F476648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 282 | 707 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10001998|Ga0075365_100019989 |
| Length | 252 |
| Sequence | MTGRDGANGAGDGAPASEREGGAGGAKLTGDVKIAPSLLSADFARLGDAIAIAERAGADMIHFDVMDGHFVPNITIGPPVLKSLARISRLPIDVHLMIENPDRYVEAFVEAGAASVTVHAEAAVHLHRVVALIKSLGAKAGVALNPGTPVSALEQIAGDLDYVLVMTVNPGFGGQTFIPRSESKVRAVRELLRREGSTAPIEVDGGIDLRTAPRIVAAGAGILVAGNAVFGSPDPERAIRDLRAAADAAVAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 2 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 187 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 203 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 204 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 205 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 206 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 207 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 212 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 280 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 94.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10018453 | 3300002459 | Bacteria | 1443 |
| 2 | JGI25406J46586_10007722 | 3300003203 | Bacteria | 4893 |
| 3 | Ga0065704_10004255 | 3300005289 | Bacteria | 5601 |
| 4 | Ga0065712_10091706 | 3300005290 | Bacteria | 2361 |
| 5 | Ga0065712_10119184 | 3300005290 | Bacteria | 1695 |
| 6 | Ga0065715_10095823 | 3300005293 | Bacteria | 3998 |
| 7 | Ga0065715_10123633 | 3300005293 | Bacteria | 2171 |
| 8 | Ga0065715_10125501 | 3300005293 | Bacteria | 2129 |
| 9 | Ga0065715_10145282 | 3300005293 | Bacteria | 1788 |
| 10 | Ga0065707_10013372 | 3300005295 | Bacteria | 1959 |
| 11 | Ga0065707_10086593 | 3300005295 | Bacteria | 5391 |
| 12 | Ga0065707_10114347 | 3300005295 | Bacteria | 2299 |
| 13 | Ga0070658_10167972 | 3300005327 | Bacteria | 1842 |
| 14 | Ga0070658_10445547 | 3300005327 | Bacteria | 1115 |
| 15 | Ga0070676_10027050 | 3300005328 | Bacteria | 3251 |
| 16 | Ga0070676_10080427 | 3300005328 | Bacteria | 1975 |
| 17 | Ga0070683_100041342 | 3300005329 | Bacteria | 4241 |
| 18 | Ga0070690_100016164 | 3300005330 | Bacteria | 4465 |
| 19 | Ga0070690_100587910 | 3300005330 | Bacteria | 844 |
| 20 | Ga0070670_100001697 | 3300005331 | Bacteria | 17921 |
| 21 | Ga0070670_100010775 | 3300005331 | Bacteria | 7810 |
| 22 | Ga0070670_100071634 | 3300005331 | Bacteria | 2976 |
| 23 | Ga0070677_10082361 | 3300005333 | Bacteria | 1380 |
| 24 | Ga0070677_10097759 | 3300005333 | Bacteria | 1289 |
| 25 | Ga0070677_10129051 | 3300005333 | Bacteria | 1152 |
| 26 | Ga0070677_10273705 | 3300005333 | Bacteria | 848 |
| 27 | Ga0068869_100037657 | 3300005334 | Bacteria | 3440 |
| 28 | Ga0068869_100164040 | 3300005334 | Bacteria | 1731 |
| 29 | Ga0068869_100393231 | 3300005334 | Bacteria | 1139 |
| 30 | Ga0070680_100543053 | 3300005336 | Bacteria | 996 |
| 31 | Ga0070680_100664250 | 3300005336 | Bacteria | 896 |
| 32 | Ga0070682_100124406 | 3300005337 | Bacteria | 1736 |
| 33 | Ga0070682_100320152 | 3300005337 | Bacteria | 1145 |
| 34 | Ga0070689_100195013 | 3300005340 | Bacteria | 1651 |
| 35 | Ga0070691_10036282 | 3300005341 | Bacteria | 2323 |
| 36 | Ga0070687_100102897 | 3300005343 | Bacteria | 1602 |
| 37 | Ga0070687_100144082 | 3300005343 | Bacteria | 1391 |
| 38 | Ga0070661_100096402 | 3300005344 | Bacteria | 2195 |
| 39 | Ga0070661_100130333 | 3300005344 | Bacteria | 1888 |
| 40 | Ga0070661_100277839 | 3300005344 | Bacteria | 1298 |
| 41 | Ga0070661_100432110 | 3300005344 | Bacteria | 1045 |
| 42 | Ga0070669_100001038 | 3300005353 | Bacteria | 20282 |
| 43 | Ga0070669_100048750 | 3300005353 | Bacteria | 3092 |
| 44 | Ga0070669_100155340 | 3300005353 | Bacteria | 1774 |
| 45 | Ga0070669_100162072 | 3300005353 | Bacteria | 1738 |
| 46 | Ga0070669_100292179 | 3300005353 | Bacteria | 1309 |
| 47 | Ga0070675_100000507 | 3300005354 | Bacteria | 26645 |
| 48 | Ga0070675_100005848 | 3300005354 | Bacteria | 9422 |
| 49 | Ga0070675_100018512 | 3300005354 | Bacteria | 5546 |
| 50 | Ga0070675_100042144 | 3300005354 | Bacteria | 3729 |
| 51 | Ga0070675_100082077 | 3300005354 | Bacteria | 2689 |
| 52 | Ga0070675_100276395 | 3300005354 | Bacteria | 1475 |
| 53 | Ga0070675_100278005 | 3300005354 | Bacteria | 1471 |
| 54 | Ga0070675_100293529 | 3300005354 | Bacteria | 1431 |
| 55 | Ga0070675_100325192 | 3300005354 | Bacteria | 1359 |
| 56 | Ga0070675_100618289 | 3300005354 | Bacteria | 983 |
| 57 | Ga0070671_100007203 | 3300005355 | Bacteria | 8894 |
| 58 | Ga0070671_100007835 | 3300005355 | Bacteria | 8534 |
| 59 | Ga0070671_100128670 | 3300005355 | Bacteria | 2132 |
| 60 | Ga0070674_100006975 | 3300005356 | Bacteria | 6631 |
| 61 | Ga0070674_100064208 | 3300005356 | Bacteria | 2572 |
| 62 | Ga0070674_100111820 | 3300005356 | Bacteria | 2007 |
| 63 | Ga0070674_100165627 | 3300005356 | Bacteria | 1681 |
| 64 | Ga0070674_100370545 | 3300005356 | Bacteria | 1162 |
| 65 | Ga0070673_100005587 | 3300005364 | Bacteria | 8065 |
| 66 | Ga0070673_100017570 | 3300005364 | Bacteria | 5092 |
| 67 | Ga0070673_100150870 | 3300005364 | Bacteria | 1968 |
| 68 | Ga0070673_100207766 | 3300005364 | Bacteria | 1689 |
| 69 | Ga0070673_100228049 | 3300005364 | Bacteria | 1615 |
| 70 | Ga0070673_100439641 | 3300005364 | Bacteria | 1172 |
| 71 | Ga0070673_100580737 | 3300005364 | Bacteria | 1021 |
| 72 | Ga0070673_100912044 | 3300005364 | Bacteria | 815 |
| 73 | Ga0070688_100024728 | 3300005365 | Bacteria | 3549 |
| 74 | Ga0070688_100043058 | 3300005365 | Bacteria | 2780 |
| 75 | Ga0070688_100425928 | 3300005365 | Bacteria | 987 |
| 76 | Ga0070688_100489244 | 3300005365 | Bacteria | 926 |
| 77 | Ga0070659_100041253 | 3300005366 | Bacteria | 3607 |
| 78 | Ga0070659_100050970 | 3300005366 | Bacteria | 3254 |
| 79 | Ga0070659_100113055 | 3300005366 | Bacteria | 2193 |
| 80 | Ga0070659_100169075 | 3300005366 | Bacteria | 1790 |
| 81 | Ga0070659_100351219 | 3300005366 | Bacteria | 1237 |
| 82 | Ga0070667_100036013 | 3300005367 | Bacteria | 4148 |
| 83 | Ga0070667_100055899 | 3300005367 | Bacteria | 3333 |
| 84 | Ga0070667_100164100 | 3300005367 | Bacteria | 1958 |
| 85 | Ga0070667_100280976 | 3300005367 | Bacteria | 1495 |
| 86 | Ga0070709_10167110 | 3300005434 | Bacteria | 1534 |
| 87 | Ga0070701_10004888 | 3300005438 | Bacteria | 5484 |
| 88 | Ga0070701_10031025 | 3300005438 | Bacteria | 2650 |
| 89 | Ga0070701_10037172 | 3300005438 | Bacteria | 2457 |
| 90 | Ga0070701_10255049 | 3300005438 | Bacteria | 1061 |
| 91 | Ga0070711_100222459 | 3300005439 | Bacteria | 1468 |
| 92 | Ga0070705_100000088 | 3300005440 | Bacteria | 51329 |
| 93 | Ga0070705_100215857 | 3300005440 | Bacteria | 1325 |
| 94 | Ga0070700_100083824 | 3300005441 | Bacteria | 2064 |
| 95 | Ga0070700_100245413 | 3300005441 | Bacteria | 1282 |
| 96 | Ga0070694_100007737 | 3300005444 | Bacteria | 6557 |
| 97 | Ga0070694_100081847 | 3300005444 | Bacteria | 2247 |
| 98 | Ga0070694_100113810 | 3300005444 | Bacteria | 1931 |
| 99 | Ga0070694_100309030 | 3300005444 | Bacteria | 1213 |
| 100 | Ga0070663_100062034 | 3300005455 | Bacteria | 2693 |
| 101 | Ga0070663_100282954 | 3300005455 | Bacteria | 1322 |
| 102 | Ga0070663_100348092 | 3300005455 | Bacteria | 1199 |
| 103 | Ga0070678_100761011 | 3300005456 | Bacteria | 877 |
| 104 | Ga0070662_100241251 | 3300005457 | Bacteria | 1450 |
| 105 | Ga0070662_100241511 | 3300005457 | Bacteria | 1449 |
| 106 | Ga0070681_10011368 | 3300005458 | Bacteria | 8807 |
| 107 | Ga0070681_10512166 | 3300005458 | Bacteria | 1113 |
| 108 | Ga0068867_100000734 | 3300005459 | Bacteria | 21968 |
| 109 | Ga0068867_100006574 | 3300005459 | Bacteria | 8213 |
| 110 | Ga0068867_100010010 | 3300005459 | Bacteria | 6682 |
| 111 | Ga0068867_100135236 | 3300005459 | Bacteria | 1921 |
| 112 | Ga0070685_10007355 | 3300005466 | Bacteria | 5631 |
| 113 | Ga0070706_100832332 | 3300005467 | Bacteria | 854 |
| 114 | Ga0070707_100040267 | 3300005468 | Bacteria | 4471 |
| 115 | Ga0070707_100076420 | 3300005468 | Bacteria | 3230 |
| 116 | Ga0070707_100195861 | 3300005468 | Bacteria | 1970 |
| 117 | Ga0070707_100243467 | 3300005468 | Bacteria | 1750 |
| 118 | Ga0070707_100265784 | 3300005468 | Bacteria | 1668 |
| 119 | Ga0070707_100534930 | 3300005468 | Bacteria | 1134 |
| 120 | Ga0070698_100001713 | 3300005471 | Bacteria | 24457 |
| 121 | Ga0070698_100242251 | 3300005471 | Bacteria | 1736 |
| 122 | Ga0070698_100404942 | 3300005471 | Bacteria | 1298 |
| 123 | Ga0070698_100591301 | 3300005471 | Bacteria | 1050 |
| 124 | Ga0070699_100003923 | 3300005518 | Bacteria | 13135 |
| 125 | Ga0070699_100012762 | 3300005518 | Bacteria | 7242 |
| 126 | Ga0070699_100054229 | 3300005518 | Bacteria | 3470 |
| 127 | Ga0070699_100091386 | 3300005518 | Bacteria | 2661 |
| 128 | Ga0070679_100208385 | 3300005530 | Bacteria | 1919 |
| 129 | Ga0070679_100568634 | 3300005530 | Bacteria | 1077 |
| 130 | Ga0070697_100155654 | 3300005536 | Bacteria | 1929 |
| 131 | Ga0068853_100226260 | 3300005539 | Bacteria | 1710 |
| 132 | Ga0070672_100001095 | 3300005543 | Bacteria | 16521 |
| 133 | Ga0070672_100009184 | 3300005543 | Bacteria | 6806 |
| 134 | Ga0070672_100011132 | 3300005543 | Bacteria | 6265 |
| 135 | Ga0070672_100258956 | 3300005543 | Bacteria | 1467 |
| 136 | Ga0070686_100006552 | 3300005544 | Bacteria | 6480 |
| 137 | Ga0070686_100112701 | 3300005544 | Bacteria | 1855 |
| 138 | Ga0070686_100435394 | 3300005544 | Bacteria | 1005 |
| 139 | Ga0070686_100542948 | 3300005544 | Bacteria | 908 |
| 140 | Ga0070695_100000021 | 3300005545 | Bacteria | 60669 |
| 141 | Ga0070695_100063380 | 3300005545 | Bacteria | 2403 |
| 142 | Ga0070695_100248454 | 3300005545 | Bacteria | 1294 |
| 143 | Ga0070695_100540290 | 3300005545 | Bacteria | 907 |
| 144 | Ga0070696_100000016 | 3300005546 | Bacteria | 76371 |
| 145 | Ga0070696_100023567 | 3300005546 | Bacteria | 4183 |
| 146 | Ga0070696_100429362 | 3300005546 | Bacteria | 1039 |
| 147 | Ga0070693_100037985 | 3300005547 | Bacteria | 2689 |
| 148 | Ga0070665_100002913 | 3300005548 | Bacteria | 18496 |
| 149 | Ga0070665_100301934 | 3300005548 | Bacteria | 1604 |
| 150 | Ga0070704_100000384 | 3300005549 | Bacteria | 20178 |
| 151 | Ga0070704_100062260 | 3300005549 | Bacteria | 2674 |
| 152 | Ga0070704_100208573 | 3300005549 | Bacteria | 1582 |
| 153 | Ga0070704_100350785 | 3300005549 | Bacteria | 1246 |
| 154 | Ga0070704_100772804 | 3300005549 | Bacteria | 856 |
| 155 | Ga0068855_100121796 | 3300005563 | Unclassified | 2985 |
| 156 | Ga0070664_100002524 | 3300005564 | Bacteria | 14755 |
| 157 | Ga0070664_100020483 | 3300005564 | Bacteria | 5446 |
| 158 | Ga0070664_100042543 | 3300005564 | Bacteria | 3834 |
| 159 | Ga0070664_100258460 | 3300005564 | Bacteria | 1567 |
| 160 | Ga0070664_100492557 | 3300005564 | Bacteria | 1129 |
| 161 | Ga0070664_100519406 | 3300005564 | Bacteria | 1099 |
| 162 | Ga0068857_100042416 | 3300005577 | Bacteria | 4036 |
| 163 | Ga0068857_100098931 | 3300005577 | Unclassified | 2616 |
| 164 | Ga0068854_100170512 | 3300005578 | Unclassified | 1693 |
| 165 | Ga0068854_100358164 | 3300005578 | Bacteria | 1196 |
| 166 | Ga0070702_100018918 | 3300005615 | Bacteria | 3581 |
| 167 | Ga0070702_100024288 | 3300005615 | Bacteria | 3232 |
| 168 | Ga0070702_100433717 | 3300005615 | Bacteria | 949 |
| 169 | Ga0068852_100116359 | 3300005616 | Bacteria | 2439 |
| 170 | Ga0068852_100191629 | 3300005616 | Bacteria | 1930 |
| 171 | Ga0068859_100019849 | 3300005617 | Bacteria | 6746 |
| 172 | Ga0068859_100240472 | 3300005617 | Bacteria | 1899 |
| 173 | Ga0068864_100054442 | 3300005618 | Bacteria | 3453 |
| 174 | Ga0068864_100134476 | 3300005618 | Bacteria | 2225 |
| 175 | Ga0068864_100296120 | 3300005618 | Bacteria | 1514 |
| 176 | Ga0068866_10003129 | 3300005718 | Bacteria | 6810 |
| 177 | Ga0068861_100010900 | 3300005719 | Bacteria | 6314 |
| 178 | Ga0068861_100016995 | 3300005719 | Bacteria | 5159 |
| 179 | Ga0068851_10193709 | 3300005834 | Bacteria | 1131 |
| 180 | Ga0068870_10003900 | 3300005840 | Bacteria | 6363 |
| 181 | Ga0068870_10016974 | 3300005840 | Bacteria | 3492 |
| 182 | Ga0068870_10145269 | 3300005840 | Bacteria | 1392 |
| 183 | Ga0068863_100006191 | 3300005841 | Bacteria | 11735 |
