0068854_100358164 3300005578 Bacteria 1196
166 Ga0070702_100018918 3300005615 Bacteria 3581
167 Ga0070702_100024288 3300005615 Bacteria 3232
168 Ga0070702_100433717 3300005615 Bacteria 949
169 Ga0068852_100116359 3300005616 Bacteria 2439
170 Ga0068852_100191629 3300005616 Bacteria 1930
171 Ga0068859_100019849 3300005617 Bacteria 6746
172 Ga0068859_100240472 3300005617 Bacteria 1899
173 Ga0068864_100054442 3300005618 Bacteria 3453
174 Ga0068864_100134476 3300005618 Bacteria 2225
175 Ga0068864_100296120 3300005618 Bacteria 1514
176 Ga0068866_10003129 3300005718 Bacteria 6810
177 Ga0068861_100010900 3300005719 Bacteria 6314
178 Ga0068861_100016995 3300005719 Bacteria 5159
179 Ga0068851_10193709 3300005834 Bacteria 1131
180 Ga0068870_10003900 3300005840 Bacteria 6363
181 Ga0068870_10016974 3300005840 Bacteria 3492
182 Ga0068870_10145269 3300005840 Bacteria 1392
183 Ga0068863_100006191 3300005841 Bacteria 11735
184 Ga0068863_100042922 3300005841 Bacteria 4295
185 Ga0068858_100005046 3300005842 Bacteria 12942
186 Ga0068858_100145183 3300005842 Bacteria 2228
187 Ga0068858_100180871 3300005842 Bacteria 1991
188 Ga0068858_100273211 3300005842 Bacteria 1608
189 Ga0068860_100014433 3300005843 Bacteria 7738
190 Ga0068860_100039025 3300005843 Bacteria 4543
191 Ga0068860_100079061 3300005843 Bacteria 3127
192 Ga0068860_100082549 3300005843 Bacteria 3056
193 Ga0068860_100507041 3300005843 Bacteria 1205
194 Ga0068860_101139891 3300005843 Bacteria 800
195 Ga0068860_101206537 3300005843 Bacteria 777
196 Ga0068862_100005891 3300005844 Bacteria 10207
197 Ga0068862_100032432 3300005844 Bacteria 4414
198 Ga0068862_100242253 3300005844 Bacteria 1640
199 Ga0068862_100428638 3300005844 Bacteria 1243
200 Ga0068862_100566224 3300005844 Bacteria 1087
201 Ga0081539_10000106 3300005985 Bacteria 195771
202 Ga0070717_10067480 3300006028 Bacteria 2976
203 Ga0075365_10001998 3300006038 Bacteria 9667
204 Ga0075365_10114053 3300006038 Bacteria 1859
205 Ga0075363_100361720 3300006048 Bacteria 849
206 Ga0075364_10241359 3300006051 Bacteria 1227
207 Ga0075362_10004952 3300006177 Bacteria 4828
208 Ga0075367_10050056 3300006178 Bacteria 2465
209 Ga0075367_10241406 3300006178 Bacteria 1132
210 Ga0075366_10000340 3300006195 Bacteria 21470
211 Ga0097621_100343388 3300006237 Bacteria 1326
212 Ga0075428_100005224 3300006844 Bacteria 14436
213 Ga0075428_100007242 3300006844 Bacteria 12289
214 Ga0075428_100103590 3300006844 Bacteria 3103
215 Ga0075428_100310513 3300006844 Bacteria 1695
216 Ga0075430_100025586 3300006846 Bacteria 5023
217 Ga0075430_100045984 3300006846 Bacteria 3686
218 Ga0075430_100115480 3300006846 Bacteria 2237
219 Ga0075430_100155366 3300006846 Bacteria 1905
220 Ga0075431_100020518 3300006847 Bacteria 6751
221 Ga0075431_100034489 3300006847 Bacteria 5214
222 Ga0075431_100184693 3300006847 Bacteria 2139
223 Ga0075433_10071902 3300006852 Bacteria 3041
224 Ga0075434_100001393 3300006871 Bacteria 20300
225 Ga0075434_100016592 3300006871 Bacteria 7082
226 Ga0075434_100055428 3300006871 Bacteria 3939
227 Ga0075434_100267612 3300006871 Bacteria 1728
228 Ga0075434_100287489 3300006871 Bacteria 1664
229 Ga0075434_100523532 3300006871 Bacteria 1206
230 Ga0075429_100114599 3300006880 Bacteria 2356
231 Ga0075429_100461716 3300006880 Bacteria 1113
232 Ga0068865_100002495 3300006881 Bacteria 10899
233 Ga0075436_100028414 3300006914 Bacteria 3847
234 Ga0075436_100087038 3300006914 Bacteria 2170
235 Ga0097620_100019848 3300006931 Bacteria 6746
236 Ga0097620_100240472 3300006931 Bacteria 1899
237 Ga0075435_100043029 3300007076 Bacteria 3615
238 Ga0075435_100105118 3300007076 Bacteria 2343
239 Ga0075435_100119361 3300007076 Bacteria 2199
240 Ga0075435_100302214 3300007076 Bacteria 1369
241 Ga0105240_10920090 3300009093 Bacteria 940
242 Ga0111539_10000253 3300009094 Bacteria 64123
243 Ga0111539_10003215 3300009094 Bacteria 21610
244 Ga0111539_10017868 3300009094 Bacteria 8783
245 Ga0111539_10064568 3300009094 Bacteria 4329
246 Ga0111539_10133175 3300009094 Bacteria 2910
247 Ga0111539_10144545 3300009094 Bacteria 2784
248 Ga0111539_10428297 3300009094 Bacteria 1541
249 Ga0111539_10467792 3300009094 Bacteria 1468
250 Ga0111539_10582099 3300009094 Bacteria 1304
251 Ga0111539_10605960 3300009094 Bacteria 1275
252 Ga0111539_10607802 3300009094 Bacteria 1273
253 Ga0105245_10457447 3300009098 Bacteria 1286
254 Ga0114129_10003607 3300009147 Bacteria 21767
255 Ga0114129_10005104 3300009147 Bacteria 18487
256 Ga0114129_10080023 3300009147 Bacteria 4543
257 Ga0114129_10091479 3300009147 Bacteria 4215
258 Ga0114129_10206620 3300009147 Bacteria 2657
259 Ga0105243_10002751 3300009148 Bacteria 14622
260 Ga0105243_10009061 3300009148 Bacteria 7602
261 Ga0105243_10094272 3300009148 Bacteria 2472
262 Ga0105243_10533607 3300009148 Bacteria 1118
263 Ga0105241_10103959 3300009174 Bacteria 2262
264 Ga0105242_10008954 3300009176 Bacteria 7684
265 Ga0105242_10018069 3300009176 Bacteria 5507
266 Ga0105248_10024378 3300009177 Bacteria 6727
267 Ga0105248_10267442 3300009177 Bacteria 1925
268 Ga0105237_10007566 3300009545 Bacteria 11874
269 Ga0105238_10013846 3300009551 Bacteria 8152
270 Ga0105249_10001485 3300009553 Bacteria 20547
271 Ga0105249_10041995 3300009553 Bacteria 4158
272 Ga0105249_10150337 3300009553 Bacteria 2241
273 Ga0105249_10312288 3300009553 Bacteria 1581
274 Ga0105249_10533751 3300009553 Bacteria 1222
275 Ga0105239_10933960 3300010375 Bacteria 996
276 Ga0105246_10642612 3300011119 Bacteria 922
277 Ga0157374_10043530 3300013296 Bacteria 4149
278 Ga0157378_10283585 3300013297 Bacteria 1597
279 Ga0163162_10142684 3300013306 Bacteria 2509
280 Ga0163162_10662496 3300013306 Bacteria 1167
281 Ga0157372_10337530 3300013307 Bacteria 1755
282 Ga0157372_10624495 3300013307 Bacteria 1255
283 Ga0157375_10035943 3300013308 Bacteria 4733
284 Ga0157375_10079505 3300013308 Bacteria 3315
285 Ga0157375_10183003 3300013308 Bacteria 2248
286 Ga0157375_10191689 3300013308 Bacteria 2199
287 Ga0163163_10012635 3300014325 Bacteria 7697
288 Ga0163163_10019152 3300014325 Bacteria 6423
289 Ga0163163_10298780 3300014325 Bacteria 1663
290 Ga0157380_10003938 3300014326 Bacteria 10247
291 Ga0157380_10006040 3300014326 Bacteria 8483
292 Ga0157380_10007433 3300014326 Bacteria 7778
293 Ga0157380_10070744 3300014326 Bacteria 2820
294 Ga0157380_10092723 3300014326 Bacteria 2496
295 Ga0157380_10397595 3300014326 Bacteria 1306
296 Ga0157377_10033384 3300014745 Bacteria 2809
297 Ga0157377_10197591 3300014745 Bacteria 1275
298 Ga0157377_10302101 3300014745 Bacteria 1057
299 Ga0157377_10327080 3300014745 Bacteria 1020
300 Ga0157379_10012602 3300014968 Bacteria 7385
301 Ga0157376_10095204 3300014969 Bacteria 2589
302 Ga0157376_10192398 3300014969 Bacteria 1871
303 Ga0207656_10010706 3300025321 Bacteria 3444
304 Ga0207682_10006289 3300025893 Bacteria 4794
305 Ga0207682_10030309 3300025893 Bacteria 2166
306 Ga0207682_10045704 3300025893 Bacteria 1798
307 Ga0207688_10051590 3300025901 Bacteria 2304
308 Ga0207688_10238470 3300025901 Bacteria 1099
309 Ga0207680_10021143 3300025903 Bacteria 3516
310 Ga0207680_10035135 3300025903 Bacteria 2875
311 Ga0207680_10122446 3300025903 Bacteria 1703
312 Ga0207680_10138028 3300025903 Bacteria 1614
313 Ga0207680_10164132 3300025903 Bacteria 1492
314 Ga0207645_10004890 3300025907 Bacteria 9822
315 Ga0207645_10007927 3300025907 Bacteria 7460
316 Ga0207645_10177585 3300025907 Bacteria 1397
317 Ga0207643_10011995 3300025908 Bacteria 4679
318 Ga0207643_10032604 3300025908 Bacteria 2910
319 Ga0207643_10047006 3300025908 Bacteria 2440
320 Ga0207643_10078032 3300025908 Bacteria 1915
321 Ga0207643_10118575 3300025908 Bacteria 1565
322 Ga0207705_10137462 3300025909 Bacteria 1823
323 Ga0207684_10164619 3300025910 Bacteria 1910
324 Ga0207684_10944923 3300025910 Bacteria 723
325 Ga0207707_10056337 3300025912 Bacteria 3420
326 Ga0207707_10067961 3300025912 Bacteria 3104
327 Ga0207695_10677417 3300025913 Bacteria 912
328 Ga0207671_10022996 3300025914 Bacteria 4705
329 Ga0207660_10088488 3300025917 Bacteria 2290
330 Ga0207660_10458681 3300025917 Bacteria 1031
331 Ga0207660_10583351 3300025917 Bacteria 910
332 Ga0207662_10001930 3300025918 Bacteria 10217
333 Ga0207662_10004273 3300025918 Bacteria 7499
334 Ga0207662_10023741 3300025918 Bacteria 3525
335 Ga0207662_10053313 3300025918 Bacteria 2409
336 Ga0207662_10282929 3300025918 Bacteria 1098
337 Ga0207649_10061520 3300025920 Bacteria 2364
338 Ga0207649_10096597 3300025920 Bacteria 1947
339 Ga0207652_10031233 3300025921 Bacteria 4472
340 Ga0207652_10382824 3300025921 Bacteria 1270
341 Ga0207646_10092492 3300025922 Bacteria 2707
342 Ga0207646_10159352 3300025922 Bacteria 2036
343 Ga0207646_10172854 3300025922 Bacteria 1951
344 Ga0207681_10007908 3300025923 Bacteria 6500
345 Ga0207681_10013643 3300025923 Bacteria 5031
346 Ga0207681_10028939 3300025923 Bacteria 3593