| 184 | Ga0068863_100042922 | 3300005841 | Bacteria | 4295 |
| 185 | Ga0068858_100005046 | 3300005842 | Bacteria | 12942 |
| 186 | Ga0068858_100145183 | 3300005842 | Bacteria | 2228 |
| 187 | Ga0068858_100180871 | 3300005842 | Bacteria | 1991 |
| 188 | Ga0068858_100273211 | 3300005842 | Bacteria | 1608 |
| 189 | Ga0068860_100014433 | 3300005843 | Bacteria | 7738 |
| 190 | Ga0068860_100039025 | 3300005843 | Bacteria | 4543 |
| 191 | Ga0068860_100079061 | 3300005843 | Bacteria | 3127 |
| 192 | Ga0068860_100082549 | 3300005843 | Bacteria | 3056 |
| 193 | Ga0068860_100507041 | 3300005843 | Bacteria | 1205 |
| 194 | Ga0068860_101139891 | 3300005843 | Bacteria | 800 |
| 195 | Ga0068860_101206537 | 3300005843 | Bacteria | 777 |
| 196 | Ga0068862_100005891 | 3300005844 | Bacteria | 10207 |
| 197 | Ga0068862_100032432 | 3300005844 | Bacteria | 4414 |
| 198 | Ga0068862_100242253 | 3300005844 | Bacteria | 1640 |
| 199 | Ga0068862_100428638 | 3300005844 | Bacteria | 1243 |
| 200 | Ga0068862_100566224 | 3300005844 | Bacteria | 1087 |
| 201 | Ga0081539_10000106 | 3300005985 | Bacteria | 195771 |
| 202 | Ga0070717_10067480 | 3300006028 | Bacteria | 2976 |
| 203 | Ga0075365_10001998 | 3300006038 | Bacteria | 9667 |
| 204 | Ga0075365_10114053 | 3300006038 | Bacteria | 1859 |
| 205 | Ga0075363_100361720 | 3300006048 | Bacteria | 849 |
| 206 | Ga0075364_10241359 | 3300006051 | Bacteria | 1227 |
| 207 | Ga0075362_10004952 | 3300006177 | Bacteria | 4828 |
| 208 | Ga0075367_10050056 | 3300006178 | Bacteria | 2465 |
| 209 | Ga0075367_10241406 | 3300006178 | Bacteria | 1132 |
| 210 | Ga0075366_10000340 | 3300006195 | Bacteria | 21470 |
| 211 | Ga0097621_100343388 | 3300006237 | Bacteria | 1326 |
| 212 | Ga0075428_100005224 | 3300006844 | Bacteria | 14436 |
| 213 | Ga0075428_100007242 | 3300006844 | Bacteria | 12289 |
| 214 | Ga0075428_100103590 | 3300006844 | Bacteria | 3103 |
| 215 | Ga0075428_100310513 | 3300006844 | Bacteria | 1695 |
| 216 | Ga0075430_100025586 | 3300006846 | Bacteria | 5023 |
| 217 | Ga0075430_100045984 | 3300006846 | Bacteria | 3686 |
| 218 | Ga0075430_100115480 | 3300006846 | Bacteria | 2237 |
| 219 | Ga0075430_100155366 | 3300006846 | Bacteria | 1905 |
| 220 | Ga0075431_100020518 | 3300006847 | Bacteria | 6751 |
| 221 | Ga0075431_100034489 | 3300006847 | Bacteria | 5214 |
| 222 | Ga0075431_100184693 | 3300006847 | Bacteria | 2139 |
| 223 | Ga0075433_10071902 | 3300006852 | Bacteria | 3041 |
| 224 | Ga0075434_100001393 | 3300006871 | Bacteria | 20300 |
| 225 | Ga0075434_100016592 | 3300006871 | Bacteria | 7082 |
| 226 | Ga0075434_100055428 | 3300006871 | Bacteria | 3939 |
| 227 | Ga0075434_100267612 | 3300006871 | Bacteria | 1728 |
| 228 | Ga0075434_100287489 | 3300006871 | Bacteria | 1664 |
| 229 | Ga0075434_100523532 | 3300006871 | Bacteria | 1206 |
| 230 | Ga0075429_100114599 | 3300006880 | Bacteria | 2356 |
| 231 | Ga0075429_100461716 | 3300006880 | Bacteria | 1113 |
| 232 | Ga0068865_100002495 | 3300006881 | Bacteria | 10899 |
| 233 | Ga0075436_100028414 | 3300006914 | Bacteria | 3847 |
| 234 | Ga0075436_100087038 | 3300006914 | Bacteria | 2170 |
| 235 | Ga0097620_100019848 | 3300006931 | Bacteria | 6746 |
| 236 | Ga0097620_100240472 | 3300006931 | Bacteria | 1899 |
| 237 | Ga0075435_100043029 | 3300007076 | Bacteria | 3615 |
| 238 | Ga0075435_100105118 | 3300007076 | Bacteria | 2343 |
| 239 | Ga0075435_100119361 | 3300007076 | Bacteria | 2199 |
| 240 | Ga0075435_100302214 | 3300007076 | Bacteria | 1369 |
| 241 | Ga0105240_10920090 | 3300009093 | Bacteria | 940 |
| 242 | Ga0111539_10000253 | 3300009094 | Bacteria | 64123 |
| 243 | Ga0111539_10003215 | 3300009094 | Bacteria | 21610 |
| 244 | Ga0111539_10017868 | 3300009094 | Bacteria | 8783 |
| 245 | Ga0111539_10064568 | 3300009094 | Bacteria | 4329 |
| 246 | Ga0111539_10133175 | 3300009094 | Bacteria | 2910 |
| 247 | Ga0111539_10144545 | 3300009094 | Bacteria | 2784 |
| 248 | Ga0111539_10428297 | 3300009094 | Bacteria | 1541 |
| 249 | Ga0111539_10467792 | 3300009094 | Bacteria | 1468 |
| 250 | Ga0111539_10582099 | 3300009094 | Bacteria | 1304 |
| 251 | Ga0111539_10605960 | 3300009094 | Bacteria | 1275 |
| 252 | Ga0111539_10607802 | 3300009094 | Bacteria | 1273 |
| 253 | Ga0105245_10457447 | 3300009098 | Bacteria | 1286 |
| 254 | Ga0114129_10003607 | 3300009147 | Bacteria | 21767 |
| 255 | Ga0114129_10005104 | 3300009147 | Bacteria | 18487 |
| 256 | Ga0114129_10080023 | 3300009147 | Bacteria | 4543 |
| 257 | Ga0114129_10091479 | 3300009147 | Bacteria | 4215 |
| 258 | Ga0114129_10206620 | 3300009147 | Bacteria | 2657 |
| 259 | Ga0105243_10002751 | 3300009148 | Bacteria | 14622 |
| 260 | Ga0105243_10009061 | 3300009148 | Bacteria | 7602 |
| 261 | Ga0105243_10094272 | 3300009148 | Bacteria | 2472 |
| 262 | Ga0105243_10533607 | 3300009148 | Bacteria | 1118 |
| 263 | Ga0105241_10103959 | 3300009174 | Bacteria | 2262 |
| 264 | Ga0105242_10008954 | 3300009176 | Bacteria | 7684 |
| 265 | Ga0105242_10018069 | 3300009176 | Bacteria | 5507 |
| 266 | Ga0105248_10024378 | 3300009177 | Bacteria | 6727 |
| 267 | Ga0105248_10267442 | 3300009177 | Bacteria | 1925 |
| 268 | Ga0105237_10007566 | 3300009545 | Bacteria | 11874 |
| 269 | Ga0105238_10013846 | 3300009551 | Bacteria | 8152 |
| 270 | Ga0105249_10001485 | 3300009553 | Bacteria | 20547 |
| 271 | Ga0105249_10041995 | 3300009553 | Bacteria | 4158 |
| 272 | Ga0105249_10150337 | 3300009553 | Bacteria | 2241 |
| 273 | Ga0105249_10312288 | 3300009553 | Bacteria | 1581 |
| 274 | Ga0105249_10533751 | 3300009553 | Bacteria | 1222 |
| 275 | Ga0105239_10933960 | 3300010375 | Bacteria | 996 |
| 276 | Ga0105246_10642612 | 3300011119 | Bacteria | 922 |
| 277 | Ga0157374_10043530 | 3300013296 | Bacteria | 4149 |
| 278 | Ga0157378_10283585 | 3300013297 | Bacteria | 1597 |
| 279 | Ga0163162_10142684 | 3300013306 | Bacteria | 2509 |
| 280 | Ga0163162_10662496 | 3300013306 | Bacteria | 1167 |
| 281 | Ga0157372_10337530 | 3300013307 | Bacteria | 1755 |
| 282 | Ga0157372_10624495 | 3300013307 | Bacteria | 1255 |
| 283 | Ga0157375_10035943 | 3300013308 | Bacteria | 4733 |
| 284 | Ga0157375_10079505 | 3300013308 | Bacteria | 3315 |
| 285 | Ga0157375_10183003 | 3300013308 | Bacteria | 2248 |
| 286 | Ga0157375_10191689 | 3300013308 | Bacteria | 2199 |
| 287 | Ga0163163_10012635 | 3300014325 | Bacteria | 7697 |
| 288 | Ga0163163_10019152 | 3300014325 | Bacteria | 6423 |
| 289 | Ga0163163_10298780 | 3300014325 | Bacteria | 1663 |
| 290 | Ga0157380_10003938 | 3300014326 | Bacteria | 10247 |
| 291 | Ga0157380_10006040 | 3300014326 | Bacteria | 8483 |
| 292 | Ga0157380_10007433 | 3300014326 | Bacteria | 7778 |
| 293 | Ga0157380_10070744 | 3300014326 | Bacteria | 2820 |
| 294 | Ga0157380_10092723 | 3300014326 | Bacteria | 2496 |
| 295 | Ga0157380_10397595 | 3300014326 | Bacteria | 1306 |
| 296 | Ga0157377_10033384 | 3300014745 | Bacteria | 2809 |
| 297 | Ga0157377_10197591 | 3300014745 | Bacteria | 1275 |
| 298 | Ga0157377_10302101 | 3300014745 | Bacteria | 1057 |
| 299 | Ga0157377_10327080 | 3300014745 | Bacteria | 1020 |
| 300 | Ga0157379_10012602 | 3300014968 | Bacteria | 7385 |
| 301 | Ga0157376_10095204 | 3300014969 | Bacteria | 2589 |
| 302 | Ga0157376_10192398 | 3300014969 | Bacteria | 1871 |
| 303 | Ga0207656_10010706 | 3300025321 | Bacteria | 3444 |
| 304 | Ga0207682_10006289 | 3300025893 | Bacteria | 4794 |
| 305 | Ga0207682_10030309 | 3300025893 | Bacteria | 2166 |
| 306 | Ga0207682_10045704 | 3300025893 | Bacteria | 1798 |
| 307 | Ga0207688_10051590 | 3300025901 | Bacteria | 2304 |
| 308 | Ga0207688_10238470 | 3300025901 | Bacteria | 1099 |
| 309 | Ga0207680_10021143 | 3300025903 | Bacteria | 3516 |
| 310 | Ga0207680_10035135 | 3300025903 | Bacteria | 2875 |
| 311 | Ga0207680_10122446 | 3300025903 | Bacteria | 1703 |
| 312 | Ga0207680_10138028 | 3300025903 | Bacteria | 1614 |
| 313 | Ga0207680_10164132 | 3300025903 | Bacteria | 1492 |
| 314 | Ga0207645_10004890 | 3300025907 | Bacteria | 9822 |
| 315 | Ga0207645_10007927 | 3300025907 | Bacteria | 7460 |
| 316 | Ga0207645_10177585 | 3300025907 | Bacteria | 1397 |
| 317 | Ga0207643_10011995 | 3300025908 | Bacteria | 4679 |
| 318 | Ga0207643_10032604 | 3300025908 | Bacteria | 2910 |
| 319 | Ga0207643_10047006 | 3300025908 | Bacteria | 2440 |
| 320 | Ga0207643_10078032 | 3300025908 | Bacteria | 1915 |
| 321 | Ga0207643_10118575 | 3300025908 | Bacteria | 1565 |
| 322 | Ga0207705_10137462 | 3300025909 | Bacteria | 1823 |
| 323 | Ga0207684_10164619 | 3300025910 | Bacteria | 1910 |
| 324 | Ga0207684_10944923 | 3300025910 | Bacteria | 723 |
| 325 | Ga0207707_10056337 | 3300025912 | Bacteria | 3420 |
| 326 | Ga0207707_10067961 | 3300025912 | Bacteria | 3104 |
| 327 | Ga0207695_10677417 | 3300025913 | Bacteria | 912 |
| 328 | Ga0207671_10022996 | 3300025914 | Bacteria | 4705 |
| 329 | Ga0207660_10088488 | 3300025917 | Bacteria | 2290 |
| 330 | Ga0207660_10458681 | 3300025917 | Bacteria | 1031 |
| 331 | Ga0207660_10583351 | 3300025917 | Bacteria | 910 |
| 332 | Ga0207662_10001930 | 3300025918 | Bacteria | 10217 |
| 333 | Ga0207662_10004273 | 3300025918 | Bacteria | 7499 |
| 334 | Ga0207662_10023741 | 3300025918 | Bacteria | 3525 |
| 335 | Ga0207662_10053313 | 3300025918 | Bacteria | 2409 |
| 336 | Ga0207662_10282929 | 3300025918 | Bacteria | 1098 |
| 337 | Ga0207649_10061520 | 3300025920 | Bacteria | 2364 |
| 338 | Ga0207649_10096597 | 3300025920 | Bacteria | 1947 |
| 339 | Ga0207652_10031233 | 3300025921 | Bacteria | 4472 |
| 340 | Ga0207652_10382824 | 3300025921 | Bacteria | 1270 |
| 341 | Ga0207646_10092492 | 3300025922 | Bacteria | 2707 |
| 342 | Ga0207646_10159352 | 3300025922 | Bacteria | 2036 |
| 343 | Ga0207646_10172854 | 3300025922 | Bacteria | 1951 |
| 344 | Ga0207681_10007908 | 3300025923 | Bacteria | 6500 |
| 345 | Ga0207681_10013643 | 3300025923 | Bacteria | 5031 |
| 346 | Ga0207681_10028939 | 3300025923 | Bacteria | 3593 |
| 347 | Ga0207681_10101372 | 3300025923 | Bacteria | 2077 |
| 348 | Ga0207681_10114701 | 3300025923 | Bacteria | 1966 |
| 349 | Ga0207681_10134573 | 3300025923 | Bacteria | 1832 |
| 350 | Ga0207681_10199030 | 3300025923 | Bacteria | 1537 |
| 351 | Ga0207694_10008144 | 3300025924 | Bacteria | 7920 |
| 352 | Ga0207650_10008282 | 3300025925 | Bacteria | 7099 |
| 353 | Ga0207650_10110686 | 3300025925 | Bacteria | 2125 |
| 354 | Ga0207650_10248611 | 3300025925 | Bacteria | 1439 |
| 355 | Ga0207659_10000602 | 3300025926 | Bacteria | 21496 |
| 356 | Ga0207659_10002907 | 3300025926 | Bacteria | 10196 |
| 357 | Ga0207659_10020747 | 3300025926 | Bacteria | 4349 |
| 358 | Ga0207659_10121177 | 3300025926 | Bacteria | 2005 |
| 359 | Ga0207659_10222309 | 3300025926 | Bacteria | 1519 |
| 360 | Ga0207659_10678717 | 3300025926 | Bacteria | 881 |
| 361 | Ga0207687_10158580 | 3300025927 | Bacteria | 1734 |
| 362 | Ga0207700_10093560 | 3300025928 | Bacteria | 2379 |
| 363 | Ga0207700_10649447 | 3300025928 | Bacteria | 940 |
| 364 | Ga0207644_10004034 | 3300025931 | Bacteria | 9527 |
| 365 | Ga0207644_10031630 | 3300025931 | Bacteria | 3688 |
| 366 | Ga0207690_10020688 | 3300025932 | Bacteria | 4070 |
| 367 | Ga0207690_10219283 | 3300025932 | Bacteria | 1455 |
| 368 | Ga0207706_10100215 | 3300025933 | Bacteria | 2548 |
| 369 | Ga0207706_10174393 | 3300025933 | Bacteria | 1889 |
| 370 | Ga0207706_10219010 | 3300025933 | Bacteria | 1667 |
| 371 | Ga0207686_10013872 | 3300025934 | Bacteria | 4469 |
| 372 | Ga0207709_10008072 | 3300025935 | Bacteria | 5830 |
| 373 | Ga0207709_10016003 | 3300025935 | Bacteria | 4163 |
| 374 | Ga0207670_10006747 | 3300025936 | Bacteria | 6381 |
| 375 | Ga0207670_10039776 | 3300025936 | Bacteria | 3082 |
| 376 | Ga0207670_10086293 | 3300025936 | Bacteria | 2208 |
| 377 | Ga0207669_10005893 | 3300025937 | Bacteria | 5546 |
| 378 | Ga0207669_10012323 | 3300025937 | Bacteria | 4200 |
| 379 | Ga0207669_10028054 | 3300025937 | Bacteria | 3092 |
| 380 | Ga0207669_10361057 | 3300025937 | Bacteria | 1126 |
| 381 | Ga0207669_10380093 | 3300025937 | Bacteria | 1100 |
| 382 | Ga0207704_10000998 | 3300025938 | Bacteria | 12551 |
| 383 | Ga0207704_10013084 | 3300025938 | Bacteria | 4140 |