347 Ga0207681_10101372 3300025923 Bacteria 2077
348 Ga0207681_10114701 3300025923 Bacteria 1966
349 Ga0207681_10134573 3300025923 Bacteria 1832
350 Ga0207681_10199030 3300025923 Bacteria 1537
351 Ga0207694_10008144 3300025924 Bacteria 7920
352 Ga0207650_10008282 3300025925 Bacteria 7099
353 Ga0207650_10110686 3300025925 Bacteria 2125
354 Ga0207650_10248611 3300025925 Bacteria 1439
355 Ga0207659_10000602 3300025926 Bacteria 21496
356 Ga0207659_10002907 3300025926 Bacteria 10196
357 Ga0207659_10020747 3300025926 Bacteria 4349
358 Ga0207659_10121177 3300025926 Bacteria 2005
359 Ga0207659_10222309 3300025926 Bacteria 1519
360 Ga0207659_10678717 3300025926 Bacteria 881
361 Ga0207687_10158580 3300025927 Bacteria 1734
362 Ga0207700_10093560 3300025928 Bacteria 2379
363 Ga0207700_10649447 3300025928 Bacteria 940
364 Ga0207644_10004034 3300025931 Bacteria 9527
365 Ga0207644_10031630 3300025931 Bacteria 3688
366 Ga0207690_10020688 3300025932 Bacteria 4070
367 Ga0207690_10219283 3300025932 Bacteria 1455
368 Ga0207706_10100215 3300025933 Bacteria 2548
369 Ga0207706_10174393 3300025933 Bacteria 1889
370 Ga0207706_10219010 3300025933 Bacteria 1667
371 Ga0207686_10013872 3300025934 Bacteria 4469
372 Ga0207709_10008072 3300025935 Bacteria 5830
373 Ga0207709_10016003 3300025935 Bacteria 4163
374 Ga0207670_10006747 3300025936 Bacteria 6381
375 Ga0207670_10039776 3300025936 Bacteria 3082
376 Ga0207670_10086293 3300025936 Bacteria 2208
377 Ga0207669_10005893 3300025937 Bacteria 5546
378 Ga0207669_10012323 3300025937 Bacteria 4200
379 Ga0207669_10028054 3300025937 Bacteria 3092
380 Ga0207669_10361057 3300025937 Bacteria 1126
381 Ga0207669_10380093 3300025937 Bacteria 1100
382 Ga0207704_10000998 3300025938 Bacteria 12551
383 Ga0207704_10013084 3300025938 Bacteria 4140
384 Ga0207665_10293724 3300025939 Bacteria 1213
385 Ga0207691_10010354 3300025940 Bacteria 8943
386 Ga0207691_10042381 3300025940 Bacteria 4196
387 Ga0207691_10244682 3300025940 Bacteria 1550
388 Ga0207691_10342973 3300025940 Bacteria 1279
389 Ga0207691_10346539 3300025940 Bacteria 1271
390 Ga0207691_10438000 3300025940 Bacteria 1113
391 Ga0207711_10217190 3300025941 Bacteria 1748
392 Ga0207689_10013122 3300025942 Bacteria 7071
393 Ga0207689_10057438 3300025942 Bacteria 3201
394 Ga0207689_10080261 3300025942 Bacteria 2681
395 Ga0207689_10091465 3300025942 Bacteria 2500
396 Ga0207689_10116339 3300025942 Bacteria 2198
397 Ga0207689_10138462 3300025942 Bacteria 2005
398 Ga0207689_10240715 3300025942 Bacteria 1496
399 Ga0207661_10001149 3300025944 Bacteria 17678
400 Ga0207661_10005260 3300025944 Bacteria 9105
401 Ga0207679_10005938 3300025945 Bacteria 7679
402 Ga0207651_10002624 3300025960 Bacteria 8589
403 Ga0207651_10009236 3300025960 Bacteria 5382
404 Ga0207651_10030995 3300025960 Bacteria 3412
405 Ga0207651_10138287 3300025960 Bacteria 1877
406 Ga0207651_10203374 3300025960 Bacteria 1589
407 Ga0207651_10228472 3300025960 Bacteria 1509
408 Ga0207651_10298169 3300025960 Bacteria 1339
409 Ga0207651_10304776 3300025960 Bacteria 1326
410 Ga0207712_10041096 3300025961 Bacteria 3177
411 Ga0207712_10367480 3300025961 Bacteria 1200
412 Ga0207712_10442019 3300025961 Bacteria 1101
413 Ga0207668_10247533 3300025972 Bacteria 1446
414 Ga0207640_10352963 3300025981 Bacteria 1182
415 Ga0207658_10136941 3300025986 Bacteria 1976
416 Ga0207658_10138198 3300025986 Bacteria 1968
417 Ga0207658_10576577 3300025986 Bacteria 1009
418 Ga0207658_10656217 3300025986 Bacteria 946
419 Ga0207677_10231171 3300026023 Bacteria 1490
420 Ga0207703_10021915 3300026035 Bacteria 5003
421 Ga0207703_10338075 3300026035 Bacteria 1383
422 Ga0207703_10433688 3300026035 Bacteria 1225
423 Ga0207639_10612819 3300026041 Bacteria 1005
424 Ga0207678_10069168 3300026067 Bacteria 3027
425 Ga0207678_10148174 3300026067 Bacteria 2003
426 Ga0207708_10003387 3300026075 Bacteria 11746
427 Ga0207708_10005930 3300026075 Bacteria 9039
428 Ga0207708_10012327 3300026075 Bacteria 6370
429 Ga0207708_10089523 3300026075 Bacteria 2372
430 Ga0207641_10024334 3300026088 Bacteria 4991
431 Ga0207641_10038115 3300026088 Bacteria 4018
432 Ga0207641_10113057 3300026088 Bacteria 2410
433 Ga0207648_10000338 3300026089 Bacteria 51422
434 Ga0207648_10001667 3300026089 Bacteria 24343
435 Ga0207648_10003433 3300026089 Bacteria 16628
436 Ga0207648_10033564 3300026089 Bacteria 4526
437 Ga0207648_10123543 3300026089 Bacteria 2277
438 Ga0207648_10590475 3300026089 Bacteria 1023
439 Ga0207676_10047921 3300026095 Bacteria 3314
440 Ga0207676_10127093 3300026095 Bacteria 2161
441 Ga0207676_10502706 3300026095 Bacteria 1151
442 Ga0207676_11057397 3300026095 Bacteria 801
443 Ga0207674_10035241 3300026116 Bacteria 5224
444 Ga0207674_10089673 3300026116 Bacteria 3068
445 Ga0207674_10111526 3300026116 Bacteria 2709
446 Ga0207674_10114204 3300026116 Unclassified 2673
447 Ga0207674_10523703 3300026116 Bacteria 1145
448 Ga0207674_10833870 3300026116 Bacteria 889
449 Ga0207675_100007099 3300026118 Bacteria 10586
450 Ga0207675_100008779 3300026118 Bacteria 9489
451 Ga0207675_100024774 3300026118 Bacteria 5582
452 Ga0207683_10033865 3300026121 Bacteria 4439
453 Ga0207683_10062518 3300026121 Bacteria 3279
454 Ga0207683_10064623 3300026121 Bacteria 3225
455 Ga0207683_10106178 3300026121 Bacteria 2511
456 Ga0207683_10419098 3300026121 Bacteria 1233
457 Ga0207683_10666624 3300026121 Bacteria 964
458 Ga0207698_10069888 3300026142 Bacteria 2779
459 Ga0207698_10157919 3300026142 Bacteria 1979
460 Ga0209998_10011182 3300027717 Bacteria 1858
461 Ga0207428_10000085 3300027907 Bacteria 132411
462 Ga0207428_10005133 3300027907 Bacteria 12267
463 Ga0207428_10012432 3300027907 Bacteria 7481
464 Ga0207428_10070310 3300027907 Bacteria 2751
465 Ga0268266_10002732 3300028379 Bacteria 18470
466 Ga0268265_10003298 3300028380 Bacteria 11696
467 Ga0268265_10038871 3300028380 Bacteria 3503
468 Ga0268265_10045365 3300028380 Bacteria 3279
469 Ga0268265_10192217 3300028380 Bacteria 1764
470 Ga0268265_10211815 3300028380 Bacteria 1689
471 Ga0268265_10547105 3300028380 Bacteria 1098
472 Ga0268265_10558633 3300028380 Bacteria 1088
473 Ga0268264_10007621 3300028381 Bacteria 9024
474 Ga0268264_10039264 3300028381 Bacteria 3911
475 Ga0268264_10268238 3300028381 Bacteria 1594
476 Ga0268264_10476004 3300028381 Bacteria 1214
477 Ga0268264_10611157 3300028381 Bacteria 1075
478 Ga0268264_10814085 3300028381 Bacteria 934
479 Ga0307408_100043786 3300031548 Bacteria 3186
480 Ga0307408_100337784 3300031548 Bacteria 1274
481 Ga0307408_100450523 3300031548 Bacteria 1116
482 Ga0307408_100878977 3300031548 Bacteria 819
483 Ga0316576_10121623 3300031727 Bacteria 1960
484 Ga0307405_10000896 3300031731 Bacteria 11820
485 Ga0307405_10029783 3300031731 Bacteria 3193
486 Ga0316577_10239459 3300031733 Bacteria 1026
487 Ga0307413_10013614 3300031824 Bacteria 4096
488 Ga0307413_10174498 3300031824 Bacteria 1525
489 Ga0307410_10008739 3300031852 Bacteria 5637
490 Ga0307410_10011533 3300031852 Bacteria 5059
491 Ga0307410_10316653 3300031852 Bacteria 1236
492 Ga0307410_10332085 3300031852 Bacteria 1209
493 Ga0307406_10019269 3300031901 Bacteria 4002
494 Ga0307406_10044831 3300031901 Bacteria 2773
495 Ga0307407_10026375 3300031903 Bacteria 3075
496 Ga0307407_10026962 3300031903 Bacteria 3051
497 Ga0307412_10016850 3300031911 Bacteria 4364
498 Ga0307412_10028538 3300031911 Bacteria 3492
499 Ga0307412_10078519 3300031911 Bacteria 2274
500 Ga0307412_10279405 3300031911 Bacteria 1310
501 Ga0307409_100002483 3300031995 Bacteria 9661
502 Ga0307409_100025219 3300031995 Bacteria 4165
503 Ga0307409_100031724 3300031995 Bacteria 3819
504 Ga0307409_100069918 3300031995 Bacteria 2784
505 Ga0307409_100133809 3300031995 Bacteria 2124
506 Ga0307409_100159458 3300031995 Bacteria 1971
507 Ga0307416_100002720 3300032002 Bacteria 10252
508 Ga0307416_100045322 3300032002 Bacteria 3462
509 Ga0307416_100097334 3300032002 Bacteria 2548
510 Ga0307416_100288535 3300032002 Bacteria 1623
511 Ga0307414_10149177 3300032004 Bacteria 1842
512 Ga0307414_10203522 3300032004 Bacteria 1612
513 Ga0307414_10208604 3300032004 Bacteria 1595
514 Ga0307411_10013381 3300032005 Bacteria 4525
515 Ga0307411_10020596 3300032005 Bacteria 3840
516 Ga0307411_10657410 3300032005 Bacteria 908
517 Ga0307415_100039123 3300032126 Bacteria 3131
518 Ga0307415_100278341 3300032126 Bacteria 1374
519 Ga0307415_100775477 3300032126 Bacteria 873
520 Ga0316583_10007523 3300032133 Bacteria 3922
521 Ga0316580_10038502 3300032139 Bacteria 1478
522 Ga0373926_0106346 3300035083 Bacteria 1052
523 Ga0373923_0059154 3300035111 Bacteria 1624
524 Ga0373939_0030310 3300035114 Bacteria 1555
525 Ga0373960_0021398 3300035121 Bacteria 1720
526 Ga0373943_0322151 3300035170 Bacteria 881
527 Ga0373924_0120057 3300035410 Bacteria 1140
528 Ga0373935_0335291 3300035692 Bacteria 1076
529 Ga0373933_0333976 3300035724 Bacteria 983
530 Ga0373947_0025933 3300035725 Bacteria 3420
531 Ga0373937_0013013 3300036401 Bacteria 7328
532 Ga0373937_0048996 3300036401 Bacteria 3868
533 Ga0373937_0291055 3300036401 Bacteria 1543
534 Ga0373937_0791042 3300036401 Bacteria 896
535 Ga0316582_0107406 3300036647 Bacteria 1854
536 Ga0316584_0028588 3300036712 Bacteria 4112
537 Ga0373925_0012431 3300037068 Bacteria 6164
538 Ga0373925_0336091 3300037068 Bacteria 1224
539 Ga0395905_0844249 3300037471 Bacteria 819
540 Ga0400491_22105 3300038727 Bacteria 1175
541 Ga0400485_10833 3300038735 Bacteria 31562
542 Ga0400486_01644 3300038742 Bacteria 89520
543 Ga0400486_13502 3300038742 Bacteria 34171
544 Ga0400483_020887 3300039062 Bacteria 4734
545 Ga0400483_032668 3300039062 Bacteria 5132
546 Ga0400483_163516 3300039062 Bacteria 14697
547 Ga0400483_232829 3300039062 Bacteria 1608
548 Ga0400483_248230 3300039062 Bacteria 9765
549 Ga0400487_35213 3300039110 Bacteria 4079
550 Ga0400487_39899 3300039110 Bacteria 80564
551 Ga0451843_0404721 3300041509 Bacteria 849
552 Ga0451853_2622050 3300041512 Bacteria 1480
553 Ga0439445_0021089 3300042004 Bacteria 1635
554 Ga0439448_0156988 3300042005 Bacteria 791
555 Ga0439446_0033837 3300042156 Bacteria 1486
556 Ga0439446_0076565 3300042156 Bacteria 1030
557 Ga0439434_0015830 3300042435 Bacteria 2250
558 Ga0451577_0001333 3300042876 Bacteria 33539
559 Ga0451577_0037691 3300042876 Bacteria 4351
560 Ga0451577_0103059 3300042876 Bacteria 2550
561 Ga0451577_0794019 3300042876 Bacteria 855
562 Ga0453684_0000441 3300044712 Bacteria 169068
563 Ga0453684_0003492 3300044712 Bacteria 35294
564 Ga0453684_0005948 3300044712 Bacteria 23665
565 Ga0453684_0024766 3300044712 Bacteria 8748
566 Ga0453684_0026141 3300044712 Bacteria 8446
567 Ga0453684_0048385 3300044712 Bacteria 5624
568 Ga0453684_0280745 3300044712 Bacteria 1899
569 Ga0451576_0027569 3300045051 Bacteria 6099
570 Ga0451576_0051942 3300045051 Bacteria 4296
571 Ga0451576_0271090 3300045051 Bacteria 1774
572 Ga0451576_0513240 3300045051 Bacteria 1259
573 Ga0466967_0495476 3300045976 Bacteria 1198
574 Ga0495603_0094283 3300046455 Bacteria 1749
575 Ga0495629_0139680 3300046459 Bacteria 1686
576 Ga0495639_0161727 3300046475 Bacteria 1084
577 Ga0495643_0006118 3300046522 Bacteria 7997
578 Ga0495640_0337106 3300046533 Bacteria 932
579 Ga0495598_0035860 3300046537 Bacteria 1422
580 Ga0495621_0000068 3300046539 Bacteria 20404
581 Ga0495621_0003713 3300046539 Bacteria 4226
582 Ga0495621_0021505 3300046539 Bacteria 2127
583 Ga0495633_0028137 3300046558 Bacteria 2742
584 Ga0495667_0180617 3300046559 Bacteria 1354
585 Ga0495634_0343146 3300046642 Bacteria 895
586 Ga0495611_0150681 3300046648 Bacteria 1086
587 Ga0495659_0001941 3300046664 Bacteria 6820
588 Ga0495659_0023876 3300046664 Bacteria 2080
589 Ga0495659_0087353 3300046664 Bacteria 1192
590 Ga0495670_0058596 3300046691 Bacteria 1933
591 Ga0495636_0008433 3300047318 Bacteria 4066
592 Ga0495636_0059286 3300047318 Bacteria 1615
593 Ga0495685_013370 3300047447 Bacteria 2786
594 Ga0496102_0232266 3300048905 Bacteria 1739
595 Ga0496104_0196663 3300048907 Bacteria 1928
596 Ga0496104_0408010 3300048907 Bacteria 1271
597 Ga0496109_0001883 3300048912 Bacteria 17398
598 Ga0496109_0237155 3300048912 Bacteria 1716
599 Ga0496110_0001704 3300048913 Bacteria 16172
600 Ga0496111_0035301 3300048914 Bacteria 3573
601 Ga0496112_0029044 3300048915 Bacteria 5346
602 Ga0496112_0056723 3300048915 Bacteria 3856
603 Ga0496112_0070709 3300048915 Bacteria 3449
604 Ga0501034_0030152 3300049571 Bacteria 5512
605 Ga0501034_0192634 3300049571 Bacteria 2000
606 Ga0501036_0018336 3300049572 Bacteria 5861
607 Ga0501036_0044850 3300049572 Bacteria 3746
608 Ga0501038_0564095 3300049574 Bacteria 865
609 Ga0501040_0035844 3300049576 Bacteria 3366
610 Ga0501041_0041438 3300049577 Bacteria 2797
611 Ga0501041_0144180 3300049577 Bacteria 1486
612 Ga0501041_0169242 3300049577 Bacteria 1367
613 Ga0501042_0244947 3300049578 Bacteria 1293
614 Ga0501042_0282449 3300049578 Bacteria 1199
615 Ga0501043_0219065 3300049579 Bacteria 1473
616 Ga0501046_0127346 3300049580 Bacteria 1933
617 Ga0501047_0028729 3300049581 Bacteria 5363
618 Ga0501047_0105108 3300049581 Bacteria 2704
619 Ga0501048_0012795 3300049582 Bacteria 6236
620 Ga0501048_0036313 3300049582 Bacteria 3542
621 Ga0501048_0058057 3300049582 Bacteria 2744
622 Ga0501048_0100345 3300049582 Bacteria 2042
623 Ga0501068_0416745 3300049584 Bacteria 867
624 Ga0501069_0020387 3300049585 Bacteria 3592
625 Ga0501069_0244555 3300049585 Bacteria 1046
626 Ga0501070_0503380 3300049586 Bacteria 973
627 Ga0501071_0097243 3300049587 Bacteria 2167
628 Ga0501071_0350696 3300049587 Bacteria 1123
629 Ga0501072_0071364 3300049588 Bacteria 2744
630 Ga0501072_0540346 3300049588 Bacteria 921
631 Ga0501074_0284580 3300049590 Bacteria 1175
632 Ga0501074_0335896 3300049590 Bacteria 1072
633 Ga0501075_0021816 3300049591 Bacteria 4672
634 Ga0501075_0036917 3300049591 Bacteria 3648
635 Ga0501075_0176420 3300049591 Bacteria 1631
636 Ga0501076_0034496 3300049592 Bacteria 3955
637 Ga0501076_0224136 3300049592 Bacteria 1536
638 Ga0501076_0235578 3300049592 Bacteria 1497
639 Ga0501076_0303958 3300049592 Bacteria 1308
640 Ga0501077_0183534 3300049593 Bacteria 1329
641 Ga0501079_0371620 3300049741 Bacteria 1121
642 Ga0501079_0414127 3300049741 Bacteria 1057
643 Ga0501079_0461654 3300049741 Bacteria 997
644 Ga0501080_0314393 3300049742 Bacteria 1419
645 Ga0501080_0770802 3300049742 Bacteria 845
646 Ga0501083_0000455 3300049744 Bacteria 26198
647 Ga0501035_0459386 3300049822 Bacteria 1053
648 Ga0501044_0015771 3300049823 Bacteria 8136
649 Ga0501045_0019410 3300049824 Bacteria 4846
650 Ga0501045_0194144 3300049824 Bacteria 1513
651 Ga0501045_0272086 3300049824 Bacteria 1261
652 Ga0501045_0348345 3300049824 Bacteria 1102
653 nmdc:mga03n38_128780_c1 3300050490 Bacteria 1252
654 nmdc:mga0k408_1178_c1 3300050493 Bacteria 14303
655 nmdc:mga06z11_210692_c1 3300050494 Bacteria 1132
656 nmdc:mga06z11_243300_c1 3300050494 Bacteria 1057
657 nmdc:mga06z11_34628_c1 3300050494 Bacteria 2481
658 nmdc:mga05p37_1071903_c1 3300050507 Bacteria 847
659 nmdc:mga05p37_267894_c1 3300050507 Bacteria 2042
660 nmdc:mga05p37_393402_c1 3300050507 Bacteria 1620
661 nmdc:mga05p37_511932_c1 3300050507 Bacteria 1375
662 nmdc:mga05p37_71942_c1 3300050507 Bacteria 4255
663 nmdc:mga09592_254716_c1 3300050508 Bacteria 1521
664 nmdc:mga09592_58490_c1 3300050508 Bacteria 3259
665 nmdc:mga0qj67_139422_c1 3300050509 Bacteria 1966
666 nmdc:mga0qj67_182709_c1 3300050509 Bacteria 1703
667 nmdc:mga06r32_165971_c1 3300050510 Bacteria 2191
668 nmdc:mga06r32_627354_c1 3300050510 Bacteria 1044
669 nmdc:mga06r32_7080_c1 3300050510 Bacteria 10094
670 nmdc:mga06r32_82668_c1 3300050510 Bacteria 3129
671 nmdc:mga06r32_97705_c1 3300050510 Bacteria 2878
672 nmdc:mga08y16_117465_c1 3300050511 Bacteria 2768
673 nmdc:mga08y16_39235_c1 3300050511 Unclassified 4969
674 nmdc:mga08y16_403685_c1 3300050511 Bacteria 1398
675 nmdc:mga08y16_419863_c1 3300050511 Bacteria 1367
676 nmdc:mga08y16_480387_c1 3300050511 Bacteria 1264
677 nmdc:mga08y16_739_c1 3300050511 Bacteria 31074
678 nmdc:mga0n895_1055_c1 3300050512 Bacteria 20087
679 nmdc:mga0n895_15813_c1 3300050512 Bacteria 6900
680 nmdc:mga0n895_164058_c1 3300050512 Bacteria 2253
681 nmdc:mga0n895_292324_c1 3300050512 Bacteria 1652
682 nmdc:mga0n895_66262_c1 3300050512 Bacteria 3576
683 nmdc:mga0rr50_132430_c1 3300050513 Bacteria 1998
684 nmdc:mga0rr50_13456_c1 3300050513 Bacteria 5327
685 nmdc:mga0rr50_229666_c1 3300050513 Bacteria 1535
686 nmdc:mga0rr50_236124_c1 3300050513 Bacteria 1514
687 nmdc:mga0rr50_89109_c1 3300050513 Bacteria 2398
688 nmdc:mga0rr50_95687_c1 3300050513 Bacteria 2322
689 nmdc:mga08x19_131776_c1 3300050514 Bacteria 1682
690 nmdc:mga0a205_37510_c1 3300050515 Bacteria 4660
691 nmdc:mga0a205_427978_c1 3300050515 Bacteria 1185
692 nmdc:mga0a205_84335_c1 3300050515 Bacteria 3069
693 Ga0495619_0391646 3300053085 Bacteria 960
694 Ga0500628_016766 3300053129 Bacteria 1421
695 Ga0500628_021855 3300053129 Bacteria 1303
696 Ga0501084_0624591 3300054114 Bacteria 910
697 Ga0590071_000810 3300059421 Bacteria 8733
698 Ga0590075_000256 3300059424 Bacteria 14991
699 Ga0590075_022287 3300059424 Bacteria 1585
700 Ga0590077_000858 3300059426 Bacteria 7792
701 Ga0590077_003633 3300059426 Bacteria 3188
702 Ga0501082_0055759 3300060353 Bacteria 3404
703 Ga0501082_0182993 3300060353 Bacteria 1823
704 Ga0501082_0282621 3300060353 Bacteria 1444
705 Ga0501082_0521983 3300060353 Bacteria 1038
706 Ga0530510_0063833 3300061734 Bacteria 2667
707 Ga0530510_0564406 3300061734 Bacteria 865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0020387 Ga0501069_0020387_3016_3579 179
2 3300041509 Ga0451843_0404721 Ga0451843_0404721_13_573 186
3 3300036401 Ga0373937_0291055 Ga0373937_0291055_269_949 191
4 3300037068 Ga0373925_0336091 Ga0373925_0336091_90_773 194
5 3300009094 Ga0111539_10000253 Ga0111539_1000025342 196