| 384 | Ga0207665_10293724 | 3300025939 | Bacteria | 1213 |
| 385 | Ga0207691_10010354 | 3300025940 | Bacteria | 8943 |
| 386 | Ga0207691_10042381 | 3300025940 | Bacteria | 4196 |
| 387 | Ga0207691_10244682 | 3300025940 | Bacteria | 1550 |
| 388 | Ga0207691_10342973 | 3300025940 | Bacteria | 1279 |
| 389 | Ga0207691_10346539 | 3300025940 | Bacteria | 1271 |
| 390 | Ga0207691_10438000 | 3300025940 | Bacteria | 1113 |
| 391 | Ga0207711_10217190 | 3300025941 | Bacteria | 1748 |
| 392 | Ga0207689_10013122 | 3300025942 | Bacteria | 7071 |
| 393 | Ga0207689_10057438 | 3300025942 | Bacteria | 3201 |
| 394 | Ga0207689_10080261 | 3300025942 | Bacteria | 2681 |
| 395 | Ga0207689_10091465 | 3300025942 | Bacteria | 2500 |
| 396 | Ga0207689_10116339 | 3300025942 | Bacteria | 2198 |
| 397 | Ga0207689_10138462 | 3300025942 | Bacteria | 2005 |
| 398 | Ga0207689_10240715 | 3300025942 | Bacteria | 1496 |
| 399 | Ga0207661_10001149 | 3300025944 | Bacteria | 17678 |
| 400 | Ga0207661_10005260 | 3300025944 | Bacteria | 9105 |
| 401 | Ga0207679_10005938 | 3300025945 | Bacteria | 7679 |
| 402 | Ga0207651_10002624 | 3300025960 | Bacteria | 8589 |
| 403 | Ga0207651_10009236 | 3300025960 | Bacteria | 5382 |
| 404 | Ga0207651_10030995 | 3300025960 | Bacteria | 3412 |
| 405 | Ga0207651_10138287 | 3300025960 | Bacteria | 1877 |
| 406 | Ga0207651_10203374 | 3300025960 | Bacteria | 1589 |
| 407 | Ga0207651_10228472 | 3300025960 | Bacteria | 1509 |
| 408 | Ga0207651_10298169 | 3300025960 | Bacteria | 1339 |
| 409 | Ga0207651_10304776 | 3300025960 | Bacteria | 1326 |
| 410 | Ga0207712_10041096 | 3300025961 | Bacteria | 3177 |
| 411 | Ga0207712_10367480 | 3300025961 | Bacteria | 1200 |
| 412 | Ga0207712_10442019 | 3300025961 | Bacteria | 1101 |
| 413 | Ga0207668_10247533 | 3300025972 | Bacteria | 1446 |
| 414 | Ga0207640_10352963 | 3300025981 | Bacteria | 1182 |
| 415 | Ga0207658_10136941 | 3300025986 | Bacteria | 1976 |
| 416 | Ga0207658_10138198 | 3300025986 | Bacteria | 1968 |
| 417 | Ga0207658_10576577 | 3300025986 | Bacteria | 1009 |
| 418 | Ga0207658_10656217 | 3300025986 | Bacteria | 946 |
| 419 | Ga0207677_10231171 | 3300026023 | Bacteria | 1490 |
| 420 | Ga0207703_10021915 | 3300026035 | Bacteria | 5003 |
| 421 | Ga0207703_10338075 | 3300026035 | Bacteria | 1383 |
| 422 | Ga0207703_10433688 | 3300026035 | Bacteria | 1225 |
| 423 | Ga0207639_10612819 | 3300026041 | Bacteria | 1005 |
| 424 | Ga0207678_10069168 | 3300026067 | Bacteria | 3027 |
| 425 | Ga0207678_10148174 | 3300026067 | Bacteria | 2003 |
| 426 | Ga0207708_10003387 | 3300026075 | Bacteria | 11746 |
| 427 | Ga0207708_10005930 | 3300026075 | Bacteria | 9039 |
| 428 | Ga0207708_10012327 | 3300026075 | Bacteria | 6370 |
| 429 | Ga0207708_10089523 | 3300026075 | Bacteria | 2372 |
| 430 | Ga0207641_10024334 | 3300026088 | Bacteria | 4991 |
| 431 | Ga0207641_10038115 | 3300026088 | Bacteria | 4018 |
| 432 | Ga0207641_10113057 | 3300026088 | Bacteria | 2410 |
| 433 | Ga0207648_10000338 | 3300026089 | Bacteria | 51422 |
| 434 | Ga0207648_10001667 | 3300026089 | Bacteria | 24343 |
| 435 | Ga0207648_10003433 | 3300026089 | Bacteria | 16628 |
| 436 | Ga0207648_10033564 | 3300026089 | Bacteria | 4526 |
| 437 | Ga0207648_10123543 | 3300026089 | Bacteria | 2277 |
| 438 | Ga0207648_10590475 | 3300026089 | Bacteria | 1023 |
| 439 | Ga0207676_10047921 | 3300026095 | Bacteria | 3314 |
| 440 | Ga0207676_10127093 | 3300026095 | Bacteria | 2161 |
| 441 | Ga0207676_10502706 | 3300026095 | Bacteria | 1151 |
| 442 | Ga0207676_11057397 | 3300026095 | Bacteria | 801 |
| 443 | Ga0207674_10035241 | 3300026116 | Bacteria | 5224 |
| 444 | Ga0207674_10089673 | 3300026116 | Bacteria | 3068 |
| 445 | Ga0207674_10111526 | 3300026116 | Bacteria | 2709 |
| 446 | Ga0207674_10114204 | 3300026116 | Unclassified | 2673 |
| 447 | Ga0207674_10523703 | 3300026116 | Bacteria | 1145 |
| 448 | Ga0207674_10833870 | 3300026116 | Bacteria | 889 |
| 449 | Ga0207675_100007099 | 3300026118 | Bacteria | 10586 |
| 450 | Ga0207675_100008779 | 3300026118 | Bacteria | 9489 |
| 451 | Ga0207675_100024774 | 3300026118 | Bacteria | 5582 |
| 452 | Ga0207683_10033865 | 3300026121 | Bacteria | 4439 |
| 453 | Ga0207683_10062518 | 3300026121 | Bacteria | 3279 |
| 454 | Ga0207683_10064623 | 3300026121 | Bacteria | 3225 |
| 455 | Ga0207683_10106178 | 3300026121 | Bacteria | 2511 |
| 456 | Ga0207683_10419098 | 3300026121 | Bacteria | 1233 |
| 457 | Ga0207683_10666624 | 3300026121 | Bacteria | 964 |
| 458 | Ga0207698_10069888 | 3300026142 | Bacteria | 2779 |
| 459 | Ga0207698_10157919 | 3300026142 | Bacteria | 1979 |
| 460 | Ga0209998_10011182 | 3300027717 | Bacteria | 1858 |
| 461 | Ga0207428_10000085 | 3300027907 | Bacteria | 132411 |
| 462 | Ga0207428_10005133 | 3300027907 | Bacteria | 12267 |
| 463 | Ga0207428_10012432 | 3300027907 | Bacteria | 7481 |
| 464 | Ga0207428_10070310 | 3300027907 | Bacteria | 2751 |
| 465 | Ga0268266_10002732 | 3300028379 | Bacteria | 18470 |
| 466 | Ga0268265_10003298 | 3300028380 | Bacteria | 11696 |
| 467 | Ga0268265_10038871 | 3300028380 | Bacteria | 3503 |
| 468 | Ga0268265_10045365 | 3300028380 | Bacteria | 3279 |
| 469 | Ga0268265_10192217 | 3300028380 | Bacteria | 1764 |
| 470 | Ga0268265_10211815 | 3300028380 | Bacteria | 1689 |
| 471 | Ga0268265_10547105 | 3300028380 | Bacteria | 1098 |
| 472 | Ga0268265_10558633 | 3300028380 | Bacteria | 1088 |
| 473 | Ga0268264_10007621 | 3300028381 | Bacteria | 9024 |
| 474 | Ga0268264_10039264 | 3300028381 | Bacteria | 3911 |
| 475 | Ga0268264_10268238 | 3300028381 | Bacteria | 1594 |
| 476 | Ga0268264_10476004 | 3300028381 | Bacteria | 1214 |
| 477 | Ga0268264_10611157 | 3300028381 | Bacteria | 1075 |
| 478 | Ga0268264_10814085 | 3300028381 | Bacteria | 934 |
| 479 | Ga0307408_100043786 | 3300031548 | Bacteria | 3186 |
| 480 | Ga0307408_100337784 | 3300031548 | Bacteria | 1274 |
| 481 | Ga0307408_100450523 | 3300031548 | Bacteria | 1116 |
| 482 | Ga0307408_100878977 | 3300031548 | Bacteria | 819 |
| 483 | Ga0316576_10121623 | 3300031727 | Bacteria | 1960 |
| 484 | Ga0307405_10000896 | 3300031731 | Bacteria | 11820 |
| 485 | Ga0307405_10029783 | 3300031731 | Bacteria | 3193 |
| 486 | Ga0316577_10239459 | 3300031733 | Bacteria | 1026 |
| 487 | Ga0307413_10013614 | 3300031824 | Bacteria | 4096 |
| 488 | Ga0307413_10174498 | 3300031824 | Bacteria | 1525 |
| 489 | Ga0307410_10008739 | 3300031852 | Bacteria | 5637 |
| 490 | Ga0307410_10011533 | 3300031852 | Bacteria | 5059 |
| 491 | Ga0307410_10316653 | 3300031852 | Bacteria | 1236 |
| 492 | Ga0307410_10332085 | 3300031852 | Bacteria | 1209 |
| 493 | Ga0307406_10019269 | 3300031901 | Bacteria | 4002 |
| 494 | Ga0307406_10044831 | 3300031901 | Bacteria | 2773 |
| 495 | Ga0307407_10026375 | 3300031903 | Bacteria | 3075 |
| 496 | Ga0307407_10026962 | 3300031903 | Bacteria | 3051 |
| 497 | Ga0307412_10016850 | 3300031911 | Bacteria | 4364 |
| 498 | Ga0307412_10028538 | 3300031911 | Bacteria | 3492 |
| 499 | Ga0307412_10078519 | 3300031911 | Bacteria | 2274 |
| 500 | Ga0307412_10279405 | 3300031911 | Bacteria | 1310 |
| 501 | Ga0307409_100002483 | 3300031995 | Bacteria | 9661 |
| 502 | Ga0307409_100025219 | 3300031995 | Bacteria | 4165 |
| 503 | Ga0307409_100031724 | 3300031995 | Bacteria | 3819 |
| 504 | Ga0307409_100069918 | 3300031995 | Bacteria | 2784 |
| 505 | Ga0307409_100133809 | 3300031995 | Bacteria | 2124 |
| 506 | Ga0307409_100159458 | 3300031995 | Bacteria | 1971 |
| 507 | Ga0307416_100002720 | 3300032002 | Bacteria | 10252 |
| 508 | Ga0307416_100045322 | 3300032002 | Bacteria | 3462 |
| 509 | Ga0307416_100097334 | 3300032002 | Bacteria | 2548 |
| 510 | Ga0307416_100288535 | 3300032002 | Bacteria | 1623 |
| 511 | Ga0307414_10149177 | 3300032004 | Bacteria | 1842 |
| 512 | Ga0307414_10203522 | 3300032004 | Bacteria | 1612 |
| 513 | Ga0307414_10208604 | 3300032004 | Bacteria | 1595 |
| 514 | Ga0307411_10013381 | 3300032005 | Bacteria | 4525 |
| 515 | Ga0307411_10020596 | 3300032005 | Bacteria | 3840 |
| 516 | Ga0307411_10657410 | 3300032005 | Bacteria | 908 |
| 517 | Ga0307415_100039123 | 3300032126 | Bacteria | 3131 |
| 518 | Ga0307415_100278341 | 3300032126 | Bacteria | 1374 |
| 519 | Ga0307415_100775477 | 3300032126 | Bacteria | 873 |
| 520 | Ga0316583_10007523 | 3300032133 | Bacteria | 3922 |
| 521 | Ga0316580_10038502 | 3300032139 | Bacteria | 1478 |
| 522 | Ga0373926_0106346 | 3300035083 | Bacteria | 1052 |
| 523 | Ga0373923_0059154 | 3300035111 | Bacteria | 1624 |
| 524 | Ga0373939_0030310 | 3300035114 | Bacteria | 1555 |
| 525 | Ga0373960_0021398 | 3300035121 | Bacteria | 1720 |
| 526 | Ga0373943_0322151 | 3300035170 | Bacteria | 881 |
| 527 | Ga0373924_0120057 | 3300035410 | Bacteria | 1140 |
| 528 | Ga0373935_0335291 | 3300035692 | Bacteria | 1076 |
| 529 | Ga0373933_0333976 | 3300035724 | Bacteria | 983 |
| 530 | Ga0373947_0025933 | 3300035725 | Bacteria | 3420 |
| 531 | Ga0373937_0013013 | 3300036401 | Bacteria | 7328 |
| 532 | Ga0373937_0048996 | 3300036401 | Bacteria | 3868 |
| 533 | Ga0373937_0291055 | 3300036401 | Bacteria | 1543 |
| 534 | Ga0373937_0791042 | 3300036401 | Bacteria | 896 |
| 535 | Ga0316582_0107406 | 3300036647 | Bacteria | 1854 |
| 536 | Ga0316584_0028588 | 3300036712 | Bacteria | 4112 |
| 537 | Ga0373925_0012431 | 3300037068 | Bacteria | 6164 |
| 538 | Ga0373925_0336091 | 3300037068 | Bacteria | 1224 |
| 539 | Ga0395905_0844249 | 3300037471 | Bacteria | 819 |
| 540 | Ga0400491_22105 | 3300038727 | Bacteria | 1175 |
| 541 | Ga0400485_10833 | 3300038735 | Bacteria | 31562 |
| 542 | Ga0400486_01644 | 3300038742 | Bacteria | 89520 |
| 543 | Ga0400486_13502 | 3300038742 | Bacteria | 34171 |
| 544 | Ga0400483_020887 | 3300039062 | Bacteria | 4734 |
| 545 | Ga0400483_032668 | 3300039062 | Bacteria | 5132 |
| 546 | Ga0400483_163516 | 3300039062 | Bacteria | 14697 |
| 547 | Ga0400483_232829 | 3300039062 | Bacteria | 1608 |
| 548 | Ga0400483_248230 | 3300039062 | Bacteria | 9765 |
| 549 | Ga0400487_35213 | 3300039110 | Bacteria | 4079 |
| 550 | Ga0400487_39899 | 3300039110 | Bacteria | 80564 |
| 551 | Ga0451843_0404721 | 3300041509 | Bacteria | 849 |
| 552 | Ga0451853_2622050 | 3300041512 | Bacteria | 1480 |
| 553 | Ga0439445_0021089 | 3300042004 | Bacteria | 1635 |
| 554 | Ga0439448_0156988 | 3300042005 | Bacteria | 791 |
| 555 | Ga0439446_0033837 | 3300042156 | Bacteria | 1486 |
| 556 | Ga0439446_0076565 | 3300042156 | Bacteria | 1030 |
| 557 | Ga0439434_0015830 | 3300042435 | Bacteria | 2250 |
| 558 | Ga0451577_0001333 | 3300042876 | Bacteria | 33539 |
| 559 | Ga0451577_0037691 | 3300042876 | Bacteria | 4351 |
| 560 | Ga0451577_0103059 | 3300042876 | Bacteria | 2550 |
| 561 | Ga0451577_0794019 | 3300042876 | Bacteria | 855 |
| 562 | Ga0453684_0000441 | 3300044712 | Bacteria | 169068 |
| 563 | Ga0453684_0003492 | 3300044712 | Bacteria | 35294 |
| 564 | Ga0453684_0005948 | 3300044712 | Bacteria | 23665 |
| 565 | Ga0453684_0024766 | 3300044712 | Bacteria | 8748 |
| 566 | Ga0453684_0026141 | 3300044712 | Bacteria | 8446 |
| 567 | Ga0453684_0048385 | 3300044712 | Bacteria | 5624 |
| 568 | Ga0453684_0280745 | 3300044712 | Bacteria | 1899 |
| 569 | Ga0451576_0027569 | 3300045051 | Bacteria | 6099 |
| 570 | Ga0451576_0051942 | 3300045051 | Bacteria | 4296 |
| 571 | Ga0451576_0271090 | 3300045051 | Bacteria | 1774 |
| 572 | Ga0451576_0513240 | 3300045051 | Bacteria | 1259 |
| 573 | Ga0466967_0495476 | 3300045976 | Bacteria | 1198 |
| 574 | Ga0495603_0094283 | 3300046455 | Bacteria | 1749 |
| 575 | Ga0495629_0139680 | 3300046459 | Bacteria | 1686 |
| 576 | Ga0495639_0161727 | 3300046475 | Bacteria | 1084 |
| 577 | Ga0495643_0006118 | 3300046522 | Bacteria | 7997 |
| 578 | Ga0495640_0337106 | 3300046533 | Bacteria | 932 |
| 579 | Ga0495598_0035860 | 3300046537 | Bacteria | 1422 |
| 580 | Ga0495621_0000068 | 3300046539 | Bacteria | 20404 |
| 581 | Ga0495621_0003713 | 3300046539 | Bacteria | 4226 |
| 582 | Ga0495621_0021505 | 3300046539 | Bacteria | 2127 |
| 583 | Ga0495633_0028137 | 3300046558 | Bacteria | 2742 |
| 584 | Ga0495667_0180617 | 3300046559 | Bacteria | 1354 |
| 585 | Ga0495634_0343146 | 3300046642 | Bacteria | 895 |