6 3300027907 Ga0207428_10005133 Ga0207428_100051339 196
7 3300031911 Ga0307412_10078519 Ga0307412_100785194 199
8 3300032002 Ga0307416_100288535 Ga0307416_1002885352 201
9 3300032004 Ga0307414_10203522 Ga0307414_102035222 201
10 3300032005 Ga0307411_10020596 Ga0307411_100205963 201
11 3300009094 Ga0111539_10467792 Ga0111539_104677921 202
12 3300005364 Ga0070673_100439641 Ga0070673_1004396412 203
13 3300005365 Ga0070688_100489244 Ga0070688_1004892441 203
14 3300025960 Ga0207651_10228472 Ga0207651_102284722 203
15 3300049576 Ga0501040_0035844 Ga0501040_0035844_1096_1770 203
16 3300049577 Ga0501041_0041438 Ga0501041_0041438_1467_2141 203
17 3300049580 Ga0501046_0127346 Ga0501046_0127346_232_906 203
18 3300049582 Ga0501048_0036313 Ga0501048_0036313_1433_2107 203
19 3300049587 Ga0501071_0097243 Ga0501071_0097243_1202_1876 203
20 3300049592 Ga0501076_0235578 Ga0501076_0235578_447_1121 203
21 3300049741 Ga0501079_0414127 Ga0501079_0414127_436_1047 203
22 3300049741 Ga0501079_0461654 Ga0501079_0461654_44_718 203
23 3300049742 Ga0501080_0770802 Ga0501080_0770802_103_777 203
24 3300049822 Ga0501035_0459386 Ga0501035_0459386_353_1027 203
25 3300049824 Ga0501045_0272086 Ga0501045_0272086_417_1091 203
26 3300054114 Ga0501084_0624591 Ga0501084_0624591_121_795 203
27 3300060353 Ga0501082_0182993 Ga0501082_0182993_990_1664 203
28 3300060353 Ga0501082_0521983 Ga0501082_0521983_197_871 204
29 3300005337 Ga0070682_100124406 Ga0070682_1001244063 205
30 3300005366 Ga0070659_100041253 Ga0070659_1000412533 205
31 3300025932 Ga0207690_10020688 Ga0207690_100206883 206
32 3300036401 Ga0373937_0791042 Ga0373937_0791042_195_878 206
33 3300046533 Ga0495640_0337106 Ga0495640_0337106_64_747 206
34 3300046559 Ga0495667_0180617 Ga0495667_0180617_30_713 206
35 3300046642 Ga0495634_0343146 Ga0495634_0343146_110_793 206
36 3300048907 Ga0496104_0408010 Ga0496104_0408010_553_1236 206
37 3300053085 Ga0495619_0391646 Ga0495619_0391646_262_945 206
38 3300005293 Ga0065715_10095823 Ga0065715_100958235 207
39 3300028381 Ga0268264_10007621 Ga0268264_100076214 207
40 3300042004 Ga0439445_0021089 Ga0439445_0021089_703_1374 208
41 3300042156 Ga0439446_0076565 Ga0439446_0076565_335_1006 208
42 3300050513 nmdc:mga0rr50_229666_c1 nmdc:mga0rr50_229666_c1_558_1220 208
43 3300005518 Ga0070699_100012762 Ga0070699_1000127628 209
44 3300006844 Ga0075428_100103590 Ga0075428_1001035902 209
45 3300006846 Ga0075430_100025586 Ga0075430_1000255863 209
46 3300006847 Ga0075431_100020518 Ga0075431_1000205183 209
47 3300006880 Ga0075429_100461716 Ga0075429_1004617162 209
48 3300009147 Ga0114129_10091479 Ga0114129_100914793 209
49 3300050507 nmdc:mga05p37_71942_c1 nmdc:mga05p37_71942_c1_1010_1681 209
50 3300050508 nmdc:mga09592_58490_c1 nmdc:mga09592_58490_c1_830_1501 209
51 3300050509 nmdc:mga0qj67_139422_c1 nmdc:mga0qj67_139422_c1_807_1478 209
52 3300050510 nmdc:mga06r32_82668_c1 nmdc:mga06r32_82668_c1_789_1460 209
53 3300005290 Ga0065712_10091706 Ga0065712_100917063 211
54 3300005356 Ga0070674_100370545 Ga0070674_1003705452 211
55 3300005549 Ga0070704_100208573 Ga0070704_1002085732 211
56 3300049571 Ga0501034_0192634 Ga0501034_0192634_705_1394 211
57 3300049579 Ga0501043_0219065 Ga0501043_0219065_598_1287 211
58 3300049581 Ga0501047_0028729 Ga0501047_0028729_2791_3480 211
59 3300049586 Ga0501070_0503380 Ga0501070_0503380_224_913 211
60 3300049823 Ga0501044_0015771 Ga0501044_0015771_4925_5614 211
61 3300005353 Ga0070669_100162072 Ga0070669_1001620722 212
62 3300005354 Ga0070675_100325192 Ga0070675_1003251921 212
63 3300005356 Ga0070674_100111820 Ga0070674_1001118202 212
64 3300005530 Ga0070679_100568634 Ga0070679_1005686342 212
65 3300006871 Ga0075434_100267612 Ga0075434_1002676123 212
66 3300006914 Ga0075436_100028414 Ga0075436_1000284144 212
67 3300007076 Ga0075435_100119361 Ga0075435_1001193613 212
68 3300025923 Ga0207681_10101372 Ga0207681_101013722 212
69 3300025937 Ga0207669_10028054 Ga0207669_100280543 212
70 3300025972 Ga0207668_10247533 Ga0207668_102475332 212
71 3300037471 Ga0395905_0844249 Ga0395905_0844249_88_765 212
72 3300048915 Ga0496112_0029044 Ga0496112_0029044_2041_2826 212
73 3300050512 nmdc:mga0n895_15813_c1 nmdc:mga0n895_15813_c1_391_1071 212
74 3300050515 nmdc:mga0a205_427978_c1 nmdc:mga0a205_427978_c1_385_1065 212
75 3300009094 Ga0111539_10144545 Ga0111539_101445454 213
76 3300042156 Ga0439446_0033837 Ga0439446_0033837_323_997 213
77 3300050511 nmdc:mga08y16_117465_c1 nmdc:mga08y16_117465_c1_526_1212 213
78 3300003203 JGI25406J46586_10007722 JGI25406J46586_100077223 214
79 3300005331 Ga0070670_100071634 Ga0070670_1000716342 214
80 3300005344 Ga0070661_100096402 Ga0070661_1000964023 214
81 3300005355 Ga0070671_100128670 Ga0070671_1001286702 214
82 3300005367 Ga0070667_100164100 Ga0070667_1001641003 214
83 3300005455 Ga0070663_100348092 Ga0070663_1003480922 214
84 3300005544 Ga0070686_100542948 Ga0070686_1005429482 214
85 3300005564 Ga0070664_100002524 Ga0070664_1000025247 214
86 3300005985 Ga0081539_10000106 Ga0081539_1000010657 214
87 3300013306 Ga0163162_10662496 Ga0163162_106624962 214
88 3300025920 Ga0207649_10061520 Ga0207649_100615203 214
89 3300025925 Ga0207650_10008282 Ga0207650_100082824 214
90 3300025941 Ga0207711_10217190 Ga0207711_102171901 214
91 3300025942 Ga0207689_10138462 Ga0207689_101384623 214
92 3300025944 Ga0207661_10001149 Ga0207661_100011496 214
93 3300025945 Ga0207679_10005938 Ga0207679_100059387 214
94 3300025986 Ga0207658_10136941 Ga0207658_101369412 214
95 3300026067 Ga0207678_10148174 Ga0207678_101481742 214
96 3300026095 Ga0207676_10502706 Ga0207676_105027061 214
97 3300048912 Ga0496109_0001883 Ga0496109_0001883_16503_17174 214
98 3300048912 Ga0496109_0237155 Ga0496109_0237155_872_1555 214
99 3300048913 Ga0496110_0001704 Ga0496110_0001704_7593_8264 214
100 3300048914 Ga0496111_0035301 Ga0496111_0035301_1614_2285 214
101 3300048915 Ga0496112_0056723 Ga0496112_0056723_2197_2868 214
102 3300050512 nmdc:mga0n895_164058_c1 nmdc:mga0n895_164058_c1_374_1045 214
103 3300005545 Ga0070695_100248454 Ga0070695_1002484542 215
104 3300005578 Ga0068854_100358164 Ga0068854_1003581642 215
105 3300006178 Ga0075367_10241406 Ga0075367_102414061 215
106 3300025937 Ga0207669_10380093 Ga0207669_103800932 215
107 3300025940 Ga0207691_10342973 Ga0207691_103429732 215
108 3300026116 Ga0207674_10833870 Ga0207674_108338702 215
109 3300050494 nmdc:mga06z11_210692_c1 nmdc:mga06z11_210692_c1_438_1088 215
110 3300053129 Ga0500628_016766 Ga0500628_016766_390_1073 215
111 3300005354 Ga0070675_100005848 Ga0070675_1000058486 216
112 3300005356 Ga0070674_100006975 Ga0070674_1000069752 216
113 3300005365 Ga0070688_100043058 Ga0070688_1000430582 216
114 3300005367 Ga0070667_100036013 Ga0070667_1000360131 216
115 3300005438 Ga0070701_10031025 Ga0070701_100310251 216
116 3300005444 Ga0070694_100081847 Ga0070694_1000818473 216
117 3300005444 Ga0070694_100113810 Ga0070694_1001138101 216
118 3300005455 Ga0070663_100062034 Ga0070663_1000620343 216
119 3300005459 Ga0068867_100006574 Ga0068867_1000065743 216
120 3300005467 Ga0070706_100832332 Ga0070706_1008323321 216
121 3300005468 Ga0070707_100243467 Ga0070707_1002434673 216
122 3300005468 Ga0070707_100265784 Ga0070707_1002657842 216
123 3300005471 Ga0070698_100242251 Ga0070698_1002422512 216
124 3300005544 Ga0070686_100006552 Ga0070686_1000065523 216
125 3300005549 Ga0070704_100062260 Ga0070704_1000622602 216
126 3300005615 Ga0070702_100433717 Ga0070702_1004337172 216
127 3300005617 Ga0068859_100019849 Ga0068859_1000198493 216
128 3300005618 Ga0068864_100134476 Ga0068864_1001344762 216
129 3300005719 Ga0068861_100010900 Ga0068861_1000109004 216
130 3300005841 Ga0068863_100042922 Ga0068863_1000429223 216
131 3300005842 Ga0068858_100005046 Ga0068858_10000504612 216
132 3300005843 Ga0068860_100079061 Ga0068860_1000790612 216
133 3300005844 Ga0068862_100032432 Ga0068862_1000324323 216
134 3300006038 Ga0075365_10114053 Ga0075365_101140533 216
135 3300006048 Ga0075363_100361720 Ga0075363_1003617202 216
136 3300006051 Ga0075364_10241359 Ga0075364_102413592 216
137 3300006177 Ga0075362_10004952 Ga0075362_100049524 216
138 3300006178 Ga0075367_10050056 Ga0075367_100500562 216
139 3300006195 Ga0075366_10000340 Ga0075366_1000034015 216
140 3300006846 Ga0075430_100045984 Ga0075430_1000459842 216
141 3300006846 Ga0075430_100155366 Ga0075430_1001553662 216
142 3300006871 Ga0075434_100055428 Ga0075434_1000554284 216
143 3300006931 Ga0097620_100019848 Ga0097620_1000198486 216
144 3300009094 Ga0111539_10003215 Ga0111539_100032156 216
145 3300009147 Ga0114129_10080023 Ga0114129_100800232 216
146 3300009148 Ga0105243_10002751 Ga0105243_1000275111 216
147 3300009177 Ga0105248_10024378 Ga0105248_100243786 216
148 3300009553 Ga0105249_10041995 Ga0105249_100419953 216
149 3300009553 Ga0105249_10150337 Ga0105249_101503372 216
150 3300013308 Ga0157375_10079505 Ga0157375_100795053 216
151 3300014326 Ga0157380_10070744 Ga0157380_100707443 216
152 3300014968 Ga0157379_10012602 Ga0157379_100126023 216
153 3300025907 Ga0207645_10177585 Ga0207645_101775852 216
154 3300025908 Ga0207643_10032604 Ga0207643_100326043 216
155 3300025910 Ga0207684_10944923 Ga0207684_109449231 216
156 3300025918 Ga0207662_10001930 Ga0207662_100019303 216
157 3300025922 Ga0207646_10092492 Ga0207646_100924924 216
158 3300025937 Ga0207669_10005893 Ga0207669_100058936 216
159 3300025938 Ga0207704_10013084 Ga0207704_100130844 216
160 3300025942 Ga0207689_10013122 Ga0207689_100131224 216
161 3300025961 Ga0207712_10041096 Ga0207712_100410963 216
162 3300025986 Ga0207658_10656217 Ga0207658_106562172 216
163 3300026023 Ga0207677_10231171 Ga0207677_102311712 216
164 3300026035 Ga0207703_10021915 Ga0207703_100219155 216
165 3300026067 Ga0207678_10069168 Ga0207678_100691683 216
166 3300026075 Ga0207708_10005930 Ga0207708_100059307 216
167 3300026088 Ga0207641_10113057 Ga0207641_101130573 216
168 3300026089 Ga0207648_10003433 Ga0207648_100034337 216
169 3300026095 Ga0207676_10127093 Ga0207676_101270933 216
170 3300026116 Ga0207674_10089673 Ga0207674_100896733 216
171 3300026118 Ga0207675_100008779 Ga0207675_1000087795 216
172 3300026121 Ga0207683_10033865 Ga0207683_100338654 216
173 3300027907 Ga0207428_10000085 Ga0207428_1000008591 216
174 3300028380 Ga0268265_10045365 Ga0268265_100453652 216
175 3300028381 Ga0268264_10611157 Ga0268264_106111572 216
176 3300035725 Ga0373947_0025933 Ga0373947_0025933_722_1393 216
177 3300039062 Ga0400483_032668 Ga0400483_032668_2302_2952 216
178 3300039062 Ga0400483_248230 Ga0400483_248230_5330_5980 216
179 3300049572 Ga0501036_0044850 Ga0501036_0044850_998_1648 216
180 3300049577 Ga0501041_0169242 Ga0501041_0169242_130_780 216
181 3300049578 Ga0501042_0244947 Ga0501042_0244947_198_848 216
182 3300049582 Ga0501048_0012795 Ga0501048_0012795_288_938 216
183 3300049584 Ga0501068_0416745 Ga0501068_0416745_164_814 216
184 3300049588 Ga0501072_0071364 Ga0501072_0071364_1357_2007 216
185 3300049591 Ga0501075_0021816 Ga0501075_0021816_549_1199 216
186 3300049592 Ga0501076_0034496 Ga0501076_0034496_826_1476 216
187 3300049824 Ga0501045_0348345 Ga0501045_0348345_241_891 216
188 3300050493 nmdc:mga0k408_1178_c1 nmdc:mga0k408_1178_c1_2121_2771 216
189 3300050494 nmdc:mga06z11_34628_c1 nmdc:mga06z11_34628_c1_1292_1942 216
190 3300050507 nmdc:mga05p37_1071903_c1 nmdc:mga05p37_1071903_c1_99_749 216
191 3300050507 nmdc:mga05p37_393402_c1 nmdc:mga05p37_393402_c1_380_1030 216
192 3300050508 nmdc:mga09592_254716_c1 nmdc:mga09592_254716_c1_804_1454 216
193 3300050509 nmdc:mga0qj67_182709_c1 nmdc:mga0qj67_182709_c1_698_1348 216
194 3300050510 nmdc:mga06r32_7080_c1 nmdc:mga06r32_7080_c1_8406_9056 216
195 3300050510 nmdc:mga06r32_97705_c1 nmdc:mga06r32_97705_c1_567_1217 216
196 3300050511 nmdc:mga08y16_739_c1 nmdc:mga08y16_739_c1_9259_9909 216
197 3300050513 nmdc:mga0rr50_13456_c1 nmdc:mga0rr50_13456_c1_1927_2577 216
198 3300050515 nmdc:mga0a205_37510_c1 nmdc:mga0a205_37510_c1_501_1151 216
199 3300060353 Ga0501082_0055759 Ga0501082_0055759_1978_2628 216
200 iso_pu_bacteria 2554235227 2555231249 216
201 iso_pu_bacteria 2654587600 2655032911 216
202 3300009094 Ga0111539_10428297 Ga0111539_104282972 217
203 3300042005 Ga0439448_0156988 Ga0439448_0156988_87_767 217
204 3300050490 nmdc:mga03n38_128780_c1 nmdc:mga03n38_128780_c1_372_1025 217
205 3300050511 nmdc:mga08y16_480387_c1 nmdc:mga08y16_480387_c1_405_1058 217
206 3300005327 Ga0070658_10445547 Ga0070658_104455472 218
207 3300006871 Ga0075434_100523532 Ga0075434_1005235322 218
208 3300006914 Ga0075436_100087038 Ga0075436_1000870383 218
209 3300050514 nmdc:mga08x19_131776_c1 nmdc:mga08x19_131776_c1_683_1369 218
210 3300014969 Ga0157376_10095204 Ga0157376_100952042 219
211 3300025921 Ga0207652_10382824 Ga0207652_103828242 219
212 3300038727 Ga0400491_22105 Ga0400491_22105_38_697 219
213 3300038735 Ga0400485_10833 Ga0400485_10833_12037_12696 219
214 3300038742 Ga0400486_01644 Ga0400486_01644_58761_59420 219
215 3300038742 Ga0400486_13502 Ga0400486_13502_31995_32654 219
216 3300039110 Ga0400487_35213 Ga0400487_35213_1331_1990 219
217 3300039110 Ga0400487_39899 Ga0400487_39899_60974_61633 219
218 3300044712 Ga0453684_0005948 Ga0453684_0005948_22702_23388 219
219 3300044712 Ga0453684_0280745 Ga0453684_0280745_48_710 219
220 3300046522 Ga0495643_0006118 Ga0495643_0006118_2693_3376 219
221 3300049577 Ga0501041_0144180 Ga0501041_0144180_62_721 219
222 3300049582 Ga0501048_0058057 Ga0501048_0058057_357_1016 219
223 3300049592 Ga0501076_0303958 Ga0501076_0303958_212_871 219
224 3300049824 Ga0501045_0019410 Ga0501045_0019410_241_900 219
225 3300061734 Ga0530510_0063833 Ga0530510_0063833_1950_2609 219
226 3300005327 Ga0070658_10167972 Ga0070658_101679722 220
227 3300005333 Ga0070677_10082361 Ga0070677_100823612 220
228 3300005344 Ga0070661_100432110 Ga0070661_1004321101 220
229 3300005354 Ga0070675_100618289 Ga0070675_1006182892 220
230 3300005366 Ga0070659_100050970 Ga0070659_1000509705 220
231 3300005367 Ga0070667_100280976 Ga0070667_1002809762 220
232 3300005434 Ga0070709_10167110 Ga0070709_101671102 220
233 3300005444 Ga0070694_100309030 Ga0070694_1003090302 220
234 3300005457 Ga0070662_100241251 Ga0070662_1002412513 220
235 3300005466 Ga0070685_10007355 Ga0070685_100073552 220
236 3300005539 Ga0068853_100226260 Ga0068853_1002262602 220
237 3300005547 Ga0070693_100037985 Ga0070693_1000379854 220
238 3300005548 Ga0070665_100002913 Ga0070665_10000291317 220
239 3300005564 Ga0070664_100492557 Ga0070664_1004925572 220
240 3300005616 Ga0068852_100191629 Ga0068852_1001916292 220
241 3300005834 Ga0068851_10193709 Ga0068851_101937092 220
242 3300005842 Ga0068858_100273211 Ga0068858_1002732111 220
243 3300009094 Ga0111539_10607802 Ga0111539_106078022 220
244 3300025893 Ga0207682_10030309 Ga0207682_100303092 220
245 3300025903 Ga0207680_10021143 Ga0207680_100211435 220
246 3300025907 Ga0207645_10007927 Ga0207645_100079276 220
247 3300025909 Ga0207705_10137462 Ga0207705_101374622 220
248 3300025918 Ga0207662_10004273 Ga0207662_100042737 220
249 3300025926 Ga0207659_10678717 Ga0207659_106787172 220
250 3300025933 Ga0207706_10100215 Ga0207706_101002152 220
251 3300025940 Ga0207691_10438000 Ga0207691_104380002 220
252 3300025942 Ga0207689_10057438 Ga0207689_100574383 220
253 3300026041 Ga0207639_10612819 Ga0207639_106128192 220
254 3300026089 Ga0207648_10123543 Ga0207648_101235432 220
255 3300026121 Ga0207683_10064623 Ga0207683_100646232 220
256 3300026142 Ga0207698_10157919 Ga0207698_101579192 220
257 3300028379 Ga0268266_10002732 Ga0268266_1000273215 220
258 3300031727 Ga0316576_10121623 Ga0316576_101216233 220
259 3300031733 Ga0316577_10239459 Ga0316577_102394592 220
260 3300031911 Ga0307412_10279405 Ga0307412_102794052 220
261 3300032133 Ga0316583_10007523 Ga0316583_100075233 220
262 3300032139 Ga0316580_10038502 Ga0316580_100385022 220
263 3300036647 Ga0316582_0107406 Ga0316582_0107406_967_1629 220
264 3300036712 Ga0316584_0028588 Ga0316584_0028588_3112_3774 220
265 3300039062 Ga0400483_232829 Ga0400483_232829_585_1247 220
266 3300046539 Ga0495621_0003713 Ga0495621_0003713_1213_1887 220
267 3300049744 Ga0501083_0000455 Ga0501083_0000455_17879_18541 220
268 3300005344 Ga0070661_100277839 Ga0070661_1002778392 221
269 3300005354 Ga0070675_100276395 Ga0070675_1002763952 221
270 3300005468 Ga0070707_100195861 Ga0070707_1001958612 221
271 3300013296 Ga0157374_10043530 Ga0157374_100435304 221
272 3300013308 Ga0157375_10183003 Ga0157375_101830032 221
273 3300014326 Ga0157380_10092723 Ga0157380_100927233 221
274 3300025901 Ga0207688_10238470 Ga0207688_102384702 221
275 3300025903 Ga0207680_10164132 Ga0207680_101641323 221
276 3300025922 Ga0207646_10172854 Ga0207646_101728543 221
277 3300025925 Ga0207650_10248611 Ga0207650_102486112 221
278 3300025939 Ga0207665_10293724 Ga0207665_102937242 221
279 3300042876 Ga0451577_0001333 Ga0451577_0001333_20904_21569 221
280 3300044712 Ga0453684_0000441 Ga0453684_0000441_70001_70666 221
281 3300044712 Ga0453684_0003492 Ga0453684_0003492_1821_2489 221
282 3300046537 Ga0495598_0035860 Ga0495598_0035860_448_1125 221
283 3300046539 Ga0495621_0021505 Ga0495621_0021505_916_1593 221
284 3300046558 Ga0495633_0028137 Ga0495633_0028137_1490_2167 221
285 3300046691 Ga0495670_0058596 Ga0495670_0058596_686_1363 221
286 3300049582 Ga0501048_0100345 Ga0501048_0100345_25_696 221
287 3300050494 nmdc:mga06z11_243300_c1 nmdc:mga06z11_243300_c1_119_784 221
288 3300005336 Ga0070680_100664250 Ga0070680_1006642501 222
289 3300005341 Ga0070691_10036282 Ga0070691_100362823 222
290 3300005365 Ga0070688_100425928 Ga0070688_1004259282 222
291 3300005438 Ga0070701_10004888 Ga0070701_100048886 222
292 3300005440 Ga0070705_100000088 Ga0070705_10000008846 222
293 3300005444 Ga0070694_100007737 Ga0070694_1000077375 222