| 586 | Ga0495611_0150681 | 3300046648 | Bacteria | 1086 |
| 587 | Ga0495659_0001941 | 3300046664 | Bacteria | 6820 |
| 588 | Ga0495659_0023876 | 3300046664 | Bacteria | 2080 |
| 589 | Ga0495659_0087353 | 3300046664 | Bacteria | 1192 |
| 590 | Ga0495670_0058596 | 3300046691 | Bacteria | 1933 |
| 591 | Ga0495636_0008433 | 3300047318 | Bacteria | 4066 |
| 592 | Ga0495636_0059286 | 3300047318 | Bacteria | 1615 |
| 593 | Ga0495685_013370 | 3300047447 | Bacteria | 2786 |
| 594 | Ga0496102_0232266 | 3300048905 | Bacteria | 1739 |
| 595 | Ga0496104_0196663 | 3300048907 | Bacteria | 1928 |
| 596 | Ga0496104_0408010 | 3300048907 | Bacteria | 1271 |
| 597 | Ga0496109_0001883 | 3300048912 | Bacteria | 17398 |
| 598 | Ga0496109_0237155 | 3300048912 | Bacteria | 1716 |
| 599 | Ga0496110_0001704 | 3300048913 | Bacteria | 16172 |
| 600 | Ga0496111_0035301 | 3300048914 | Bacteria | 3573 |
| 601 | Ga0496112_0029044 | 3300048915 | Bacteria | 5346 |
| 602 | Ga0496112_0056723 | 3300048915 | Bacteria | 3856 |
| 603 | Ga0496112_0070709 | 3300048915 | Bacteria | 3449 |
| 604 | Ga0501034_0030152 | 3300049571 | Bacteria | 5512 |
| 605 | Ga0501034_0192634 | 3300049571 | Bacteria | 2000 |
| 606 | Ga0501036_0018336 | 3300049572 | Bacteria | 5861 |
| 607 | Ga0501036_0044850 | 3300049572 | Bacteria | 3746 |
| 608 | Ga0501038_0564095 | 3300049574 | Bacteria | 865 |
| 609 | Ga0501040_0035844 | 3300049576 | Bacteria | 3366 |
| 610 | Ga0501041_0041438 | 3300049577 | Bacteria | 2797 |
| 611 | Ga0501041_0144180 | 3300049577 | Bacteria | 1486 |
| 612 | Ga0501041_0169242 | 3300049577 | Bacteria | 1367 |
| 613 | Ga0501042_0244947 | 3300049578 | Bacteria | 1293 |
| 614 | Ga0501042_0282449 | 3300049578 | Bacteria | 1199 |
| 615 | Ga0501043_0219065 | 3300049579 | Bacteria | 1473 |
| 616 | Ga0501046_0127346 | 3300049580 | Bacteria | 1933 |
| 617 | Ga0501047_0028729 | 3300049581 | Bacteria | 5363 |
| 618 | Ga0501047_0105108 | 3300049581 | Bacteria | 2704 |
| 619 | Ga0501048_0012795 | 3300049582 | Bacteria | 6236 |
| 620 | Ga0501048_0036313 | 3300049582 | Bacteria | 3542 |
| 621 | Ga0501048_0058057 | 3300049582 | Bacteria | 2744 |
| 622 | Ga0501048_0100345 | 3300049582 | Bacteria | 2042 |
| 623 | Ga0501068_0416745 | 3300049584 | Bacteria | 867 |
| 624 | Ga0501069_0020387 | 3300049585 | Bacteria | 3592 |
| 625 | Ga0501069_0244555 | 3300049585 | Bacteria | 1046 |
| 626 | Ga0501070_0503380 | 3300049586 | Bacteria | 973 |
| 627 | Ga0501071_0097243 | 3300049587 | Bacteria | 2167 |
| 628 | Ga0501071_0350696 | 3300049587 | Bacteria | 1123 |
| 629 | Ga0501072_0071364 | 3300049588 | Bacteria | 2744 |
| 630 | Ga0501072_0540346 | 3300049588 | Bacteria | 921 |
| 631 | Ga0501074_0284580 | 3300049590 | Bacteria | 1175 |
| 632 | Ga0501074_0335896 | 3300049590 | Bacteria | 1072 |
| 633 | Ga0501075_0021816 | 3300049591 | Bacteria | 4672 |
| 634 | Ga0501075_0036917 | 3300049591 | Bacteria | 3648 |
| 635 | Ga0501075_0176420 | 3300049591 | Bacteria | 1631 |
| 636 | Ga0501076_0034496 | 3300049592 | Bacteria | 3955 |
| 637 | Ga0501076_0224136 | 3300049592 | Bacteria | 1536 |
| 638 | Ga0501076_0235578 | 3300049592 | Bacteria | 1497 |
| 639 | Ga0501076_0303958 | 3300049592 | Bacteria | 1308 |
| 640 | Ga0501077_0183534 | 3300049593 | Bacteria | 1329 |
| 641 | Ga0501079_0371620 | 3300049741 | Bacteria | 1121 |
| 642 | Ga0501079_0414127 | 3300049741 | Bacteria | 1057 |
| 643 | Ga0501079_0461654 | 3300049741 | Bacteria | 997 |
| 644 | Ga0501080_0314393 | 3300049742 | Bacteria | 1419 |
| 645 | Ga0501080_0770802 | 3300049742 | Bacteria | 845 |
| 646 | Ga0501083_0000455 | 3300049744 | Bacteria | 26198 |
| 647 | Ga0501035_0459386 | 3300049822 | Bacteria | 1053 |
| 648 | Ga0501044_0015771 | 3300049823 | Bacteria | 8136 |
| 649 | Ga0501045_0019410 | 3300049824 | Bacteria | 4846 |
| 650 | Ga0501045_0194144 | 3300049824 | Bacteria | 1513 |
| 651 | Ga0501045_0272086 | 3300049824 | Bacteria | 1261 |
| 652 | Ga0501045_0348345 | 3300049824 | Bacteria | 1102 |
| 653 | nmdc:mga03n38_128780_c1 | 3300050490 | Bacteria | 1252 |
| 654 | nmdc:mga0k408_1178_c1 | 3300050493 | Bacteria | 14303 |
| 655 | nmdc:mga06z11_210692_c1 | 3300050494 | Bacteria | 1132 |
| 656 | nmdc:mga06z11_243300_c1 | 3300050494 | Bacteria | 1057 |
| 657 | nmdc:mga06z11_34628_c1 | 3300050494 | Bacteria | 2481 |
| 658 | nmdc:mga05p37_1071903_c1 | 3300050507 | Bacteria | 847 |
| 659 | nmdc:mga05p37_267894_c1 | 3300050507 | Bacteria | 2042 |
| 660 | nmdc:mga05p37_393402_c1 | 3300050507 | Bacteria | 1620 |
| 661 | nmdc:mga05p37_511932_c1 | 3300050507 | Bacteria | 1375 |
| 662 | nmdc:mga05p37_71942_c1 | 3300050507 | Bacteria | 4255 |
| 663 | nmdc:mga09592_254716_c1 | 3300050508 | Bacteria | 1521 |
| 664 | nmdc:mga09592_58490_c1 | 3300050508 | Bacteria | 3259 |
| 665 | nmdc:mga0qj67_139422_c1 | 3300050509 | Bacteria | 1966 |
| 666 | nmdc:mga0qj67_182709_c1 | 3300050509 | Bacteria | 1703 |
| 667 | nmdc:mga06r32_165971_c1 | 3300050510 | Bacteria | 2191 |
| 668 | nmdc:mga06r32_627354_c1 | 3300050510 | Bacteria | 1044 |
| 669 | nmdc:mga06r32_7080_c1 | 3300050510 | Bacteria | 10094 |
| 670 | nmdc:mga06r32_82668_c1 | 3300050510 | Bacteria | 3129 |
| 671 | nmdc:mga06r32_97705_c1 | 3300050510 | Bacteria | 2878 |
| 672 | nmdc:mga08y16_117465_c1 | 3300050511 | Bacteria | 2768 |
| 673 | nmdc:mga08y16_39235_c1 | 3300050511 | Unclassified | 4969 |
| 674 | nmdc:mga08y16_403685_c1 | 3300050511 | Bacteria | 1398 |
| 675 | nmdc:mga08y16_419863_c1 | 3300050511 | Bacteria | 1367 |
| 676 | nmdc:mga08y16_480387_c1 | 3300050511 | Bacteria | 1264 |
| 677 | nmdc:mga08y16_739_c1 | 3300050511 | Bacteria | 31074 |
| 678 | nmdc:mga0n895_1055_c1 | 3300050512 | Bacteria | 20087 |
| 679 | nmdc:mga0n895_15813_c1 | 3300050512 | Bacteria | 6900 |
| 680 | nmdc:mga0n895_164058_c1 | 3300050512 | Bacteria | 2253 |
| 681 | nmdc:mga0n895_292324_c1 | 3300050512 | Bacteria | 1652 |
| 682 | nmdc:mga0n895_66262_c1 | 3300050512 | Bacteria | 3576 |
| 683 | nmdc:mga0rr50_132430_c1 | 3300050513 | Bacteria | 1998 |
| 684 | nmdc:mga0rr50_13456_c1 | 3300050513 | Bacteria | 5327 |
| 685 | nmdc:mga0rr50_229666_c1 | 3300050513 | Bacteria | 1535 |
| 686 | nmdc:mga0rr50_236124_c1 | 3300050513 | Bacteria | 1514 |
| 687 | nmdc:mga0rr50_89109_c1 | 3300050513 | Bacteria | 2398 |
| 688 | nmdc:mga0rr50_95687_c1 | 3300050513 | Bacteria | 2322 |
| 689 | nmdc:mga08x19_131776_c1 | 3300050514 | Bacteria | 1682 |
| 690 | nmdc:mga0a205_37510_c1 | 3300050515 | Bacteria | 4660 |
| 691 | nmdc:mga0a205_427978_c1 | 3300050515 | Bacteria | 1185 |
| 692 | nmdc:mga0a205_84335_c1 | 3300050515 | Bacteria | 3069 |
| 693 | Ga0495619_0391646 | 3300053085 | Bacteria | 960 |
| 694 | Ga0500628_016766 | 3300053129 | Bacteria | 1421 |
| 695 | Ga0500628_021855 | 3300053129 | Bacteria | 1303 |
| 696 | Ga0501084_0624591 | 3300054114 | Bacteria | 910 |
| 697 | Ga0590071_000810 | 3300059421 | Bacteria | 8733 |
| 698 | Ga0590075_000256 | 3300059424 | Bacteria | 14991 |
| 699 | Ga0590075_022287 | 3300059424 | Bacteria | 1585 |
| 700 | Ga0590077_000858 | 3300059426 | Bacteria | 7792 |
| 701 | Ga0590077_003633 | 3300059426 | Bacteria | 3188 |
| 702 | Ga0501082_0055759 | 3300060353 | Bacteria | 3404 |
| 703 | Ga0501082_0182993 | 3300060353 | Bacteria | 1823 |
| 704 | Ga0501082_0282621 | 3300060353 | Bacteria | 1444 |
| 705 | Ga0501082_0521983 | 3300060353 | Bacteria | 1038 |
| 706 | Ga0530510_0063833 | 3300061734 | Bacteria | 2667 |
| 707 | Ga0530510_0564406 | 3300061734 | Bacteria | 865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0020387 | Ga0501069_0020387_3016_3579 | 179 |
| 2 | 3300041509 | Ga0451843_0404721 | Ga0451843_0404721_13_573 | 186 |
| 3 | 3300036401 | Ga0373937_0291055 | Ga0373937_0291055_269_949 | 191 |
| 4 | 3300037068 | Ga0373925_0336091 | Ga0373925_0336091_90_773 | 194 |
| 5 | 3300009094 | Ga0111539_10000253 | Ga0111539_1000025342 | 196 |
| 6 | 3300027907 | Ga0207428_10005133 | Ga0207428_100051339 | 196 |
| 7 | 3300031911 | Ga0307412_10078519 | Ga0307412_100785194 | 199 |
| 8 | 3300032002 | Ga0307416_100288535 | Ga0307416_1002885352 | 201 |
| 9 | 3300032004 | Ga0307414_10203522 | Ga0307414_102035222 | 201 |
| 10 | 3300032005 | Ga0307411_10020596 | Ga0307411_100205963 | 201 |
| 11 | 3300009094 | Ga0111539_10467792 | Ga0111539_104677921 | 202 |
| 12 | 3300005364 | Ga0070673_100439641 | Ga0070673_1004396412 | 203 |
| 13 | 3300005365 | Ga0070688_100489244 | Ga0070688_1004892441 | 203 |
| 14 | 3300025960 | Ga0207651_10228472 | Ga0207651_102284722 | 203 |
| 15 | 3300049576 | Ga0501040_0035844 | Ga0501040_0035844_1096_1770 | 203 |
| 16 | 3300049577 | Ga0501041_0041438 | Ga0501041_0041438_1467_2141 | 203 |
| 17 | 3300049580 | Ga0501046_0127346 | Ga0501046_0127346_232_906 | 203 |
| 18 | 3300049582 | Ga0501048_0036313 | Ga0501048_0036313_1433_2107 | 203 |
| 19 | 3300049587 | Ga0501071_0097243 | Ga0501071_0097243_1202_1876 | 203 |
| 20 | 3300049592 | Ga0501076_0235578 | Ga0501076_0235578_447_1121 | 203 |
| 21 | 3300049741 | Ga0501079_0414127 | Ga0501079_0414127_436_1047 | 203 |
| 22 | 3300049741 | Ga0501079_0461654 | Ga0501079_0461654_44_718 | 203 |
| 23 | 3300049742 | Ga0501080_0770802 | Ga0501080_0770802_103_777 | 203 |
| 24 | 3300049822 | Ga0501035_0459386 | Ga0501035_0459386_353_1027 | 203 |
| 25 | 3300049824 | Ga0501045_0272086 | Ga0501045_0272086_417_1091 | 203 |
| 26 | 3300054114 | Ga0501084_0624591 | Ga0501084_0624591_121_795 | 203 |
| 27 | 3300060353 | Ga0501082_0182993 | Ga0501082_0182993_990_1664 | 203 |
| 28 | 3300060353 | Ga0501082_0521983 | Ga0501082_0521983_197_871 | 204 |
| 29 | 3300005337 | Ga0070682_100124406 | Ga0070682_1001244063 | 205 |
| 30 | 3300005366 | Ga0070659_100041253 | Ga0070659_1000412533 | 205 |
| 31 | 3300025932 | Ga0207690_10020688 | Ga0207690_100206883 | 206 |
| 32 | 3300036401 | Ga0373937_0791042 | Ga0373937_0791042_195_878 | 206 |
| 33 | 3300046533 | Ga0495640_0337106 | Ga0495640_0337106_64_747 | 206 |
| 34 | 3300046559 | Ga0495667_0180617 | Ga0495667_0180617_30_713 | 206 |
| 35 | 3300046642 | Ga0495634_0343146 | Ga0495634_0343146_110_793 | 206 |
| 36 | 3300048907 | Ga0496104_0408010 | Ga0496104_0408010_553_1236 | 206 |
| 37 | 3300053085 | Ga0495619_0391646 | Ga0495619_0391646_262_945 | 206 |
| 38 | 3300005293 | Ga0065715_10095823 | Ga0065715_100958235 | 207 |
| 39 | 3300028381 | Ga0268264_10007621 | Ga0268264_100076214 | 207 |
| 40 | 3300042004 | Ga0439445_0021089 | Ga0439445_0021089_703_1374 | 208 |
| 41 | 3300042156 | Ga0439446_0076565 | Ga0439446_0076565_335_1006 | 208 |
| 42 | 3300050513 | nmdc:mga0rr50_229666_c1 | nmdc:mga0rr50_229666_c1_558_1220 | 208 |
| 43 | 3300005518 | Ga0070699_100012762 | Ga0070699_1000127628 | 209 |
| 44 | 3300006844 | Ga0075428_100103590 | Ga0075428_1001035902 | 209 |
| 45 | 3300006846 | Ga0075430_100025586 | Ga0075430_1000255863 | 209 |
| 46 | 3300006847 | Ga0075431_100020518 | Ga0075431_1000205183 | 209 |
| 47 | 3300006880 | Ga0075429_100461716 | Ga0075429_1004617162 | 209 |
| 48 | 3300009147 | Ga0114129_10091479 | Ga0114129_100914793 | 209 |
| 49 | 3300050507 | nmdc:mga05p37_71942_c1 | nmdc:mga05p37_71942_c1_1010_1681 | 209 |
| 50 | 3300050508 | nmdc:mga09592_58490_c1 | nmdc:mga09592_58490_c1_830_1501 | 209 |
| 51 | 3300050509 | nmdc:mga0qj67_139422_c1 | nmdc:mga0qj67_139422_c1_807_1478 | 209 |
| 52 | 3300050510 | nmdc:mga06r32_82668_c1 | nmdc:mga06r32_82668_c1_789_1460 | 209 |
| 53 | 3300005290 | Ga0065712_10091706 | Ga0065712_100917063 | 211 |
| 54 | 3300005356 | Ga0070674_100370545 | Ga0070674_1003705452 | 211 |
| 55 | 3300005549 | Ga0070704_100208573 | Ga0070704_1002085732 | 211 |
| 56 | 3300049571 | Ga0501034_0192634 | Ga0501034_0192634_705_1394 | 211 |
| 57 | 3300049579 | Ga0501043_0219065 | Ga0501043_0219065_598_1287 | 211 |
| 58 | 3300049581 | Ga0501047_0028729 | Ga0501047_0028729_2791_3480 | 211 |
| 59 | 3300049586 | Ga0501070_0503380 | Ga0501070_0503380_224_913 | 211 |
| 60 | 3300049823 | Ga0501044_0015771 | Ga0501044_0015771_4925_5614 | 211 |
| 61 | 3300005353 | Ga0070669_100162072 | Ga0070669_1001620722 | 212 |
| 62 | 3300005354 | Ga0070675_100325192 | Ga0070675_1003251921 | 212 |
| 63 | 3300005356 | Ga0070674_100111820 | Ga0070674_1001118202 | 212 |
| 64 | 3300005530 | Ga0070679_100568634 | Ga0070679_1005686342 | 212 |