294 3300005536 Ga0070697_100155654 Ga0070697_1001556542 222
295 3300005545 Ga0070695_100000021 Ga0070695_10000002134 222
296 3300005546 Ga0070696_100000016 Ga0070696_10000001646 222
297 3300005548 Ga0070665_100301934 Ga0070665_1003019342 222
298 3300005549 Ga0070704_100350785 Ga0070704_1003507852 222
299 3300005615 Ga0070702_100024288 Ga0070702_1000242883 222
300 3300006846 Ga0075430_100115480 Ga0075430_1001154803 222
301 3300006871 Ga0075434_100001393 Ga0075434_10000139311 222
302 3300009093 Ga0105240_10920090 Ga0105240_109200901 222
303 3300009545 Ga0105237_10007566 Ga0105237_1000756610 222
304 3300025912 Ga0207707_10067961 Ga0207707_100679612 222
305 3300025913 Ga0207695_10677417 Ga0207695_106774171 222
306 3300025914 Ga0207671_10022996 Ga0207671_100229966 222
307 3300025917 Ga0207660_10088488 Ga0207660_100884882 222
308 3300031548 Ga0307408_100043786 Ga0307408_1000437863 222
309 3300031731 Ga0307405_10029783 Ga0307405_100297833 222
310 3300031824 Ga0307413_10013614 Ga0307413_100136142 222
311 3300031852 Ga0307410_10011533 Ga0307410_100115336 222
312 3300031852 Ga0307410_10332085 Ga0307410_103320851 222
313 3300031901 Ga0307406_10019269 Ga0307406_100192695 222
314 3300031903 Ga0307407_10026375 Ga0307407_100263753 222
315 3300031911 Ga0307412_10028538 Ga0307412_100285383 222
316 3300031995 Ga0307409_100002483 Ga0307409_10000248313 222
317 3300031995 Ga0307409_100133809 Ga0307409_1001338093 222
318 3300032002 Ga0307416_100002720 Ga0307416_1000027202 222
319 3300032004 Ga0307414_10149177 Ga0307414_101491772 222
320 3300032005 Ga0307411_10013381 Ga0307411_100133815 222
321 3300032126 Ga0307415_100039123 Ga0307415_1000391232 222
322 3300032126 Ga0307415_100775477 Ga0307415_1007754771 222
323 3300042876 Ga0451577_0103059 Ga0451577_0103059_1284_1964 222
324 3300045051 Ga0451576_0027569 Ga0451576_0027569_2341_3021 222
325 3300045051 Ga0451576_0271090 Ga0451576_0271090_559_1239 222
326 3300046648 Ga0495611_0150681 Ga0495611_0150681_79_759 222
327 3300046664 Ga0495659_0023876 Ga0495659_0023876_330_1010 222
328 3300047318 Ga0495636_0008433 Ga0495636_0008433_2533_3213 222
329 3300047447 Ga0495685_013370 Ga0495685_013370_655_1335 222
330 3300049591 Ga0501075_0176420 Ga0501075_0176420_177_857 222
331 3300050512 nmdc:mga0n895_1055_c1 nmdc:mga0n895_1055_c1_8413_9093 222
332 3300061734 Ga0530510_0564406 Ga0530510_0564406_15_695 222
333 3300005293 Ga0065715_10145282 Ga0065715_101452822 223
334 3300005295 Ga0065707_10086593 Ga0065707_100865937 223
335 3300005336 Ga0070680_100543053 Ga0070680_1005430532 223
336 3300005337 Ga0070682_100320152 Ga0070682_1003201522 223
337 3300005353 Ga0070669_100001038 Ga0070669_10000103812 223
338 3300005354 Ga0070675_100042144 Ga0070675_1000421444 223
339 3300005364 Ga0070673_100912044 Ga0070673_1009120441 223
340 3300005366 Ga0070659_100169075 Ga0070659_1001690752 223
341 3300005438 Ga0070701_10037172 Ga0070701_100371722 223
342 3300005439 Ga0070711_100222459 Ga0070711_1002224592 223
343 3300005455 Ga0070663_100282954 Ga0070663_1002829541 223
344 3300005458 Ga0070681_10011368 Ga0070681_100113684 223
345 3300005530 Ga0070679_100208385 Ga0070679_1002083852 223
346 3300005577 Ga0068857_100098931 Ga0068857_1000989313 223
347 3300005578 Ga0068854_100170512 Ga0068854_1001705122 223
348 3300005840 Ga0068870_10016974 Ga0068870_100169742 223
349 3300005844 Ga0068862_100242253 Ga0068862_1002422532 223
350 3300006237 Ga0097621_100343388 Ga0097621_1003433882 223
351 3300006844 Ga0075428_100007242 Ga0075428_1000072425 223
352 3300006847 Ga0075431_100034489 Ga0075431_1000344897 223
353 3300006852 Ga0075433_10071902 Ga0075433_100719024 223
354 3300007076 Ga0075435_100302214 Ga0075435_1003022142 223
355 3300009094 Ga0111539_10017868 Ga0111539_100178689 223
356 3300009094 Ga0111539_10064568 Ga0111539_100645686 223
357 3300009147 Ga0114129_10005104 Ga0114129_100051043 223
358 3300009147 Ga0114129_10206620 Ga0114129_102066202 223
359 3300009553 Ga0105249_10001485 Ga0105249_1000148514 223
360 3300010375 Ga0105239_10933960 Ga0105239_109339602 223
361 3300011119 Ga0105246_10642612 Ga0105246_106426122 223
362 3300014745 Ga0157377_10197591 Ga0157377_101975912 223
363 3300025908 Ga0207643_10078032 Ga0207643_100780323 223
364 3300025912 Ga0207707_10056337 Ga0207707_100563373 223
365 3300025917 Ga0207660_10458681 Ga0207660_104586812 223
366 3300025921 Ga0207652_10031233 Ga0207652_100312332 223
367 3300025923 Ga0207681_10013643 Ga0207681_100136433 223
368 3300025937 Ga0207669_10361057 Ga0207669_103610572 223
369 3300025940 Ga0207691_10346539 Ga0207691_103465392 223
370 3300026116 Ga0207674_10114204 Ga0207674_101142043 223
371 3300026116 Ga0207674_10523703 Ga0207674_105237032 223
372 3300027717 Ga0209998_10011182 Ga0209998_100111822 223
373 3300027907 Ga0207428_10070310 Ga0207428_100703102 223
374 3300028380 Ga0268265_10038871 Ga0268265_100388712 223
375 3300028380 Ga0268265_10211815 Ga0268265_102118152 223
376 3300031548 Ga0307408_100337784 Ga0307408_1003377842 223
377 3300031852 Ga0307410_10316653 Ga0307410_103166532 223
378 3300031995 Ga0307409_100031724 Ga0307409_1000317243 223
379 3300031995 Ga0307409_100069918 Ga0307409_1000699182 223
380 3300032002 Ga0307416_100097334 Ga0307416_1000973344 223
381 3300032005 Ga0307411_10657410 Ga0307411_106574102 223
382 3300035170 Ga0373943_0322151 Ga0373943_0322151_127_798 223
383 3300042435 Ga0439434_0015830 Ga0439434_0015830_646_1317 223
384 3300042876 Ga0451577_0037691 Ga0451577_0037691_1042_1731 223
385 3300044712 Ga0453684_0024766 Ga0453684_0024766_1261_1950 223
386 3300044712 Ga0453684_0048385 Ga0453684_0048385_1997_2671 223
387 3300046475 Ga0495639_0161727 Ga0495639_0161727_310_981 223
388 3300048907 Ga0496104_0196663 Ga0496104_0196663_786_1475 223
389 3300048915 Ga0496112_0070709 Ga0496112_0070709_1427_2116 223
390 3300049574 Ga0501038_0564095 Ga0501038_0564095_31_711 223
391 3300049588 Ga0501072_0540346 Ga0501072_0540346_157_831 223
392 3300049593 Ga0501077_0183534 Ga0501077_0183534_353_1024 223
393 3300049742 Ga0501080_0314393 Ga0501080_0314393_443_1114 223
394 3300050507 nmdc:mga05p37_267894_c1 nmdc:mga05p37_267894_c1_735_1421 223
395 3300050507 nmdc:mga05p37_511932_c1 nmdc:mga05p37_511932_c1_674_1345 223
396 3300050510 nmdc:mga06r32_165971_c1 nmdc:mga06r32_165971_c1_916_1587 223
397 3300050511 nmdc:mga08y16_39235_c1 nmdc:mga08y16_39235_c1_1876_2547 223
398 3300050513 nmdc:mga0rr50_95687_c1 nmdc:mga0rr50_95687_c1_1186_1857 223
399 3300050515 nmdc:mga0a205_84335_c1 nmdc:mga0a205_84335_c1_2024_2695 223
400 3300059421 Ga0590071_000810 Ga0590071_000810_3812_4513 223
401 3300059424 Ga0590075_000256 Ga0590075_000256_5448_6149 223
402 3300059424 Ga0590075_022287 Ga0590075_022287_87_770 223
403 3300059426 Ga0590077_000858 Ga0590077_000858_4927_5628 223
404 3300059426 Ga0590077_003633 Ga0590077_003633_594_1277 223
405 3300060353 Ga0501082_0282621 Ga0501082_0282621_403_1074 223
406 3300005289 Ga0065704_10004255 Ga0065704_100042553 224
407 3300005295 Ga0065707_10013372 Ga0065707_100133722 224
408 3300005295 Ga0065707_10114347 Ga0065707_101143472 224
409 3300005330 Ga0070690_100587910 Ga0070690_1005879101 224
410 3300005331 Ga0070670_100001697 Ga0070670_1000016977 224
411 3300005333 Ga0070677_10097759 Ga0070677_100977592 224
412 3300005333 Ga0070677_10129051 Ga0070677_101290512 224
413 3300005334 Ga0068869_100164040 Ga0068869_1001640403 224
414 3300005334 Ga0068869_100393231 Ga0068869_1003932312 224
415 3300005343 Ga0070687_100102897 Ga0070687_1001028972 224
416 3300005343 Ga0070687_100144082 Ga0070687_1001440822 224
417 3300005344 Ga0070661_100130333 Ga0070661_1001303333 224
418 3300005354 Ga0070675_100000507 Ga0070675_10000050714 224
419 3300005354 Ga0070675_100082077 Ga0070675_1000820774 224
420 3300005354 Ga0070675_100293529 Ga0070675_1002935291 224
421 3300005355 Ga0070671_100007835 Ga0070671_1000078358 224
422 3300005364 Ga0070673_100207766 Ga0070673_1002077662 224
423 3300005364 Ga0070673_100228049 Ga0070673_1002280492 224
424 3300005364 Ga0070673_100580737 Ga0070673_1005807372 224
425 3300005438 Ga0070701_10255049 Ga0070701_102550492 224
426 3300005440 Ga0070705_100215857 Ga0070705_1002158572 224
427 3300005457 Ga0070662_100241511 Ga0070662_1002415112 224
428 3300005459 Ga0068867_100010010 Ga0068867_1000100107 224
429 3300005468 Ga0070707_100040267 Ga0070707_1000402675 224
430 3300005468 Ga0070707_100076420 Ga0070707_1000764203 224
431 3300005468 Ga0070707_100534930 Ga0070707_1005349302 224
432 3300005471 Ga0070698_100001713 Ga0070698_10000171317 224
433 3300005471 Ga0070698_100404942 Ga0070698_1004049422 224
434 3300005471 Ga0070698_100591301 Ga0070698_1005913012 224
435 3300005518 Ga0070699_100003923 Ga0070699_10000392312 224
436 3300005518 Ga0070699_100054229 Ga0070699_1000542294 224
437 3300005518 Ga0070699_100091386 Ga0070699_1000913863 224
438 3300005543 Ga0070672_100009184 Ga0070672_1000091843 224
439 3300005543 Ga0070672_100258956 Ga0070672_1002589562 224
440 3300005544 Ga0070686_100435394 Ga0070686_1004353942 224
441 3300005546 Ga0070696_100023567 Ga0070696_1000235672 224
442 3300005549 Ga0070704_100000384 Ga0070704_1000003846 224
443 3300005564 Ga0070664_100020483 Ga0070664_1000204832 224
444 3300005564 Ga0070664_100258460 Ga0070664_1002584602 224
445 3300005577 Ga0068857_100042416 Ga0068857_1000424163 224
446 3300005618 Ga0068864_100054442 Ga0068864_1000544423 224
447 3300005719 Ga0068861_100016995 Ga0068861_1000169954 224
448 3300005840 Ga0068870_10003900 Ga0068870_100039004 224
449 3300005841 Ga0068863_100006191 Ga0068863_10000619115 224
450 3300005842 Ga0068858_100145183 Ga0068858_1001451833 224
451 3300005843 Ga0068860_100014433 Ga0068860_1000144336 224
452 3300005843 Ga0068860_101139891 Ga0068860_1011398912 224
453 3300005844 Ga0068862_100005891 Ga0068862_1000058918 224
454 3300006844 Ga0075428_100310513 Ga0075428_1003105132 224
455 3300006847 Ga0075431_100184693 Ga0075431_1001846932 224
456 3300006871 Ga0075434_100016592 Ga0075434_1000165923 224
457 3300006871 Ga0075434_100287489 Ga0075434_1002874893 224
458 3300006880 Ga0075429_100114599 Ga0075429_1001145992 224
459 3300007076 Ga0075435_100043029 Ga0075435_1000430294 224
460 3300009094 Ga0111539_10133175 Ga0111539_101331753 224
461 3300009094 Ga0111539_10582099 Ga0111539_105820992 224
462 3300009147 Ga0114129_10003607 Ga0114129_100036074 224
463 3300009148 Ga0105243_10094272 Ga0105243_100942723 224
464 3300009553 Ga0105249_10312288 Ga0105249_103122882 224
465 3300009553 Ga0105249_10533751 Ga0105249_105337512 224
466 3300013306 Ga0163162_10142684 Ga0163162_101426843 224
467 3300013308 Ga0157375_10035943 Ga0157375_100359434 224
468 3300013308 Ga0157375_10191689 Ga0157375_101916893 224
469 3300014325 Ga0163163_10298780 Ga0163163_102987802 224
470 3300014326 Ga0157380_10003938 Ga0157380_100039386 224
471 3300014326 Ga0157380_10007433 Ga0157380_100074337 224
472 3300014745 Ga0157377_10033384 Ga0157377_100333844 224
473 3300014745 Ga0157377_10327080 Ga0157377_103270802 224
474 3300014969 Ga0157376_10192398 Ga0157376_101923983 224
475 3300025893 Ga0207682_10045704 Ga0207682_100457043 224
476 3300025908 Ga0207643_10011995 Ga0207643_100119954 224
477 3300025908 Ga0207643_10047006 Ga0207643_100470062 224
478 3300025910 Ga0207684_10164619 Ga0207684_101646192 224
479 3300025917 Ga0207660_10583351 Ga0207660_105833511 224
480 3300025918 Ga0207662_10053313 Ga0207662_100533133 224
481 3300025918 Ga0207662_10282929 Ga0207662_102829292 224
482 3300025920 Ga0207649_10096597 Ga0207649_100965973 224
483 3300025922 Ga0207646_10159352 Ga0207646_101593523 224
484 3300025923 Ga0207681_10114701 Ga0207681_101147012 224
485 3300025926 Ga0207659_10000602 Ga0207659_1000060213 224
486 3300025926 Ga0207659_10020747 Ga0207659_100207474 224
487 3300025926 Ga0207659_10121177 Ga0207659_101211772 224
488 3300025926 Ga0207659_10222309 Ga0207659_102223092 224
489 3300025931 Ga0207644_10031630 Ga0207644_100316304 224
490 3300025933 Ga0207706_10174393 Ga0207706_101743933 224
491 3300025935 Ga0207709_10016003 Ga0207709_100160033 224
492 3300025936 Ga0207670_10006747 Ga0207670_100067475 224
493 3300025936 Ga0207670_10039776 Ga0207670_100397764 224
494 3300025940 Ga0207691_10042381 Ga0207691_100423814 224
495 3300025960 Ga0207651_10138287 Ga0207651_101382873 224
496 3300025960 Ga0207651_10203374 Ga0207651_102033743 224
497 3300025960 Ga0207651_10298169 Ga0207651_102981692 224
498 3300025960 Ga0207651_10304776 Ga0207651_103047762 224
499 3300025961 Ga0207712_10367480 Ga0207712_103674802 224
500 3300026035 Ga0207703_10338075 Ga0207703_103380752 224
501 3300026088 Ga0207641_10038115 Ga0207641_100381155 224
502 3300026089 Ga0207648_10000338 Ga0207648_1000033825 224
503 3300026095 Ga0207676_10047921 Ga0207676_100479212 224
504 3300026095 Ga0207676_11057397 Ga0207676_110573972 224
505 3300026116 Ga0207674_10035241 Ga0207674_100352415 224
506 3300026116 Ga0207674_10111526 Ga0207674_101115262 224
507 3300026118 Ga0207675_100007099 Ga0207675_1000070999 224
508 3300026121 Ga0207683_10106178 Ga0207683_101061781 224
509 3300027907 Ga0207428_10012432 Ga0207428_100124324 224
510 3300028380 Ga0268265_10003298 Ga0268265_100032987 224
511 3300028381 Ga0268264_10268238 Ga0268264_102682383 224
512 3300031548 Ga0307408_100450523 Ga0307408_1004505231 224
513 3300031548 Ga0307408_100878977 Ga0307408_1008789771 224
514 3300031731 Ga0307405_10000896 Ga0307405_100008962 224
515 3300031824 Ga0307413_10174498 Ga0307413_101744982 224
516 3300031852 Ga0307410_10008739 Ga0307410_100087392 224
517 3300031901 Ga0307406_10044831 Ga0307406_100448313 224
518 3300031903 Ga0307407_10026962 Ga0307407_100269621 224
519 3300031911 Ga0307412_10016850 Ga0307412_100168503 224
520 3300031995 Ga0307409_100025219 Ga0307409_1000252194 224
521 3300031995 Ga0307409_100159458 Ga0307409_1001594583 224
522 3300032002 Ga0307416_100045322 Ga0307416_1000453224 224
523 3300032004 Ga0307414_10208604 Ga0307414_102086042 224
524 3300032126 Ga0307415_100278341 Ga0307415_1002783412 224
525 3300039062 Ga0400483_020887 Ga0400483_020887_2218_2892 224
526 3300039062 Ga0400483_163516 Ga0400483_163516_1292_1966 224
527 3300041512 Ga0451853_2622050 Ga0451853_2622050_493_1167 224
528 3300042876 Ga0451577_0794019 Ga0451577_0794019_28_729 224
529 3300045051 Ga0451576_0051942 Ga0451576_0051942_1065_1766 224
530 3300045051 Ga0451576_0513240 Ga0451576_0513240_312_998 224
531 3300046664 Ga0495659_0001941 Ga0495659_0001941_4132_4818 224
532 3300046664 Ga0495659_0087353 Ga0495659_0087353_468_1154 224
533 3300047318 Ga0495636_0059286 Ga0495636_0059286_255_941 224
534 3300049572 Ga0501036_0018336 Ga0501036_0018336_3719_4399 224
535 3300049590 Ga0501074_0284580 Ga0501074_0284580_77_757 224
536 3300049591 Ga0501075_0036917 Ga0501075_0036917_1960_2640 224
537 3300049592 Ga0501076_0224136 Ga0501076_0224136_775_1455 224
538 3300049741 Ga0501079_0371620 Ga0501079_0371620_131_811 224
539 3300049824 Ga0501045_0194144 Ga0501045_0194144_529_1209 224
540 3300050510 nmdc:mga06r32_627354_c1 nmdc:mga06r32_627354_c1_37_726 224
541 3300050511 nmdc:mga08y16_419863_c1 nmdc:mga08y16_419863_c1_190_876 224
542 3300050512 nmdc:mga0n895_292324_c1 nmdc:mga0n895_292324_c1_339_1025 224
543 3300050512 nmdc:mga0n895_66262_c1 nmdc:mga0n895_66262_c1_685_1386 224
544 3300050513 nmdc:mga0rr50_132430_c1 nmdc:mga0rr50_132430_c1_1192_1893 224
545 3300050513 nmdc:mga0rr50_236124_c1 nmdc:mga0rr50_236124_c1_731_1417 224
546 3300050513 nmdc:mga0rr50_89109_c1 nmdc:mga0rr50_89109_c1_982_1668 224
547 3300005353 Ga0070669_100292179 Ga0070669_1002921792 225
548 3300005355 Ga0070671_100007203 Ga0070671_10000720312 225
549 3300005364 Ga0070673_100017570 Ga0070673_1000175703 225
550 3300005543 Ga0070672_100011132 Ga0070672_1000111323 225
551 3300006844 Ga0075428_100005224 Ga0075428_1000052245 225
552 3300009094 Ga0111539_10605960 Ga0111539_106059602 225
553 3300009098 Ga0105245_10457447 Ga0105245_104574472 225
554 3300009551 Ga0105238_10013846 Ga0105238_100138465 225
555 3300025321 Ga0207656_10010706 Ga0207656_100107063 225
556 3300025923 Ga0207681_10134573 Ga0207681_101345731 225
557 3300025924 Ga0207694_10008144 Ga0207694_100081445 225
558 3300025927 Ga0207687_10158580 Ga0207687_101585803 225
559 3300025928 Ga0207700_10093560 Ga0207700_100935602 225
560 3300025931 Ga0207644_10004034 Ga0207644_100040342 225
561 3300025933 Ga0207706_10219010 Ga0207706_102190102 225
562 3300025940 Ga0207691_10010354 Ga0207691_100103548 225
563 3300025942 Ga0207689_10240715 Ga0207689_102407152 225
564 3300025960 Ga0207651_10030995 Ga0207651_100309953 225
565 3300025986 Ga0207658_10576577 Ga0207658_105765771 225
566 3300026088 Ga0207641_10024334 Ga0207641_100243346 225
567 3300028380 Ga0268265_10192217 Ga0268265_101922171 225
568 3300035410 Ga0373924_0120057 Ga0373924_0120057_339_1028 225
569 3300035692 Ga0373935_0335291 Ga0373935_0335291_104_793 225
570 3300036401 Ga0373937_0048996 Ga0373937_0048996_2423_3112 225
571 3300046459 Ga0495629_0139680 Ga0495629_0139680_74_763 225
572 3300046539 Ga0495621_0000068 Ga0495621_0000068_14488_15195 225
573 3300049578 Ga0501042_0282449 Ga0501042_0282449_204_884 225
574 3300049587 Ga0501071_0350696 Ga0501071_0350696_351_1031 225
575 3300050511 nmdc:mga08y16_403685_c1 nmdc:mga08y16_403685_c1_410_1090 225
576 3300005293 Ga0065715_10123633 Ga0065715_101236333 226
577 3300005293 Ga0065715_10125501 Ga0065715_101255012 226
578 3300005328 Ga0070676_10027050 Ga0070676_100270502 226
579 3300005328 Ga0070676_10080427 Ga0070676_100804272 226
580 3300005330 Ga0070690_100016164 Ga0070690_1000161645 226
581 3300005333 Ga0070677_10273705 Ga0070677_102737051 226
582 3300005334 Ga0068869_100037657 Ga0068869_1000376572 226
583 3300005340 Ga0070689_100195013 Ga0070689_1001950133 226
584 3300005353 Ga0070669_100048750 Ga0070669_1000487503 226