| 65 | 3300006871 | Ga0075434_100267612 | Ga0075434_1002676123 | 212 |
| 66 | 3300006914 | Ga0075436_100028414 | Ga0075436_1000284144 | 212 |
| 67 | 3300007076 | Ga0075435_100119361 | Ga0075435_1001193613 | 212 |
| 68 | 3300025923 | Ga0207681_10101372 | Ga0207681_101013722 | 212 |
| 69 | 3300025937 | Ga0207669_10028054 | Ga0207669_100280543 | 212 |
| 70 | 3300025972 | Ga0207668_10247533 | Ga0207668_102475332 | 212 |
| 71 | 3300037471 | Ga0395905_0844249 | Ga0395905_0844249_88_765 | 212 |
| 72 | 3300048915 | Ga0496112_0029044 | Ga0496112_0029044_2041_2826 | 212 |
| 73 | 3300050512 | nmdc:mga0n895_15813_c1 | nmdc:mga0n895_15813_c1_391_1071 | 212 |
| 74 | 3300050515 | nmdc:mga0a205_427978_c1 | nmdc:mga0a205_427978_c1_385_1065 | 212 |
| 75 | 3300009094 | Ga0111539_10144545 | Ga0111539_101445454 | 213 |
| 76 | 3300042156 | Ga0439446_0033837 | Ga0439446_0033837_323_997 | 213 |
| 77 | 3300050511 | nmdc:mga08y16_117465_c1 | nmdc:mga08y16_117465_c1_526_1212 | 213 |
| 78 | 3300003203 | JGI25406J46586_10007722 | JGI25406J46586_100077223 | 214 |
| 79 | 3300005331 | Ga0070670_100071634 | Ga0070670_1000716342 | 214 |
| 80 | 3300005344 | Ga0070661_100096402 | Ga0070661_1000964023 | 214 |
| 81 | 3300005355 | Ga0070671_100128670 | Ga0070671_1001286702 | 214 |
| 82 | 3300005367 | Ga0070667_100164100 | Ga0070667_1001641003 | 214 |
| 83 | 3300005455 | Ga0070663_100348092 | Ga0070663_1003480922 | 214 |
| 84 | 3300005544 | Ga0070686_100542948 | Ga0070686_1005429482 | 214 |
| 85 | 3300005564 | Ga0070664_100002524 | Ga0070664_1000025247 | 214 |
| 86 | 3300005985 | Ga0081539_10000106 | Ga0081539_1000010657 | 214 |
| 87 | 3300013306 | Ga0163162_10662496 | Ga0163162_106624962 | 214 |
| 88 | 3300025920 | Ga0207649_10061520 | Ga0207649_100615203 | 214 |
| 89 | 3300025925 | Ga0207650_10008282 | Ga0207650_100082824 | 214 |
| 90 | 3300025941 | Ga0207711_10217190 | Ga0207711_102171901 | 214 |
| 91 | 3300025942 | Ga0207689_10138462 | Ga0207689_101384623 | 214 |
| 92 | 3300025944 | Ga0207661_10001149 | Ga0207661_100011496 | 214 |
| 93 | 3300025945 | Ga0207679_10005938 | Ga0207679_100059387 | 214 |
| 94 | 3300025986 | Ga0207658_10136941 | Ga0207658_101369412 | 214 |
| 95 | 3300026067 | Ga0207678_10148174 | Ga0207678_101481742 | 214 |
| 96 | 3300026095 | Ga0207676_10502706 | Ga0207676_105027061 | 214 |
| 97 | 3300048912 | Ga0496109_0001883 | Ga0496109_0001883_16503_17174 | 214 |
| 98 | 3300048912 | Ga0496109_0237155 | Ga0496109_0237155_872_1555 | 214 |
| 99 | 3300048913 | Ga0496110_0001704 | Ga0496110_0001704_7593_8264 | 214 |
| 100 | 3300048914 | Ga0496111_0035301 | Ga0496111_0035301_1614_2285 | 214 |
| 101 | 3300048915 | Ga0496112_0056723 | Ga0496112_0056723_2197_2868 | 214 |
| 102 | 3300050512 | nmdc:mga0n895_164058_c1 | nmdc:mga0n895_164058_c1_374_1045 | 214 |
| 103 | 3300005545 | Ga0070695_100248454 | Ga0070695_1002484542 | 215 |
| 104 | 3300005578 | Ga0068854_100358164 | Ga0068854_1003581642 | 215 |
| 105 | 3300006178 | Ga0075367_10241406 | Ga0075367_102414061 | 215 |
| 106 | 3300025937 | Ga0207669_10380093 | Ga0207669_103800932 | 215 |
| 107 | 3300025940 | Ga0207691_10342973 | Ga0207691_103429732 | 215 |
| 108 | 3300026116 | Ga0207674_10833870 | Ga0207674_108338702 | 215 |
| 109 | 3300050494 | nmdc:mga06z11_210692_c1 | nmdc:mga06z11_210692_c1_438_1088 | 215 |
| 110 | 3300053129 | Ga0500628_016766 | Ga0500628_016766_390_1073 | 215 |
| 111 | 3300005354 | Ga0070675_100005848 | Ga0070675_1000058486 | 216 |
| 112 | 3300005356 | Ga0070674_100006975 | Ga0070674_1000069752 | 216 |
| 113 | 3300005365 | Ga0070688_100043058 | Ga0070688_1000430582 | 216 |
| 114 | 3300005367 | Ga0070667_100036013 | Ga0070667_1000360131 | 216 |
| 115 | 3300005438 | Ga0070701_10031025 | Ga0070701_100310251 | 216 |
| 116 | 3300005444 | Ga0070694_100081847 | Ga0070694_1000818473 | 216 |
| 117 | 3300005444 | Ga0070694_100113810 | Ga0070694_1001138101 | 216 |
| 118 | 3300005455 | Ga0070663_100062034 | Ga0070663_1000620343 | 216 |
| 119 | 3300005459 | Ga0068867_100006574 | Ga0068867_1000065743 | 216 |
| 120 | 3300005467 | Ga0070706_100832332 | Ga0070706_1008323321 | 216 |
| 121 | 3300005468 | Ga0070707_100243467 | Ga0070707_1002434673 | 216 |
| 122 | 3300005468 | Ga0070707_100265784 | Ga0070707_1002657842 | 216 |
| 123 | 3300005471 | Ga0070698_100242251 | Ga0070698_1002422512 | 216 |
| 124 | 3300005544 | Ga0070686_100006552 | Ga0070686_1000065523 | 216 |
| 125 | 3300005549 | Ga0070704_100062260 | Ga0070704_1000622602 | 216 |
| 126 | 3300005615 | Ga0070702_100433717 | Ga0070702_1004337172 | 216 |
| 127 | 3300005617 | Ga0068859_100019849 | Ga0068859_1000198493 | 216 |
| 128 | 3300005618 | Ga0068864_100134476 | Ga0068864_1001344762 | 216 |
| 129 | 3300005719 | Ga0068861_100010900 | Ga0068861_1000109004 | 216 |
| 130 | 3300005841 | Ga0068863_100042922 | Ga0068863_1000429223 | 216 |
| 131 | 3300005842 | Ga0068858_100005046 | Ga0068858_10000504612 | 216 |
| 132 | 3300005843 | Ga0068860_100079061 | Ga0068860_1000790612 | 216 |
| 133 | 3300005844 | Ga0068862_100032432 | Ga0068862_1000324323 | 216 |
| 134 | 3300006038 | Ga0075365_10114053 | Ga0075365_101140533 | 216 |
| 135 | 3300006048 | Ga0075363_100361720 | Ga0075363_1003617202 | 216 |
| 136 | 3300006051 | Ga0075364_10241359 | Ga0075364_102413592 | 216 |
| 137 | 3300006177 | Ga0075362_10004952 | Ga0075362_100049524 | 216 |
| 138 | 3300006178 | Ga0075367_10050056 | Ga0075367_100500562 | 216 |
| 139 | 3300006195 | Ga0075366_10000340 | Ga0075366_1000034015 | 216 |
| 140 | 3300006846 | Ga0075430_100045984 | Ga0075430_1000459842 | 216 |
| 141 | 3300006846 | Ga0075430_100155366 | Ga0075430_1001553662 | 216 |
| 142 | 3300006871 | Ga0075434_100055428 | Ga0075434_1000554284 | 216 |
| 143 | 3300006931 | Ga0097620_100019848 | Ga0097620_1000198486 | 216 |
| 144 | 3300009094 | Ga0111539_10003215 | Ga0111539_100032156 | 216 |
| 145 | 3300009147 | Ga0114129_10080023 | Ga0114129_100800232 | 216 |
| 146 | 3300009148 | Ga0105243_10002751 | Ga0105243_1000275111 | 216 |
| 147 | 3300009177 | Ga0105248_10024378 | Ga0105248_100243786 | 216 |
| 148 | 3300009553 | Ga0105249_10041995 | Ga0105249_100419953 | 216 |
| 149 | 3300009553 | Ga0105249_10150337 | Ga0105249_101503372 | 216 |
| 150 | 3300013308 | Ga0157375_10079505 | Ga0157375_100795053 | 216 |
| 151 | 3300014326 | Ga0157380_10070744 | Ga0157380_100707443 | 216 |
| 152 | 3300014968 | Ga0157379_10012602 | Ga0157379_100126023 | 216 |
| 153 | 3300025907 | Ga0207645_10177585 | Ga0207645_101775852 | 216 |
| 154 | 3300025908 | Ga0207643_10032604 | Ga0207643_100326043 | 216 |
| 155 | 3300025910 | Ga0207684_10944923 | Ga0207684_109449231 | 216 |
| 156 | 3300025918 | Ga0207662_10001930 | Ga0207662_100019303 | 216 |
| 157 | 3300025922 | Ga0207646_10092492 | Ga0207646_100924924 | 216 |
| 158 | 3300025937 | Ga0207669_10005893 | Ga0207669_100058936 | 216 |
| 159 | 3300025938 | Ga0207704_10013084 | Ga0207704_100130844 | 216 |
| 160 | 3300025942 | Ga0207689_10013122 | Ga0207689_100131224 | 216 |
| 161 | 3300025961 | Ga0207712_10041096 | Ga0207712_100410963 | 216 |
| 162 | 3300025986 | Ga0207658_10656217 | Ga0207658_106562172 | 216 |
| 163 | 3300026023 | Ga0207677_10231171 | Ga0207677_102311712 | 216 |
| 164 | 3300026035 | Ga0207703_10021915 | Ga0207703_100219155 | 216 |
| 165 | 3300026067 | Ga0207678_10069168 | Ga0207678_100691683 | 216 |
| 166 | 3300026075 | Ga0207708_10005930 | Ga0207708_100059307 | 216 |
| 167 | 3300026088 | Ga0207641_10113057 | Ga0207641_101130573 | 216 |
| 168 | 3300026089 | Ga0207648_10003433 | Ga0207648_100034337 | 216 |
| 169 | 3300026095 | Ga0207676_10127093 | Ga0207676_101270933 | 216 |
| 170 | 3300026116 | Ga0207674_10089673 | Ga0207674_100896733 | 216 |
| 171 | 3300026118 | Ga0207675_100008779 | Ga0207675_1000087795 | 216 |
| 172 | 3300026121 | Ga0207683_10033865 | Ga0207683_100338654 | 216 |
| 173 | 3300027907 | Ga0207428_10000085 | Ga0207428_1000008591 | 216 |
| 174 | 3300028380 | Ga0268265_10045365 | Ga0268265_100453652 | 216 |
| 175 | 3300028381 | Ga0268264_10611157 | Ga0268264_106111572 | 216 |
| 176 | 3300035725 | Ga0373947_0025933 | Ga0373947_0025933_722_1393 | 216 |
| 177 | 3300039062 | Ga0400483_032668 | Ga0400483_032668_2302_2952 | 216 |
| 178 | 3300039062 | Ga0400483_248230 | Ga0400483_248230_5330_5980 | 216 |
| 179 | 3300049572 | Ga0501036_0044850 | Ga0501036_0044850_998_1648 | 216 |
| 180 | 3300049577 | Ga0501041_0169242 | Ga0501041_0169242_130_780 | 216 |
| 181 | 3300049578 | Ga0501042_0244947 | Ga0501042_0244947_198_848 | 216 |
| 182 | 3300049582 | Ga0501048_0012795 | Ga0501048_0012795_288_938 | 216 |
| 183 | 3300049584 | Ga0501068_0416745 | Ga0501068_0416745_164_814 | 216 |
| 184 | 3300049588 | Ga0501072_0071364 | Ga0501072_0071364_1357_2007 | 216 |
| 185 | 3300049591 | Ga0501075_0021816 | Ga0501075_0021816_549_1199 | 216 |
| 186 | 3300049592 | Ga0501076_0034496 | Ga0501076_0034496_826_1476 | 216 |
| 187 | 3300049824 | Ga0501045_0348345 | Ga0501045_0348345_241_891 | 216 |
| 188 | 3300050493 | nmdc:mga0k408_1178_c1 | nmdc:mga0k408_1178_c1_2121_2771 | 216 |
| 189 | 3300050494 | nmdc:mga06z11_34628_c1 | nmdc:mga06z11_34628_c1_1292_1942 | 216 |
| 190 | 3300050507 | nmdc:mga05p37_1071903_c1 | nmdc:mga05p37_1071903_c1_99_749 | 216 |
| 191 | 3300050507 | nmdc:mga05p37_393402_c1 | nmdc:mga05p37_393402_c1_380_1030 | 216 |
| 192 | 3300050508 | nmdc:mga09592_254716_c1 | nmdc:mga09592_254716_c1_804_1454 | 216 |
| 193 | 3300050509 | nmdc:mga0qj67_182709_c1 | nmdc:mga0qj67_182709_c1_698_1348 | 216 |
| 194 | 3300050510 | nmdc:mga06r32_7080_c1 | nmdc:mga06r32_7080_c1_8406_9056 | 216 |
| 195 | 3300050510 | nmdc:mga06r32_97705_c1 | nmdc:mga06r32_97705_c1_567_1217 | 216 |
| 196 | 3300050511 | nmdc:mga08y16_739_c1 | nmdc:mga08y16_739_c1_9259_9909 | 216 |
| 197 | 3300050513 | nmdc:mga0rr50_13456_c1 | nmdc:mga0rr50_13456_c1_1927_2577 | 216 |
| 198 | 3300050515 | nmdc:mga0a205_37510_c1 | nmdc:mga0a205_37510_c1_501_1151 | 216 |
| 199 | 3300060353 | Ga0501082_0055759 | Ga0501082_0055759_1978_2628 | 216 |
| 200 | iso_pu_bacteria | 2554235227 | 2555231249 | 216 |
| 201 | iso_pu_bacteria | 2654587600 | 2655032911 | 216 |
| 202 | 3300009094 | Ga0111539_10428297 | Ga0111539_104282972 | 217 |
| 203 | 3300042005 | Ga0439448_0156988 | Ga0439448_0156988_87_767 | 217 |
| 204 | 3300050490 | nmdc:mga03n38_128780_c1 | nmdc:mga03n38_128780_c1_372_1025 | 217 |
| 205 | 3300050511 | nmdc:mga08y16_480387_c1 | nmdc:mga08y16_480387_c1_405_1058 | 217 |
| 206 | 3300005327 | Ga0070658_10445547 | Ga0070658_104455472 | 218 |
| 207 | 3300006871 | Ga0075434_100523532 | Ga0075434_1005235322 | 218 |
| 208 | 3300006914 | Ga0075436_100087038 | Ga0075436_1000870383 | 218 |
| 209 | 3300050514 | nmdc:mga08x19_131776_c1 | nmdc:mga08x19_131776_c1_683_1369 | 218 |
| 210 | 3300014969 | Ga0157376_10095204 | Ga0157376_100952042 | 219 |
| 211 | 3300025921 | Ga0207652_10382824 | Ga0207652_103828242 | 219 |
| 212 | 3300038727 | Ga0400491_22105 | Ga0400491_22105_38_697 | 219 |
| 213 | 3300038735 | Ga0400485_10833 | Ga0400485_10833_12037_12696 | 219 |
| 214 | 3300038742 | Ga0400486_01644 | Ga0400486_01644_58761_59420 | 219 |
| 215 | 3300038742 | Ga0400486_13502 | Ga0400486_13502_31995_32654 | 219 |
| 216 | 3300039110 | Ga0400487_35213 | Ga0400487_35213_1331_1990 | 219 |
| 217 | 3300039110 | Ga0400487_39899 | Ga0400487_39899_60974_61633 | 219 |
| 218 | 3300044712 | Ga0453684_0005948 | Ga0453684_0005948_22702_23388 | 219 |
| 219 | 3300044712 | Ga0453684_0280745 | Ga0453684_0280745_48_710 | 219 |
| 220 | 3300046522 | Ga0495643_0006118 | Ga0495643_0006118_2693_3376 | 219 |
| 221 | 3300049577 | Ga0501041_0144180 | Ga0501041_0144180_62_721 | 219 |
| 222 | 3300049582 | Ga0501048_0058057 | Ga0501048_0058057_357_1016 | 219 |
| 223 | 3300049592 | Ga0501076_0303958 | Ga0501076_0303958_212_871 | 219 |
| 224 | 3300049824 | Ga0501045_0019410 | Ga0501045_0019410_241_900 | 219 |
| 225 | 3300061734 | Ga0530510_0063833 | Ga0530510_0063833_1950_2609 | 219 |
| 226 | 3300005327 | Ga0070658_10167972 | Ga0070658_101679722 | 220 |
| 227 | 3300005333 | Ga0070677_10082361 | Ga0070677_100823612 | 220 |
| 228 | 3300005344 | Ga0070661_100432110 | Ga0070661_1004321101 | 220 |
| 229 | 3300005354 | Ga0070675_100618289 | Ga0070675_1006182892 | 220 |
| 230 | 3300005366 | Ga0070659_100050970 | Ga0070659_1000509705 | 220 |
| 231 | 3300005367 | Ga0070667_100280976 | Ga0070667_1002809762 | 220 |
| 232 | 3300005434 | Ga0070709_10167110 | Ga0070709_101671102 | 220 |
| 233 | 3300005444 | Ga0070694_100309030 | Ga0070694_1003090302 | 220 |
| 234 | 3300005457 | Ga0070662_100241251 | Ga0070662_1002412513 | 220 |
| 235 | 3300005466 | Ga0070685_10007355 | Ga0070685_100073552 | 220 |
| 236 | 3300005539 | Ga0068853_100226260 | Ga0068853_1002262602 | 220 |
| 237 | 3300005547 | Ga0070693_100037985 | Ga0070693_1000379854 | 220 |
| 238 | 3300005548 | Ga0070665_100002913 | Ga0070665_10000291317 | 220 |
| 239 | 3300005564 | Ga0070664_100492557 | Ga0070664_1004925572 | 220 |
| 240 | 3300005616 | Ga0068852_100191629 | Ga0068852_1001916292 | 220 |
| 241 | 3300005834 | Ga0068851_10193709 | Ga0068851_101937092 | 220 |
| 242 | 3300005842 | Ga0068858_100273211 | Ga0068858_1002732111 | 220 |
| 243 | 3300009094 | Ga0111539_10607802 | Ga0111539_106078022 | 220 |
| 244 | 3300025893 | Ga0207682_10030309 | Ga0207682_100303092 | 220 |
| 245 | 3300025903 | Ga0207680_10021143 | Ga0207680_100211435 | 220 |
| 246 | 3300025907 | Ga0207645_10007927 | Ga0207645_100079276 | 220 |
| 247 | 3300025909 | Ga0207705_10137462 | Ga0207705_101374622 | 220 |
| 248 | 3300025918 | Ga0207662_10004273 | Ga0207662_100042737 | 220 |
| 249 | 3300025926 | Ga0207659_10678717 | Ga0207659_106787172 | 220 |
| 250 | 3300025933 | Ga0207706_10100215 | Ga0207706_101002152 | 220 |
| 251 | 3300025940 | Ga0207691_10438000 | Ga0207691_104380002 | 220 |
| 252 | 3300025942 | Ga0207689_10057438 | Ga0207689_100574383 | 220 |
| 253 | 3300026041 | Ga0207639_10612819 | Ga0207639_106128192 | 220 |
| 254 | 3300026089 | Ga0207648_10123543 | Ga0207648_101235432 | 220 |
| 255 | 3300026121 | Ga0207683_10064623 | Ga0207683_100646232 | 220 |
| 256 | 3300026142 | Ga0207698_10157919 | Ga0207698_101579192 | 220 |
| 257 | 3300028379 | Ga0268266_10002732 | Ga0268266_1000273215 | 220 |
| 258 | 3300031727 | Ga0316576_10121623 | Ga0316576_101216233 | 220 |
| 259 | 3300031733 | Ga0316577_10239459 | Ga0316577_102394592 | 220 |
| 260 | 3300031911 | Ga0307412_10279405 | Ga0307412_102794052 | 220 |
| 261 | 3300032133 | Ga0316583_10007523 | Ga0316583_100075233 | 220 |
| 262 | 3300032139 | Ga0316580_10038502 | Ga0316580_100385022 | 220 |
| 263 | 3300036647 | Ga0316582_0107406 | Ga0316582_0107406_967_1629 | 220 |
| 264 | 3300036712 | Ga0316584_0028588 | Ga0316584_0028588_3112_3774 | 220 |
| 265 | 3300039062 | Ga0400483_232829 | Ga0400483_232829_585_1247 | 220 |
| 266 | 3300046539 | Ga0495621_0003713 | Ga0495621_0003713_1213_1887 | 220 |
| 267 | 3300049744 | Ga0501083_0000455 | Ga0501083_0000455_17879_18541 | 220 |
| 268 | 3300005344 | Ga0070661_100277839 | Ga0070661_1002778392 | 221 |
| 269 | 3300005354 | Ga0070675_100276395 | Ga0070675_1002763952 | 221 |
| 270 | 3300005468 | Ga0070707_100195861 | Ga0070707_1001958612 | 221 |
| 271 | 3300013296 | Ga0157374_10043530 | Ga0157374_100435304 | 221 |
| 272 | 3300013308 | Ga0157375_10183003 | Ga0157375_101830032 | 221 |
| 273 | 3300014326 | Ga0157380_10092723 | Ga0157380_100927233 | 221 |
| 274 | 3300025901 | Ga0207688_10238470 | Ga0207688_102384702 | 221 |
| 275 | 3300025903 | Ga0207680_10164132 | Ga0207680_101641323 | 221 |
| 276 | 3300025922 | Ga0207646_10172854 | Ga0207646_101728543 | 221 |
| 277 | 3300025925 | Ga0207650_10248611 | Ga0207650_102486112 | 221 |
| 278 | 3300025939 | Ga0207665_10293724 | Ga0207665_102937242 | 221 |
| 279 | 3300042876 | Ga0451577_0001333 | Ga0451577_0001333_20904_21569 | 221 |
| 280 | 3300044712 | Ga0453684_0000441 | Ga0453684_0000441_70001_70666 | 221 |
| 281 | 3300044712 | Ga0453684_0003492 | Ga0453684_0003492_1821_2489 | 221 |
| 282 | 3300046537 | Ga0495598_0035860 | Ga0495598_0035860_448_1125 | 221 |
| 283 | 3300046539 | Ga0495621_0021505 | Ga0495621_0021505_916_1593 | 221 |
| 284 | 3300046558 | Ga0495633_0028137 | Ga0495633_0028137_1490_2167 | 221 |
| 285 | 3300046691 | Ga0495670_0058596 | Ga0495670_0058596_686_1363 | 221 |
| 286 | 3300049582 | Ga0501048_0100345 | Ga0501048_0100345_25_696 | 221 |
| 287 | 3300050494 | nmdc:mga06z11_243300_c1 | nmdc:mga06z11_243300_c1_119_784 | 221 |
| 288 | 3300005336 | Ga0070680_100664250 | Ga0070680_1006642501 | 222 |
| 289 | 3300005341 | Ga0070691_10036282 | Ga0070691_100362823 | 222 |
| 290 | 3300005365 | Ga0070688_100425928 | Ga0070688_1004259282 | 222 |
| 291 | 3300005438 | Ga0070701_10004888 | Ga0070701_100048886 | 222 |
| 292 | 3300005440 | Ga0070705_100000088 | Ga0070705_10000008846 | 222 |
| 293 | 3300005444 | Ga0070694_100007737 | Ga0070694_1000077375 | 222 |
| 294 | 3300005536 | Ga0070697_100155654 | Ga0070697_1001556542 | 222 |
| 295 | 3300005545 | Ga0070695_100000021 | Ga0070695_10000002134 | 222 |
| 296 | 3300005546 | Ga0070696_100000016 | Ga0070696_10000001646 | 222 |
| 297 | 3300005548 | Ga0070665_100301934 | Ga0070665_1003019342 | 222 |
| 298 | 3300005549 | Ga0070704_100350785 | Ga0070704_1003507852 | 222 |
| 299 | 3300005615 | Ga0070702_100024288 | Ga0070702_1000242883 | 222 |
| 300 | 3300006846 | Ga0075430_100115480 | Ga0075430_1001154803 | 222 |
| 301 | 3300006871 | Ga0075434_100001393 | Ga0075434_10000139311 | 222 |
| 302 | 3300009093 | Ga0105240_10920090 | Ga0105240_109200901 | 222 |
| 303 | 3300009545 | Ga0105237_10007566 | Ga0105237_1000756610 | 222 |
| 304 | 3300025912 | Ga0207707_10067961 | Ga0207707_100679612 | 222 |
| 305 | 3300025913 | Ga0207695_10677417 | Ga0207695_106774171 | 222 |
| 306 | 3300025914 | Ga0207671_10022996 | Ga0207671_100229966 | 222 |
| 307 | 3300025917 | Ga0207660_10088488 | Ga0207660_100884882 | 222 |
| 308 | 3300031548 | Ga0307408_100043786 | Ga0307408_1000437863 | 222 |
| 309 | 3300031731 | Ga0307405_10029783 | Ga0307405_100297833 | 222 |
| 310 | 3300031824 | Ga0307413_10013614 | Ga0307413_100136142 | 222 |
| 311 | 3300031852 | Ga0307410_10011533 | Ga0307410_100115336 | 222 |
| 312 | 3300031852 | Ga0307410_10332085 | Ga0307410_103320851 | 222 |
| 313 | 3300031901 | Ga0307406_10019269 | Ga0307406_100192695 | 222 |
| 314 | 3300031903 | Ga0307407_10026375 | Ga0307407_100263753 | 222 |
| 315 | 3300031911 | Ga0307412_10028538 | Ga0307412_100285383 | 222 |
| 316 | 3300031995 | Ga0307409_100002483 | Ga0307409_10000248313 | 222 |
| 317 | 3300031995 | Ga0307409_100133809 | Ga0307409_1001338093 | 222 |
| 318 | 3300032002 | Ga0307416_100002720 | Ga0307416_1000027202 | 222 |
| 319 | 3300032004 | Ga0307414_10149177 | Ga0307414_101491772 | 222 |
| 320 | 3300032005 | Ga0307411_10013381 | Ga0307411_100133815 | 222 |
| 321 | 3300032126 | Ga0307415_100039123 | Ga0307415_1000391232 | 222 |
| 322 | 3300032126 | Ga0307415_100775477 | Ga0307415_1007754771 | 222 |
| 323 | 3300042876 | Ga0451577_0103059 | Ga0451577_0103059_1284_1964 | 222 |
| 324 | 3300045051 | Ga0451576_0027569 | Ga0451576_0027569_2341_3021 | 222 |
| 325 | 3300045051 | Ga0451576_0271090 | Ga0451576_0271090_559_1239 | 222 |
| 326 | 3300046648 | Ga0495611_0150681 | Ga0495611_0150681_79_759 | 222 |
| 327 | 3300046664 | Ga0495659_0023876 | Ga0495659_0023876_330_1010 | 222 |
| 328 | 3300047318 | Ga0495636_0008433 | Ga0495636_0008433_2533_3213 | 222 |
| 329 | 3300047447 | Ga0495685_013370 | Ga0495685_013370_655_1335 | 222 |
| 330 | 3300049591 | Ga0501075_0176420 | Ga0501075_0176420_177_857 | 222 |
| 331 | 3300050512 | nmdc:mga0n895_1055_c1 | nmdc:mga0n895_1055_c1_8413_9093 | 222 |
| 332 | 3300061734 | Ga0530510_0564406 | Ga0530510_0564406_15_695 | 222 |
| 333 | 3300005293 | Ga0065715_10145282 | Ga0065715_101452822 | 223 |
| 334 | 3300005295 | Ga0065707_10086593 | Ga0065707_100865937 | 223 |
| 335 | 3300005336 | Ga0070680_100543053 | Ga0070680_1005430532 | 223 |
| 336 | 3300005337 | Ga0070682_100320152 | Ga0070682_1003201522 | 223 |
| 337 | 3300005353 | Ga0070669_100001038 | Ga0070669_10000103812 | 223 |
| 338 | 3300005354 | Ga0070675_100042144 | Ga0070675_1000421444 | 223 |
| 339 | 3300005364 | Ga0070673_100912044 | Ga0070673_1009120441 | 223 |
| 340 | 3300005366 | Ga0070659_100169075 | Ga0070659_1001690752 | 223 |
| 341 | 3300005438 | Ga0070701_10037172 | Ga0070701_100371722 | 223 |
| 342 | 3300005439 | Ga0070711_100222459 | Ga0070711_1002224592 | 223 |
| 343 | 3300005455 | Ga0070663_100282954 | Ga0070663_1002829541 | 223 |
| 344 | 3300005458 | Ga0070681_10011368 | Ga0070681_100113684 | 223 |
| 345 | 3300005530 | Ga0070679_100208385 | Ga0070679_1002083852 | 223 |
| 346 | 3300005577 | Ga0068857_100098931 | Ga0068857_1000989313 | 223 |
| 347 | 3300005578 | Ga0068854_100170512 | Ga0068854_1001705122 | 223 |
| 348 | 3300005840 | Ga0068870_10016974 | Ga0068870_100169742 | 223 |
| 349 | 3300005844 | Ga0068862_100242253 | Ga0068862_1002422532 | 223 |
| 350 | 3300006237 | Ga0097621_100343388 | Ga0097621_1003433882 | 223 |
| 351 | 3300006844 | Ga0075428_100007242 | Ga0075428_1000072425 | 223 |
| 352 | 3300006847 | Ga0075431_100034489 | Ga0075431_1000344897 | 223 |
| 353 | 3300006852 | Ga0075433_10071902 | Ga0075433_100719024 | 223 |
| 354 | 3300007076 | Ga0075435_100302214 | Ga0075435_1003022142 | 223 |
| 355 | 3300009094 | Ga0111539_10017868 | Ga0111539_100178689 | 223 |
| 356 | 3300009094 | Ga0111539_10064568 | Ga0111539_100645686 | 223 |
| 357 | 3300009147 | Ga0114129_10005104 | Ga0114129_100051043 | 223 |
| 358 | 3300009147 | Ga0114129_10206620 | Ga0114129_102066202 | 223 |
| 359 | 3300009553 | Ga0105249_10001485 | Ga0105249_1000148514 | 223 |
| 360 | 3300010375 | Ga0105239_10933960 | Ga0105239_109339602 | 223 |
| 361 | 3300011119 | Ga0105246_10642612 | Ga0105246_106426122 | 223 |
| 362 | 3300014745 | Ga0157377_10197591 | Ga0157377_101975912 | 223 |
| 363 | 3300025908 | Ga0207643_10078032 | Ga0207643_100780323 | 223 |
| 364 | 3300025912 | Ga0207707_10056337 | Ga0207707_100563373 | 223 |
| 365 | 3300025917 | Ga0207660_10458681 | Ga0207660_104586812 | 223 |
| 366 | 3300025921 | Ga0207652_10031233 | Ga0207652_100312332 | 223 |
| 367 | 3300025923 | Ga0207681_10013643 | Ga0207681_100136433 | 223 |
| 368 | 3300025937 | Ga0207669_10361057 | Ga0207669_103610572 | 223 |
| 369 | 3300025940 | Ga0207691_10346539 | Ga0207691_103465392 | 223 |
| 370 | 3300026116 | Ga0207674_10114204 | Ga0207674_101142043 | 223 |
| 371 | 3300026116 | Ga0207674_10523703 | Ga0207674_105237032 | 223 |
| 372 | 3300027717 | Ga0209998_10011182 | Ga0209998_100111822 | 223 |
| 373 | 3300027907 | Ga0207428_10070310 | Ga0207428_100703102 | 223 |
| 374 | 3300028380 | Ga0268265_10038871 | Ga0268265_100388712 | 223 |
| 375 | 3300028380 | Ga0268265_10211815 | Ga0268265_102118152 | 223 |
| 376 | 3300031548 | Ga0307408_100337784 | Ga0307408_1003377842 | 223 |
| 377 | 3300031852 | Ga0307410_10316653 | Ga0307410_103166532 | 223 |
| 378 | 3300031995 | Ga0307409_100031724 | Ga0307409_1000317243 | 223 |
| 379 | 3300031995 | Ga0307409_100069918 | Ga0307409_1000699182 | 223 |
| 380 | 3300032002 | Ga0307416_100097334 | Ga0307416_1000973344 | 223 |
| 381 | 3300032005 | Ga0307411_10657410 | Ga0307411_106574102 | 223 |
| 382 | 3300035170 | Ga0373943_0322151 | Ga0373943_0322151_127_798 | 223 |
| 383 | 3300042435 | Ga0439434_0015830 | Ga0439434_0015830_646_1317 | 223 |
| 384 | 3300042876 | Ga0451577_0037691 | Ga0451577_0037691_1042_1731 | 223 |
| 385 | 3300044712 | Ga0453684_0024766 | Ga0453684_0024766_1261_1950 | 223 |
| 386 | 3300044712 | Ga0453684_0048385 | Ga0453684_0048385_1997_2671 | 223 |
| 387 | 3300046475 | Ga0495639_0161727 | Ga0495639_0161727_310_981 | 223 |
| 388 | 3300048907 | Ga0496104_0196663 | Ga0496104_0196663_786_1475 | 223 |
| 389 | 3300048915 | Ga0496112_0070709 | Ga0496112_0070709_1427_2116 | 223 |
| 390 | 3300049574 | Ga0501038_0564095 | Ga0501038_0564095_31_711 | 223 |
| 391 | 3300049588 | Ga0501072_0540346 | Ga0501072_0540346_157_831 | 223 |
| 392 | 3300049593 | Ga0501077_0183534 | Ga0501077_0183534_353_1024 | 223 |
| 393 | 3300049742 | Ga0501080_0314393 | Ga0501080_0314393_443_1114 | 223 |
| 394 | 3300050507 | nmdc:mga05p37_267894_c1 | nmdc:mga05p37_267894_c1_735_1421 | 223 |
| 395 | 3300050507 | nmdc:mga05p37_511932_c1 | nmdc:mga05p37_511932_c1_674_1345 | 223 |