585 3300005353 Ga0070669_100155340 Ga0070669_1001553402 226
586 3300005354 Ga0070675_100018512 Ga0070675_1000185123 226
587 3300005354 Ga0070675_100278005 Ga0070675_1002780053 226
588 3300005356 Ga0070674_100064208 Ga0070674_1000642083 226
589 3300005356 Ga0070674_100165627 Ga0070674_1001656273 226
590 3300005364 Ga0070673_100005587 Ga0070673_1000055877 226
591 3300005364 Ga0070673_100150870 Ga0070673_1001508701 226
592 3300005365 Ga0070688_100024728 Ga0070688_1000247284 226
593 3300005366 Ga0070659_100113055 Ga0070659_1001130553 226
594 3300005366 Ga0070659_100351219 Ga0070659_1003512192 226
595 3300005367 Ga0070667_100055899 Ga0070667_1000558994 226
596 3300005441 Ga0070700_100083824 Ga0070700_1000838242 226
597 3300005441 Ga0070700_100245413 Ga0070700_1002454131 226
598 3300005456 Ga0070678_100761011 Ga0070678_1007610111 226
599 3300005459 Ga0068867_100000734 Ga0068867_10000073418 226
600 3300005459 Ga0068867_100135236 Ga0068867_1001352362 226
601 3300005543 Ga0070672_100001095 Ga0070672_10000109516 226
602 3300005544 Ga0070686_100112701 Ga0070686_1001127012 226
603 3300005545 Ga0070695_100063380 Ga0070695_1000633803 226
604 3300005545 Ga0070695_100540290 Ga0070695_1005402901 226
605 3300005546 Ga0070696_100429362 Ga0070696_1004293622 226
606 3300005549 Ga0070704_100772804 Ga0070704_1007728041 226
607 3300005563 Ga0068855_100121796 Ga0068855_1001217964 226
608 3300005564 Ga0070664_100042543 Ga0070664_1000425433 226
609 3300005564 Ga0070664_100519406 Ga0070664_1005194062 226
610 3300005615 Ga0070702_100018918 Ga0070702_1000189183 226
611 3300005616 Ga0068852_100116359 Ga0068852_1001163593 226
612 3300005617 Ga0068859_100240472 Ga0068859_1002404722 226
613 3300005618 Ga0068864_100296120 Ga0068864_1002961202 226
614 3300005718 Ga0068866_10003129 Ga0068866_100031299 226
615 3300005840 Ga0068870_10145269 Ga0068870_101452692 226
616 3300005842 Ga0068858_100180871 Ga0068858_1001808713 226
617 3300005843 Ga0068860_100039025 Ga0068860_1000390254 226
618 3300005843 Ga0068860_100082549 Ga0068860_1000825494 226
619 3300005843 Ga0068860_100507041 Ga0068860_1005070412 226
620 3300005843 Ga0068860_101206537 Ga0068860_1012065371 226
621 3300005844 Ga0068862_100428638 Ga0068862_1004286383 226
622 3300005844 Ga0068862_100566224 Ga0068862_1005662242 226
623 3300006881 Ga0068865_100002495 Ga0068865_10000249510 226
624 3300006931 Ga0097620_100240472 Ga0097620_1002404722 226
625 3300007076 Ga0075435_100105118 Ga0075435_1001051182 226
626 3300009148 Ga0105243_10009061 Ga0105243_100090615 226
627 3300009148 Ga0105243_10533607 Ga0105243_105336072 226
628 3300009174 Ga0105241_10103959 Ga0105241_101039592 226
629 3300009176 Ga0105242_10008954 Ga0105242_100089544 226
630 3300009176 Ga0105242_10018069 Ga0105242_100180695 226
631 3300009177 Ga0105248_10267442 Ga0105248_102674423 226
632 3300013297 Ga0157378_10283585 Ga0157378_102835853 226
633 3300013307 Ga0157372_10337530 Ga0157372_103375302 226
634 3300013307 Ga0157372_10624495 Ga0157372_106244952 226
635 3300014325 Ga0163163_10012635 Ga0163163_100126358 226
636 3300014325 Ga0163163_10019152 Ga0163163_100191523 226
637 3300014326 Ga0157380_10006040 Ga0157380_100060402 226
638 3300014326 Ga0157380_10397595 Ga0157380_103975952 226
639 3300014745 Ga0157377_10302101 Ga0157377_103021012 226
640 3300025893 Ga0207682_10006289 Ga0207682_100062897 226
641 3300025901 Ga0207688_10051590 Ga0207688_100515902 226
642 3300025903 Ga0207680_10035135 Ga0207680_100351354 226
643 3300025903 Ga0207680_10122446 Ga0207680_101224462 226
644 3300025903 Ga0207680_10138028 Ga0207680_101380282 226
645 3300025907 Ga0207645_10004890 Ga0207645_100048908 226
646 3300025908 Ga0207643_10118575 Ga0207643_101185752 226
647 3300025918 Ga0207662_10023741 Ga0207662_100237412 226
648 3300025923 Ga0207681_10007908 Ga0207681_100079086 226
649 3300025923 Ga0207681_10028939 Ga0207681_100289392 226
650 3300025923 Ga0207681_10199030 Ga0207681_101990303 226
651 3300025926 Ga0207659_10002907 Ga0207659_100029076 226
652 3300025932 Ga0207690_10219283 Ga0207690_102192832 226
653 3300025934 Ga0207686_10013872 Ga0207686_100138723 226
654 3300025935 Ga0207709_10008072 Ga0207709_100080724 226
655 3300025936 Ga0207670_10086293 Ga0207670_100862933 226
656 3300025937 Ga0207669_10012323 Ga0207669_100123233 226
657 3300025938 Ga0207704_10000998 Ga0207704_1000099810 226
658 3300025940 Ga0207691_10244682 Ga0207691_102446822 226
659 3300025942 Ga0207689_10080261 Ga0207689_100802613 226
660 3300025942 Ga0207689_10091465 Ga0207689_100914653 226
661 3300025942 Ga0207689_10116339 Ga0207689_101163393 226
662 3300025960 Ga0207651_10002624 Ga0207651_100026244 226
663 3300025960 Ga0207651_10009236 Ga0207651_100092363 226
664 3300025961 Ga0207712_10442019 Ga0207712_104420192 226
665 3300025981 Ga0207640_10352963 Ga0207640_103529632 226
666 3300025986 Ga0207658_10138198 Ga0207658_101381983 226
667 3300026035 Ga0207703_10433688 Ga0207703_104336882 226
668 3300026075 Ga0207708_10003387 Ga0207708_100033871 226
669 3300026075 Ga0207708_10012327 Ga0207708_100123277 226
670 3300026075 Ga0207708_10089523 Ga0207708_100895233 226
671 3300026089 Ga0207648_10001667 Ga0207648_100016678 226
672 3300026089 Ga0207648_10033564 Ga0207648_100335644 226
673 3300026089 Ga0207648_10590475 Ga0207648_105904752 226
674 3300026118 Ga0207675_100024774 Ga0207675_1000247745 226
675 3300026121 Ga0207683_10062518 Ga0207683_100625183 226
676 3300026121 Ga0207683_10419098 Ga0207683_104190982 226
677 3300026121 Ga0207683_10666624 Ga0207683_106666242 226
678 3300026142 Ga0207698_10069888 Ga0207698_100698883 226
679 3300028380 Ga0268265_10547105 Ga0268265_105471052 226
680 3300028380 Ga0268265_10558633 Ga0268265_105586331 226
681 3300028381 Ga0268264_10039264 Ga0268264_100392644 226
682 3300028381 Ga0268264_10476004 Ga0268264_104760041 226
683 3300028381 Ga0268264_10814085 Ga0268264_108140851 226
684 3300035114 Ga0373939_0030310 Ga0373939_0030310_676_1356 226
685 3300035121 Ga0373960_0021398 Ga0373960_0021398_616_1296 226
686 3300045976 Ga0466967_0495476 Ga0466967_0495476_389_1069 226
687 3300046455 Ga0495603_0094283 Ga0495603_0094283_249_986 226
688 3300048905 Ga0496102_0232266 Ga0496102_0232266_1043_1723 226
689 3300049581 Ga0501047_0105108 Ga0501047_0105108_696_1376 226
690 3300049585 Ga0501069_0244555 Ga0501069_0244555_339_1019 226
691 3300002459 JGI24751J29686_10018453 JGI24751J29686_100184532 227
692 3300005290 Ga0065712_10119184 Ga0065712_101191842 227
693 3300005329 Ga0070683_100041342 Ga0070683_1000413424 227
694 3300005331 Ga0070670_100010775 Ga0070670_1000107754 227
695 3300005458 Ga0070681_10512166 Ga0070681_105121661 227
696 3300006028 Ga0070717_10067480 Ga0070717_100674803 227
697 3300006038 Ga0075365_10001998 Ga0075365_100019989 227
698 3300025925 Ga0207650_10110686 Ga0207650_101106863 227
699 3300025928 Ga0207700_10649447 Ga0207700_106494471 227
700 3300025944 Ga0207661_10005260 Ga0207661_100052607 227
701 3300035083 Ga0373926_0106346 Ga0373926_0106346_233_916 227
702 3300035111 Ga0373923_0059154 Ga0373923_0059154_868_1566 227
703 3300035724 Ga0373933_0333976 Ga0373933_0333976_38_736 227
704 3300036401 Ga0373937_0013013 Ga0373937_0013013_2628_3326 227
705 3300037068 Ga0373925_0012431 Ga0373925_0012431_3353_4036 227
706 3300044712 Ga0453684_0026141 Ga0453684_0026141_5994_6728 227
707 3300049571 Ga0501034_0030152 Ga0501034_0030152_4665_5348 227
708 3300049590 Ga0501074_0335896 Ga0501074_0335896_202_885 227
709 3300053129 Ga0500628_021855 Ga0500628_021855_103_786 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

33

230

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9702 6 217
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9679 6 221
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9643 5 214
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9609 5 217
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9582 8 221
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9713 5 217 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9649 6 220 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9584 5 211 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9518 6 220 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9504 1 219 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7NBK9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9855 6 221 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A3B9SKL1-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9849 51 216 GO:0005975
GO:0016857
AF-A0A7Y4UCZ2-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9848 6 191 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-G2LHA7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9838 6 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A6C1QHI8-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9832 6 216 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.93 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map