| 396 | 3300050510 | nmdc:mga06r32_165971_c1 | nmdc:mga06r32_165971_c1_916_1587 | 223 |
| 397 | 3300050511 | nmdc:mga08y16_39235_c1 | nmdc:mga08y16_39235_c1_1876_2547 | 223 |
| 398 | 3300050513 | nmdc:mga0rr50_95687_c1 | nmdc:mga0rr50_95687_c1_1186_1857 | 223 |
| 399 | 3300050515 | nmdc:mga0a205_84335_c1 | nmdc:mga0a205_84335_c1_2024_2695 | 223 |
| 400 | 3300059421 | Ga0590071_000810 | Ga0590071_000810_3812_4513 | 223 |
| 401 | 3300059424 | Ga0590075_000256 | Ga0590075_000256_5448_6149 | 223 |
| 402 | 3300059424 | Ga0590075_022287 | Ga0590075_022287_87_770 | 223 |
| 403 | 3300059426 | Ga0590077_000858 | Ga0590077_000858_4927_5628 | 223 |
| 404 | 3300059426 | Ga0590077_003633 | Ga0590077_003633_594_1277 | 223 |
| 405 | 3300060353 | Ga0501082_0282621 | Ga0501082_0282621_403_1074 | 223 |
| 406 | 3300005289 | Ga0065704_10004255 | Ga0065704_100042553 | 224 |
| 407 | 3300005295 | Ga0065707_10013372 | Ga0065707_100133722 | 224 |
| 408 | 3300005295 | Ga0065707_10114347 | Ga0065707_101143472 | 224 |
| 409 | 3300005330 | Ga0070690_100587910 | Ga0070690_1005879101 | 224 |
| 410 | 3300005331 | Ga0070670_100001697 | Ga0070670_1000016977 | 224 |
| 411 | 3300005333 | Ga0070677_10097759 | Ga0070677_100977592 | 224 |
| 412 | 3300005333 | Ga0070677_10129051 | Ga0070677_101290512 | 224 |
| 413 | 3300005334 | Ga0068869_100164040 | Ga0068869_1001640403 | 224 |
| 414 | 3300005334 | Ga0068869_100393231 | Ga0068869_1003932312 | 224 |
| 415 | 3300005343 | Ga0070687_100102897 | Ga0070687_1001028972 | 224 |
| 416 | 3300005343 | Ga0070687_100144082 | Ga0070687_1001440822 | 224 |
| 417 | 3300005344 | Ga0070661_100130333 | Ga0070661_1001303333 | 224 |
| 418 | 3300005354 | Ga0070675_100000507 | Ga0070675_10000050714 | 224 |
| 419 | 3300005354 | Ga0070675_100082077 | Ga0070675_1000820774 | 224 |
| 420 | 3300005354 | Ga0070675_100293529 | Ga0070675_1002935291 | 224 |
| 421 | 3300005355 | Ga0070671_100007835 | Ga0070671_1000078358 | 224 |
| 422 | 3300005364 | Ga0070673_100207766 | Ga0070673_1002077662 | 224 |
| 423 | 3300005364 | Ga0070673_100228049 | Ga0070673_1002280492 | 224 |
| 424 | 3300005364 | Ga0070673_100580737 | Ga0070673_1005807372 | 224 |
| 425 | 3300005438 | Ga0070701_10255049 | Ga0070701_102550492 | 224 |
| 426 | 3300005440 | Ga0070705_100215857 | Ga0070705_1002158572 | 224 |
| 427 | 3300005457 | Ga0070662_100241511 | Ga0070662_1002415112 | 224 |
| 428 | 3300005459 | Ga0068867_100010010 | Ga0068867_1000100107 | 224 |
| 429 | 3300005468 | Ga0070707_100040267 | Ga0070707_1000402675 | 224 |
| 430 | 3300005468 | Ga0070707_100076420 | Ga0070707_1000764203 | 224 |
| 431 | 3300005468 | Ga0070707_100534930 | Ga0070707_1005349302 | 224 |
| 432 | 3300005471 | Ga0070698_100001713 | Ga0070698_10000171317 | 224 |
| 433 | 3300005471 | Ga0070698_100404942 | Ga0070698_1004049422 | 224 |
| 434 | 3300005471 | Ga0070698_100591301 | Ga0070698_1005913012 | 224 |
| 435 | 3300005518 | Ga0070699_100003923 | Ga0070699_10000392312 | 224 |
| 436 | 3300005518 | Ga0070699_100054229 | Ga0070699_1000542294 | 224 |
| 437 | 3300005518 | Ga0070699_100091386 | Ga0070699_1000913863 | 224 |
| 438 | 3300005543 | Ga0070672_100009184 | Ga0070672_1000091843 | 224 |
| 439 | 3300005543 | Ga0070672_100258956 | Ga0070672_1002589562 | 224 |
| 440 | 3300005544 | Ga0070686_100435394 | Ga0070686_1004353942 | 224 |
| 441 | 3300005546 | Ga0070696_100023567 | Ga0070696_1000235672 | 224 |
| 442 | 3300005549 | Ga0070704_100000384 | Ga0070704_1000003846 | 224 |
| 443 | 3300005564 | Ga0070664_100020483 | Ga0070664_1000204832 | 224 |
| 444 | 3300005564 | Ga0070664_100258460 | Ga0070664_1002584602 | 224 |
| 445 | 3300005577 | Ga0068857_100042416 | Ga0068857_1000424163 | 224 |
| 446 | 3300005618 | Ga0068864_100054442 | Ga0068864_1000544423 | 224 |
| 447 | 3300005719 | Ga0068861_100016995 | Ga0068861_1000169954 | 224 |
| 448 | 3300005840 | Ga0068870_10003900 | Ga0068870_100039004 | 224 |
| 449 | 3300005841 | Ga0068863_100006191 | Ga0068863_10000619115 | 224 |
| 450 | 3300005842 | Ga0068858_100145183 | Ga0068858_1001451833 | 224 |
| 451 | 3300005843 | Ga0068860_100014433 | Ga0068860_1000144336 | 224 |
| 452 | 3300005843 | Ga0068860_101139891 | Ga0068860_1011398912 | 224 |
| 453 | 3300005844 | Ga0068862_100005891 | Ga0068862_1000058918 | 224 |
| 454 | 3300006844 | Ga0075428_100310513 | Ga0075428_1003105132 | 224 |
| 455 | 3300006847 | Ga0075431_100184693 | Ga0075431_1001846932 | 224 |
| 456 | 3300006871 | Ga0075434_100016592 | Ga0075434_1000165923 | 224 |
| 457 | 3300006871 | Ga0075434_100287489 | Ga0075434_1002874893 | 224 |
| 458 | 3300006880 | Ga0075429_100114599 | Ga0075429_1001145992 | 224 |
| 459 | 3300007076 | Ga0075435_100043029 | Ga0075435_1000430294 | 224 |
| 460 | 3300009094 | Ga0111539_10133175 | Ga0111539_101331753 | 224 |
| 461 | 3300009094 | Ga0111539_10582099 | Ga0111539_105820992 | 224 |
| 462 | 3300009147 | Ga0114129_10003607 | Ga0114129_100036074 | 224 |
| 463 | 3300009148 | Ga0105243_10094272 | Ga0105243_100942723 | 224 |
| 464 | 3300009553 | Ga0105249_10312288 | Ga0105249_103122882 | 224 |
| 465 | 3300009553 | Ga0105249_10533751 | Ga0105249_105337512 | 224 |
| 466 | 3300013306 | Ga0163162_10142684 | Ga0163162_101426843 | 224 |
| 467 | 3300013308 | Ga0157375_10035943 | Ga0157375_100359434 | 224 |
| 468 | 3300013308 | Ga0157375_10191689 | Ga0157375_101916893 | 224 |
| 469 | 3300014325 | Ga0163163_10298780 | Ga0163163_102987802 | 224 |
| 470 | 3300014326 | Ga0157380_10003938 | Ga0157380_100039386 | 224 |
| 471 | 3300014326 | Ga0157380_10007433 | Ga0157380_100074337 | 224 |
| 472 | 3300014745 | Ga0157377_10033384 | Ga0157377_100333844 | 224 |
| 473 | 3300014745 | Ga0157377_10327080 | Ga0157377_103270802 | 224 |
| 474 | 3300014969 | Ga0157376_10192398 | Ga0157376_101923983 | 224 |
| 475 | 3300025893 | Ga0207682_10045704 | Ga0207682_100457043 | 224 |
| 476 | 3300025908 | Ga0207643_10011995 | Ga0207643_100119954 | 224 |
| 477 | 3300025908 | Ga0207643_10047006 | Ga0207643_100470062 | 224 |
| 478 | 3300025910 | Ga0207684_10164619 | Ga0207684_101646192 | 224 |
| 479 | 3300025917 | Ga0207660_10583351 | Ga0207660_105833511 | 224 |
| 480 | 3300025918 | Ga0207662_10053313 | Ga0207662_100533133 | 224 |
| 481 | 3300025918 | Ga0207662_10282929 | Ga0207662_102829292 | 224 |
| 482 | 3300025920 | Ga0207649_10096597 | Ga0207649_100965973 | 224 |
| 483 | 3300025922 | Ga0207646_10159352 | Ga0207646_101593523 | 224 |
| 484 | 3300025923 | Ga0207681_10114701 | Ga0207681_101147012 | 224 |
| 485 | 3300025926 | Ga0207659_10000602 | Ga0207659_1000060213 | 224 |
| 486 | 3300025926 | Ga0207659_10020747 | Ga0207659_100207474 | 224 |
| 487 | 3300025926 | Ga0207659_10121177 | Ga0207659_101211772 | 224 |
| 488 | 3300025926 | Ga0207659_10222309 | Ga0207659_102223092 | 224 |
| 489 | 3300025931 | Ga0207644_10031630 | Ga0207644_100316304 | 224 |
| 490 | 3300025933 | Ga0207706_10174393 | Ga0207706_101743933 | 224 |
| 491 | 3300025935 | Ga0207709_10016003 | Ga0207709_100160033 | 224 |
| 492 | 3300025936 | Ga0207670_10006747 | Ga0207670_100067475 | 224 |
| 493 | 3300025936 | Ga0207670_10039776 | Ga0207670_100397764 | 224 |
| 494 | 3300025940 | Ga0207691_10042381 | Ga0207691_100423814 | 224 |
| 495 | 3300025960 | Ga0207651_10138287 | Ga0207651_101382873 | 224 |
| 496 | 3300025960 | Ga0207651_10203374 | Ga0207651_102033743 | 224 |
| 497 | 3300025960 | Ga0207651_10298169 | Ga0207651_102981692 | 224 |
| 498 | 3300025960 | Ga0207651_10304776 | Ga0207651_103047762 | 224 |
| 499 | 3300025961 | Ga0207712_10367480 | Ga0207712_103674802 | 224 |
| 500 | 3300026035 | Ga0207703_10338075 | Ga0207703_103380752 | 224 |
| 501 | 3300026088 | Ga0207641_10038115 | Ga0207641_100381155 | 224 |
| 502 | 3300026089 | Ga0207648_10000338 | Ga0207648_1000033825 | 224 |
| 503 | 3300026095 | Ga0207676_10047921 | Ga0207676_100479212 | 224 |
| 504 | 3300026095 | Ga0207676_11057397 | Ga0207676_110573972 | 224 |
| 505 | 3300026116 | Ga0207674_10035241 | Ga0207674_100352415 | 224 |
| 506 | 3300026116 | Ga0207674_10111526 | Ga0207674_101115262 | 224 |
| 507 | 3300026118 | Ga0207675_100007099 | Ga0207675_1000070999 | 224 |
| 508 | 3300026121 | Ga0207683_10106178 | Ga0207683_101061781 | 224 |
| 509 | 3300027907 | Ga0207428_10012432 | Ga0207428_100124324 | 224 |
| 510 | 3300028380 | Ga0268265_10003298 | Ga0268265_100032987 | 224 |
| 511 | 3300028381 | Ga0268264_10268238 | Ga0268264_102682383 | 224 |
| 512 | 3300031548 | Ga0307408_100450523 | Ga0307408_1004505231 | 224 |
| 513 | 3300031548 | Ga0307408_100878977 | Ga0307408_1008789771 | 224 |
| 514 | 3300031731 | Ga0307405_10000896 | Ga0307405_100008962 | 224 |
| 515 | 3300031824 | Ga0307413_10174498 | Ga0307413_101744982 | 224 |
| 516 | 3300031852 | Ga0307410_10008739 | Ga0307410_100087392 | 224 |
| 517 | 3300031901 | Ga0307406_10044831 | Ga0307406_100448313 | 224 |
| 518 | 3300031903 | Ga0307407_10026962 | Ga0307407_100269621 | 224 |
| 519 | 3300031911 | Ga0307412_10016850 | Ga0307412_100168503 | 224 |
| 520 | 3300031995 | Ga0307409_100025219 | Ga0307409_1000252194 | 224 |
| 521 | 3300031995 | Ga0307409_100159458 | Ga0307409_1001594583 | 224 |
| 522 | 3300032002 | Ga0307416_100045322 | Ga0307416_1000453224 | 224 |
| 523 | 3300032004 | Ga0307414_10208604 | Ga0307414_102086042 | 224 |
| 524 | 3300032126 | Ga0307415_100278341 | Ga0307415_1002783412 | 224 |
| 525 | 3300039062 | Ga0400483_020887 | Ga0400483_020887_2218_2892 | 224 |
| 526 | 3300039062 | Ga0400483_163516 | Ga0400483_163516_1292_1966 | 224 |
| 527 | 3300041512 | Ga0451853_2622050 | Ga0451853_2622050_493_1167 | 224 |
| 528 | 3300042876 | Ga0451577_0794019 | Ga0451577_0794019_28_729 | 224 |
| 529 | 3300045051 | Ga0451576_0051942 | Ga0451576_0051942_1065_1766 | 224 |
| 530 | 3300045051 | Ga0451576_0513240 | Ga0451576_0513240_312_998 | 224 |
| 531 | 3300046664 | Ga0495659_0001941 | Ga0495659_0001941_4132_4818 | 224 |
| 532 | 3300046664 | Ga0495659_0087353 | Ga0495659_0087353_468_1154 | 224 |
| 533 | 3300047318 | Ga0495636_0059286 | Ga0495636_0059286_255_941 | 224 |
| 534 | 3300049572 | Ga0501036_0018336 | Ga0501036_0018336_3719_4399 | 224 |
| 535 | 3300049590 | Ga0501074_0284580 | Ga0501074_0284580_77_757 | 224 |
| 536 | 3300049591 | Ga0501075_0036917 | Ga0501075_0036917_1960_2640 | 224 |
| 537 | 3300049592 | Ga0501076_0224136 | Ga0501076_0224136_775_1455 | 224 |
| 538 | 3300049741 | Ga0501079_0371620 | Ga0501079_0371620_131_811 | 224 |
| 539 | 3300049824 | Ga0501045_0194144 | Ga0501045_0194144_529_1209 | 224 |
| 540 | 3300050510 | nmdc:mga06r32_627354_c1 | nmdc:mga06r32_627354_c1_37_726 | 224 |
| 541 | 3300050511 | nmdc:mga08y16_419863_c1 | nmdc:mga08y16_419863_c1_190_876 | 224 |
| 542 | 3300050512 | nmdc:mga0n895_292324_c1 | nmdc:mga0n895_292324_c1_339_1025 | 224 |
| 543 | 3300050512 | nmdc:mga0n895_66262_c1 | nmdc:mga0n895_66262_c1_685_1386 | 224 |
| 544 | 3300050513 | nmdc:mga0rr50_132430_c1 | nmdc:mga0rr50_132430_c1_1192_1893 | 224 |
| 545 | 3300050513 | nmdc:mga0rr50_236124_c1 | nmdc:mga0rr50_236124_c1_731_1417 | 224 |
| 546 | 3300050513 | nmdc:mga0rr50_89109_c1 | nmdc:mga0rr50_89109_c1_982_1668 | 224 |
| 547 | 3300005353 | Ga0070669_100292179 | Ga0070669_1002921792 | 225 |
| 548 | 3300005355 | Ga0070671_100007203 | Ga0070671_10000720312 | 225 |
| 549 | 3300005364 | Ga0070673_100017570 | Ga0070673_1000175703 | 225 |
| 550 | 3300005543 | Ga0070672_100011132 | Ga0070672_1000111323 | 225 |
| 551 | 3300006844 | Ga0075428_100005224 | Ga0075428_1000052245 | 225 |
| 552 | 3300009094 | Ga0111539_10605960 | Ga0111539_106059602 | 225 |
| 553 | 3300009098 | Ga0105245_10457447 | Ga0105245_104574472 | 225 |
| 554 | 3300009551 | Ga0105238_10013846 | Ga0105238_100138465 | 225 |
| 555 | 3300025321 | Ga0207656_10010706 | Ga0207656_100107063 | 225 |
| 556 | 3300025923 | Ga0207681_10134573 | Ga0207681_101345731 | 225 |
| 557 | 3300025924 | Ga0207694_10008144 | Ga0207694_100081445 | 225 |
| 558 | 3300025927 | Ga0207687_10158580 | Ga0207687_101585803 | 225 |
| 559 | 3300025928 | Ga0207700_10093560 | Ga0207700_100935602 | 225 |
| 560 | 3300025931 | Ga0207644_10004034 | Ga0207644_100040342 | 225 |
| 561 | 3300025933 | Ga0207706_10219010 | Ga0207706_102190102 | 225 |
| 562 | 3300025940 | Ga0207691_10010354 | Ga0207691_100103548 | 225 |
| 563 | 3300025942 | Ga0207689_10240715 | Ga0207689_102407152 | 225 |
| 564 | 3300025960 | Ga0207651_10030995 | Ga0207651_100309953 | 225 |
| 565 | 3300025986 | Ga0207658_10576577 | Ga0207658_105765771 | 225 |
| 566 | 3300026088 | Ga0207641_10024334 | Ga0207641_100243346 | 225 |
| 567 | 3300028380 | Ga0268265_10192217 | Ga0268265_101922171 | 225 |
| 568 | 3300035410 | Ga0373924_0120057 | Ga0373924_0120057_339_1028 | 225 |
| 569 | 3300035692 | Ga0373935_0335291 | Ga0373935_0335291_104_793 | 225 |
| 570 | 3300036401 | Ga0373937_0048996 | Ga0373937_0048996_2423_3112 | 225 |
| 571 | 3300046459 | Ga0495629_0139680 | Ga0495629_0139680_74_763 | 225 |
| 572 | 3300046539 | Ga0495621_0000068 | Ga0495621_0000068_14488_15195 | 225 |
| 573 | 3300049578 | Ga0501042_0282449 | Ga0501042_0282449_204_884 | 225 |
| 574 | 3300049587 | Ga0501071_0350696 | Ga0501071_0350696_351_1031 | 225 |
| 575 | 3300050511 | nmdc:mga08y16_403685_c1 | nmdc:mga08y16_403685_c1_410_1090 | 225 |
| 576 | 3300005293 | Ga0065715_10123633 | Ga0065715_101236333 | 226 |
| 577 | 3300005293 | Ga0065715_10125501 | Ga0065715_101255012 | 226 |
| 578 | 3300005328 | Ga0070676_10027050 | Ga0070676_100270502 | 226 |
| 579 | 3300005328 | Ga0070676_10080427 | Ga0070676_100804272 | 226 |
| 580 | 3300005330 | Ga0070690_100016164 | Ga0070690_1000161645 | 226 |
| 581 | 3300005333 | Ga0070677_10273705 | Ga0070677_102737051 | 226 |
| 582 | 3300005334 | Ga0068869_100037657 | Ga0068869_1000376572 | 226 |
| 583 | 3300005340 | Ga0070689_100195013 | Ga0070689_1001950133 | 226 |
| 584 | 3300005353 | Ga0070669_100048750 | Ga0070669_1000487503 | 226 |
| 585 | 3300005353 | Ga0070669_100155340 | Ga0070669_1001553402 | 226 |
| 586 | 3300005354 | Ga0070675_100018512 | Ga0070675_1000185123 | 226 |
| 587 | 3300005354 | Ga0070675_100278005 | Ga0070675_1002780053 | 226 |
| 588 | 3300005356 | Ga0070674_100064208 | Ga0070674_1000642083 | 226 |
| 589 | 3300005356 | Ga0070674_100165627 | Ga0070674_1001656273 | 226 |
| 590 | 3300005364 | Ga0070673_100005587 | Ga0070673_1000055877 | 226 |
| 591 | 3300005364 | Ga0070673_100150870 | Ga0070673_1001508701 | 226 |
| 592 | 3300005365 | Ga0070688_100024728 | Ga0070688_1000247284 | 226 |
| 593 | 3300005366 | Ga0070659_100113055 | Ga0070659_1001130553 | 226 |
| 594 | 3300005366 | Ga0070659_100351219 | Ga0070659_1003512192 | 226 |
| 595 | 3300005367 | Ga0070667_100055899 | Ga0070667_1000558994 | 226 |
| 596 | 3300005441 | Ga0070700_100083824 | Ga0070700_1000838242 | 226 |
| 597 | 3300005441 | Ga0070700_100245413 | Ga0070700_1002454131 | 226 |
| 598 | 3300005456 | Ga0070678_100761011 | Ga0070678_1007610111 | 226 |
| 599 | 3300005459 | Ga0068867_100000734 | Ga0068867_10000073418 | 226 |
| 600 | 3300005459 | Ga0068867_100135236 | Ga0068867_1001352362 | 226 |
| 601 | 3300005543 | Ga0070672_100001095 | Ga0070672_10000109516 | 226 |
| 602 | 3300005544 | Ga0070686_100112701 | Ga0070686_1001127012 | 226 |
| 603 | 3300005545 | Ga0070695_100063380 | Ga0070695_1000633803 | 226 |
| 604 | 3300005545 | Ga0070695_100540290 | Ga0070695_1005402901 | 226 |
| 605 | 3300005546 | Ga0070696_100429362 | Ga0070696_1004293622 | 226 |
| 606 | 3300005549 | Ga0070704_100772804 | Ga0070704_1007728041 | 226 |
| 607 | 3300005563 | Ga0068855_100121796 | Ga0068855_1001217964 | 226 |
| 608 | 3300005564 | Ga0070664_100042543 | Ga0070664_1000425433 | 226 |
| 609 | 3300005564 | Ga0070664_100519406 | Ga0070664_1005194062 | 226 |
| 610 | 3300005615 | Ga0070702_100018918 | Ga0070702_1000189183 | 226 |
| 611 | 3300005616 | Ga0068852_100116359 | Ga0068852_1001163593 | 226 |
| 612 | 3300005617 | Ga0068859_100240472 | Ga0068859_1002404722 | 226 |
| 613 | 3300005618 | Ga0068864_100296120 | Ga0068864_1002961202 | 226 |
| 614 | 3300005718 | Ga0068866_10003129 | Ga0068866_100031299 | 226 |
| 615 | 3300005840 | Ga0068870_10145269 | Ga0068870_101452692 | 226 |
| 616 | 3300005842 | Ga0068858_100180871 | Ga0068858_1001808713 | 226 |
| 617 | 3300005843 | Ga0068860_100039025 | Ga0068860_1000390254 | 226 |
| 618 | 3300005843 | Ga0068860_100082549 | Ga0068860_1000825494 | 226 |
| 619 | 3300005843 | Ga0068860_100507041 | Ga0068860_1005070412 | 226 |
| 620 | 3300005843 | Ga0068860_101206537 | Ga0068860_1012065371 | 226 |
| 621 | 3300005844 | Ga0068862_100428638 | Ga0068862_1004286383 | 226 |
| 622 | 3300005844 | Ga0068862_100566224 | Ga0068862_1005662242 | 226 |
| 623 | 3300006881 | Ga0068865_100002495 | Ga0068865_10000249510 | 226 |
| 624 | 3300006931 | Ga0097620_100240472 | Ga0097620_1002404722 | 226 |
| 625 | 3300007076 | Ga0075435_100105118 | Ga0075435_1001051182 | 226 |
| 626 | 3300009148 | Ga0105243_10009061 | Ga0105243_100090615 | 226 |
| 627 | 3300009148 | Ga0105243_10533607 | Ga0105243_105336072 | 226 |
| 628 | 3300009174 | Ga0105241_10103959 | Ga0105241_101039592 | 226 |
| 629 | 3300009176 | Ga0105242_10008954 | Ga0105242_100089544 | 226 |
| 630 | 3300009176 | Ga0105242_10018069 | Ga0105242_100180695 | 226 |
| 631 | 3300009177 | Ga0105248_10267442 | Ga0105248_102674423 | 226 |
| 632 | 3300013297 | Ga0157378_10283585 | Ga0157378_102835853 | 226 |
| 633 | 3300013307 | Ga0157372_10337530 | Ga0157372_103375302 | 226 |
| 634 | 3300013307 | Ga0157372_10624495 | Ga0157372_106244952 | 226 |
| 635 | 3300014325 | Ga0163163_10012635 | Ga0163163_100126358 | 226 |
| 636 | 3300014325 | Ga0163163_10019152 | Ga0163163_100191523 | 226 |
| 637 | 3300014326 | Ga0157380_10006040 | Ga0157380_100060402 | 226 |
| 638 | 3300014326 | Ga0157380_10397595 | Ga0157380_103975952 | 226 |
| 639 | 3300014745 | Ga0157377_10302101 | Ga0157377_103021012 | 226 |
| 640 | 3300025893 | Ga0207682_10006289 | Ga0207682_100062897 | 226 |
| 641 | 3300025901 | Ga0207688_10051590 | Ga0207688_100515902 | 226 |
| 642 | 3300025903 | Ga0207680_10035135 | Ga0207680_100351354 | 226 |
| 643 | 3300025903 | Ga0207680_10122446 | Ga0207680_101224462 | 226 |
| 644 | 3300025903 | Ga0207680_10138028 | Ga0207680_101380282 | 226 |
| 645 | 3300025907 | Ga0207645_10004890 | Ga0207645_100048908 | 226 |
| 646 | 3300025908 | Ga0207643_10118575 | Ga0207643_101185752 | 226 |
| 647 | 3300025918 | Ga0207662_10023741 | Ga0207662_100237412 | 226 |
| 648 | 3300025923 | Ga0207681_10007908 | Ga0207681_100079086 | 226 |
| 649 | 3300025923 | Ga0207681_10028939 | Ga0207681_100289392 | 226 |
| 650 | 3300025923 | Ga0207681_10199030 | Ga0207681_101990303 | 226 |
| 651 | 3300025926 | Ga0207659_10002907 | Ga0207659_100029076 | 226 |
| 652 | 3300025932 | Ga0207690_10219283 | Ga0207690_102192832 | 226 |
| 653 | 3300025934 | Ga0207686_10013872 | Ga0207686_100138723 | 226 |
| 654 | 3300025935 | Ga0207709_10008072 | Ga0207709_100080724 | 226 |
| 655 | 3300025936 | Ga0207670_10086293 | Ga0207670_100862933 | 226 |
| 656 | 3300025937 | Ga0207669_10012323 | Ga0207669_100123233 | 226 |
| 657 | 3300025938 | Ga0207704_10000998 | Ga0207704_1000099810 | 226 |
| 658 | 3300025940 | Ga0207691_10244682 | Ga0207691_102446822 | 226 |
| 659 | 3300025942 | Ga0207689_10080261 | Ga0207689_100802613 | 226 |
| 660 | 3300025942 | Ga0207689_10091465 | Ga0207689_100914653 | 226 |
| 661 | 3300025942 | Ga0207689_10116339 | Ga0207689_101163393 | 226 |
| 662 | 3300025960 | Ga0207651_10002624 | Ga0207651_100026244 | 226 |
| 663 | 3300025960 | Ga0207651_10009236 | Ga0207651_100092363 | 226 |
| 664 | 3300025961 | Ga0207712_10442019 | Ga0207712_104420192 | 226 |
| 665 | 3300025981 | Ga0207640_10352963 | Ga0207640_103529632 | 226 |
| 666 | 3300025986 | Ga0207658_10138198 | Ga0207658_101381983 | 226 |
| 667 | 3300026035 | Ga0207703_10433688 | Ga0207703_104336882 | 226 |
| 668 | 3300026075 | Ga0207708_10003387 | Ga0207708_100033871 | 226 |
| 669 | 3300026075 | Ga0207708_10012327 | Ga0207708_100123277 | 226 |
| 670 | 3300026075 | Ga0207708_10089523 | Ga0207708_100895233 | 226 |
| 671 | 3300026089 | Ga0207648_10001667 | Ga0207648_100016678 | 226 |
| 672 | 3300026089 | Ga0207648_10033564 | Ga0207648_100335644 | 226 |
| 673 | 3300026089 | Ga0207648_10590475 | Ga0207648_105904752 | 226 |
| 674 | 3300026118 | Ga0207675_100024774 | Ga0207675_1000247745 | 226 |
| 675 | 3300026121 | Ga0207683_10062518 | Ga0207683_100625183 | 226 |
| 676 | 3300026121 | Ga0207683_10419098 | Ga0207683_104190982 | 226 |
| 677 | 3300026121 | Ga0207683_10666624 | Ga0207683_106666242 | 226 |
| 678 | 3300026142 | Ga0207698_10069888 | Ga0207698_100698883 | 226 |
| 679 | 3300028380 | Ga0268265_10547105 | Ga0268265_105471052 | 226 |
| 680 | 3300028380 | Ga0268265_10558633 | Ga0268265_105586331 | 226 |
| 681 | 3300028381 | Ga0268264_10039264 | Ga0268264_100392644 | 226 |
| 682 | 3300028381 | Ga0268264_10476004 | Ga0268264_104760041 | 226 |
| 683 | 3300028381 | Ga0268264_10814085 | Ga0268264_108140851 | 226 |
| 684 | 3300035114 | Ga0373939_0030310 | Ga0373939_0030310_676_1356 | 226 |
| 685 | 3300035121 | Ga0373960_0021398 | Ga0373960_0021398_616_1296 | 226 |
| 686 | 3300045976 | Ga0466967_0495476 | Ga0466967_0495476_389_1069 | 226 |
| 687 | 3300046455 | Ga0495603_0094283 | Ga0495603_0094283_249_986 | 226 |
| 688 | 3300048905 | Ga0496102_0232266 | Ga0496102_0232266_1043_1723 | 226 |
| 689 | 3300049581 | Ga0501047_0105108 | Ga0501047_0105108_696_1376 | 226 |
| 690 | 3300049585 | Ga0501069_0244555 | Ga0501069_0244555_339_1019 | 226 |
| 691 | 3300002459 | JGI24751J29686_10018453 | JGI24751J29686_100184532 | 227 |
| 692 | 3300005290 | Ga0065712_10119184 | Ga0065712_101191842 | 227 |
| 693 | 3300005329 | Ga0070683_100041342 | Ga0070683_1000413424 | 227 |
| 694 | 3300005331 | Ga0070670_100010775 | Ga0070670_1000107754 | 227 |
| 695 | 3300005458 | Ga0070681_10512166 | Ga0070681_105121661 | 227 |
| 696 | 3300006028 | Ga0070717_10067480 | Ga0070717_100674803 | 227 |
| 697 | 3300006038 | Ga0075365_10001998 | Ga0075365_100019989 | 227 |
| 698 | 3300025925 | Ga0207650_10110686 | Ga0207650_101106863 | 227 |
| 699 | 3300025928 | Ga0207700_10649447 | Ga0207700_106494471 | 227 |
| 700 | 3300025944 | Ga0207661_10005260 | Ga0207661_100052607 | 227 |
| 701 | 3300035083 | Ga0373926_0106346 | Ga0373926_0106346_233_916 | 227 |
| 702 | 3300035111 | Ga0373923_0059154 | Ga0373923_0059154_868_1566 | 227 |
| 703 | 3300035724 | Ga0373933_0333976 | Ga0373933_0333976_38_736 | 227 |
| 704 | 3300036401 | Ga0373937_0013013 | Ga0373937_0013013_2628_3326 | 227 |
| 705 | 3300037068 | Ga0373925_0012431 | Ga0373925_0012431_3353_4036 | 227 |
| 706 | 3300044712 | Ga0453684_0026141 | Ga0453684_0026141_5994_6728 | 227 |
| 707 | 3300049571 | Ga0501034_0030152 | Ga0501034_0030152_4665_5348 | 227 |
| 708 | 3300049590 | Ga0501074_0335896 | Ga0501074_0335896_202_885 | 227 |
| 709 | 3300053129 | Ga0500628_021855 | Ga0500628_021855_103_786 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9702 | 6 | 217 |
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9679 | 6 | 221 |
| 7b1w-assembly2.cif.gz_K-3 | crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii | 0.9643 | 5 | 214 |
| 1rpx-assembly1.cif.gz_A | d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts | 0.9609 | 5 | 217 |
| 7sbj-assembly1.cif.gz_C | crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a | 0.9582 | 8 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9713 | 5 | 217 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9649 | 6 | 220 | 3.20.20.70 |
| af_A0A1D6PJ99_41_293_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9584 | 5 | 211 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9518 | 6 | 220 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9504 | 1 | 219 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7NBK9-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9855 | 6 | 221 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A3B9SKL1-F1-model_v4 | Ribulose-phosphate 3-epimerase | 0.9849 | 51 | 216 |
GO:0005975
GO:0016857 |
| AF-A0A7Y4UCZ2-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9848 | 6 | 191 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-G2LHA7-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9838 | 6 | 220 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A6C1QHI8-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9832 | 6 | 216 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar