F476706

General Info

Members Datasets Scaffolds Average Seq Length
710 213 710 194

Family's Representative Sequence

Representative Sequence 3300025899|Ga0207642_10151537|Ga0207642_101515372
Length 230
Sequence VKGVFSPVNSNLPFTAGLTRRARLRCSATNTDFVGTRVRNFTNWTGAGLAAVMLAGCQTIPAQKVAQTRPAAPLSNEVPYHWTLGNAPQAHKDMVAEFGKLGLKPGEYVWAAKVPAEGEPRVVVDLLTQMTYVYRGDRLLGAASMSSAKTGHITPYGNWTILEKRPFYRSKKYDNAPMPFMQRIDDYGIAFHGGMNPGYPASHGCMRLPMKFAEKLYGVTRLGTKVVIEG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
198 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
205 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
206 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
209 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
210 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 6.06
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006104 3300001915 Bacteria 2453
2 JGI24746J21847_1003575 3300001977 Bacteria 2448
3 JGI24740J21852_10023685 3300001979 Bacteria 2093
4 JGI24740J21852_10036897 3300001979 Unclassified 1513
5 JGI24739J22299_10001582 3300001989 Bacteria 8610
6 JGI24739J22299_10002879 3300001989 Bacteria 6605
7 JGI24739J22299_10008823 3300001989 Bacteria 3758
8 JGI24739J22299_10066189 3300001989 Bacteria 1132
9 JGI24737J22298_10000474 3300001990 Bacteria 13877
10 JGI24737J22298_10032747 3300001990 Bacteria 1617
11 JGI24737J22298_10037657 3300001990 Bacteria 1490
12 JGI24737J22298_10083216 3300001990 Bacteria 951
13 JGI24735J21928_10001422 3300002067 Bacteria 8459
14 JGI24735J21928_10004652 3300002067 Bacteria 4592
15 JGI24735J21928_10034714 3300002067 Bacteria 1486
16 JGI24745J21846_1002550 3300002073 Bacteria 1866
17 JGI24738J21930_10000247 3300002075 Bacteria 14743
18 JGI24738J21930_10015941 3300002075 Bacteria 1593
19 JGI24744J21845_10001657 3300002077 Bacteria 4455
20 Ga0065715_10136426 3300005293 Bacteria 1922
21 Ga0070658_10000117 3300005327 Bacteria 71263
22 Ga0070658_10014724 3300005327 Bacteria 6272
23 Ga0070658_10082660 3300005327 Bacteria 2639
24 Ga0070658_10156326 3300005327 Bacteria 1912
25 Ga0070658_10272935 3300005327 Bacteria 1438
26 Ga0070658_10332959 3300005327 Bacteria 1298
27 Ga0070658_10763191 3300005327 Unclassified 840
28 Ga0070676_10099935 3300005328 Bacteria 1790
29 Ga0070683_100001025 3300005329 Bacteria 20971
30 Ga0070683_100006463 3300005329 Bacteria 9837
31 Ga0070683_100133412 3300005329 Bacteria 2350
32 Ga0070690_100004862 3300005330 Bacteria 7506
33 Ga0070670_100014077 3300005331 Bacteria 6863
34 Ga0070670_100118480 3300005331 Bacteria 2283
35 Ga0070670_100130081 3300005331 Bacteria 2174
36 Ga0070670_100140512 3300005331 Bacteria 2088
37 Ga0070670_100209120 3300005331 Bacteria 1696
38 Ga0070670_100952070 3300005331 Bacteria 780
39 Ga0070677_10169602 3300005333 Bacteria 1030
40 Ga0068869_100134367 3300005334 Bacteria 1904
41 Ga0070666_10000534 3300005335 Bacteria 22975
42 Ga0070666_10001262 3300005335 Bacteria 15296
43 Ga0070666_10019990 3300005335 Bacteria 4327
44 Ga0070666_10054857 3300005335 Bacteria 2689
45 Ga0070666_10064087 3300005335 Bacteria 2492
46 Ga0070680_100189766 3300005336 Bacteria 1731
47 Ga0070682_100017730 3300005337 Bacteria 4153
48 Ga0068868_100000536 3300005338 Bacteria 25436
49 Ga0068868_100060515 3300005338 Bacteria 2999
50 Ga0068868_100166560 3300005338 Bacteria 1823
51 Ga0068868_101098053 3300005338 Bacteria 732
52 Ga0070660_100000142 3300005339 Bacteria 46063
53 Ga0070660_100005504 3300005339 Bacteria 8772
54 Ga0070660_100017020 3300005339 Bacteria 5292
55 Ga0070660_100027577 3300005339 Bacteria 4240
56 Ga0070660_100042850 3300005339 Bacteria 3456
57 Ga0070660_100085374 3300005339 Bacteria 2482
58 Ga0070660_100113894 3300005339 Bacteria 2154
59 Ga0070660_100140126 3300005339 Bacteria 1940
60 Ga0070660_100826879 3300005339 Bacteria 779
61 Ga0070660_100829158 3300005339 Unclassified 778
62 Ga0070687_100022401 3300005343 Bacteria 2986
63 Ga0070687_100470246 3300005343 Bacteria 840
64 Ga0070661_100000079 3300005344 Bacteria 77180
65 Ga0070661_100024161 3300005344 Bacteria 4359
66 Ga0070661_100069643 3300005344 Bacteria 2586
67 Ga0070661_100072851 3300005344 Bacteria 2528
68 Ga0070661_100082455 3300005344 Bacteria 2375
69 Ga0070661_100115486 3300005344 Bacteria 2007
70 Ga0070661_100315059 3300005344 Bacteria 1221
71 Ga0070661_100457020 3300005344 Bacteria 1017
72 Ga0070661_100649028 3300005344 Bacteria 857
73 Ga0070661_100867100 3300005344 Bacteria 744
74 Ga0070692_10028984 3300005345 Bacteria 2757
75 Ga0070668_100041353 3300005347 Bacteria 3531
76 Ga0070669_100070880 3300005353 Bacteria 2577
77 Ga0070675_100054103 3300005354 Bacteria 3302
78 Ga0070675_100095796 3300005354 Bacteria 2492
79 Ga0070675_100141908 3300005354 Bacteria 2054
80 Ga0070671_100001217 3300005355 Bacteria 19279
81 Ga0070671_100002941 3300005355 Bacteria 13239
82 Ga0070671_100007273 3300005355 Bacteria 8848
83 Ga0070671_100038008 3300005355 Bacteria 3995
84 Ga0070671_100043709 3300005355 Bacteria 3723
85 Ga0070671_100068784 3300005355 Bacteria 2953
86 Ga0070671_100089243 3300005355 Bacteria 2581
87 Ga0070671_100144036 3300005355 Bacteria 2011
88 Ga0070671_100310364 3300005355 Bacteria 1343
89 Ga0070674_100002604 3300005356 Bacteria 9979
90 Ga0070674_100033583 3300005356 Plasmid 3417
91 Ga0070674_100049915 3300005356 Bacteria 2879
92 Ga0070674_100075206 3300005356 Bacteria 2398
93 Ga0070674_100133053 3300005356 Bacteria 1857
94 Ga0070673_100001439 3300005364 Bacteria 13923
95 Ga0070673_100008413 3300005364 Bacteria 6860
96 Ga0070673_100008885 3300005364 Bacteria 6713
97 Ga0070673_100047406 3300005364 Bacteria 3344
98 Ga0070673_100083750 3300005364 Bacteria 2592
99 Ga0070659_100000125 3300005366 Bacteria 57976
100 Ga0070659_100005619 3300005366 Bacteria 9015
101 Ga0070659_100010129 3300005366 Bacteria 6939
102 Ga0070659_100027475 3300005366 Bacteria 4385
103 Ga0070659_100028112 3300005366 Bacteria 4339
104 Ga0070659_100118961 3300005366 Bacteria 2138
105 Ga0070659_100162474 3300005366 Bacteria 1827
106 Ga0070659_100317975 3300005366 Bacteria 1301
107 Ga0070659_100487180 3300005366 Bacteria 1050
108 Ga0070667_100003322 3300005367 Bacteria 13746
109 Ga0070667_100005526 3300005367 Bacteria 10554
110 Ga0070667_100008368 3300005367 Bacteria 8578
111 Ga0070667_100082485 3300005367 Bacteria 2753
112 Ga0070667_100154722 3300005367 Bacteria 2016
113 Ga0070667_100713032 3300005367 Bacteria 929
114 Ga0070663_100000725 3300005455 Bacteria 17792
115 Ga0070663_100009729 3300005455 Bacteria 5968
116 Ga0070663_100013983 3300005455 Bacteria 5139
117 Ga0070663_100083356 3300005455 Bacteria 2354
118 Ga0070663_100190813 3300005455 Bacteria 1594
119 Ga0070663_100247068 3300005455 Bacteria 1411
120 Ga0070663_100506338 3300005455 Bacteria 1003
121 Ga0070678_100018418 3300005456 Bacteria 4524
122 Ga0070678_100024099 3300005456 Bacteria 4067
123 Ga0070678_100337205 3300005456 Bacteria 1292
124 Ga0070678_100539368 3300005456 Bacteria 1034
125 Ga0070662_100000066 3300005457 Bacteria 57014
126 Ga0070662_100000664 3300005457 Bacteria 20906
127 Ga0070662_100037193 3300005457 Bacteria 3450
128 Ga0070662_100052776 3300005457 Bacteria 2941
129 Ga0070662_100085293 3300005457 Bacteria 2360
130 Ga0070662_100105033 3300005457 Bacteria 2144
131 Ga0070662_100167625 3300005457 Bacteria 1722
132 Ga0070662_100172680 3300005457 Bacteria 1699
133 Ga0070662_100215818 3300005457 Bacteria 1528
134 Ga0070662_100305321 3300005457 Bacteria 1294
135 Ga0070681_10193235 3300005458 Bacteria 1955
136 Ga0070681_10359665 3300005458 Bacteria 1366
137 Ga0070681_10827604 3300005458 Unclassified 843
138 Ga0068867_100043296 3300005459 Bacteria 3296
139 Ga0068867_100199745 3300005459 Bacteria 1600
140 Ga0068867_100368911 3300005459 Bacteria 1203
141 Ga0070679_100086693 3300005530 Bacteria 3117
142 Ga0070679_100089596 3300005530 Bacteria 3063
143 Ga0070679_100760642 3300005530 Unclassified 912
144 Ga0070684_100004262 3300005535 Bacteria 10842
145 Ga0070684_100008097 3300005535 Bacteria 8206
146 Ga0068853_100000182 3300005539 Bacteria 44164
147 Ga0068853_100030645 3300005539 Bacteria 4545
148 Ga0068853_100055536 3300005539 Bacteria 3414
149 Ga0068853_100088305 3300005539 Bacteria 2722
150 Ga0068853_100162125 3300005539 Bacteria 2019
151 Ga0068853_100174676 3300005539 Unclassified 1945
152 Ga0068853_100461264 3300005539 Bacteria 1196
153 Ga0068853_100508613 3300005539 Bacteria 1138
154 Ga0070672_100009243 3300005543 Bacteria 6786
155 Ga0070672_100040725 3300005543 Bacteria 3567
156 Ga0070672_100060468 3300005543 Bacteria 2983
157 Ga0070672_100077159 3300005543 Bacteria 2663
158 Ga0070672_100089029 3300005543 Bacteria 2486
159 Ga0070672_100183114 3300005543 Bacteria 1746
160 Ga0070672_100247192 3300005543 Bacteria 1502
161 Ga0070686_100212534 3300005544 Bacteria 1393
162 Ga0070693_100000475 3300005547 Bacteria 17969
163 Ga0070665_100009601 3300005548 Bacteria 9788
164 Ga0070665_100013620 3300005548 Bacteria 8179
165 Ga0070665_100027660 3300005548 Bacteria 5711
166 Ga0070665_100370389 3300005548 Bacteria 1439
167 Ga0068855_100000886 3300005563 Bacteria 37122
168 Ga0068855_100509775 3300005563 Bacteria 1306
169 Ga0068855_100528752 3300005563 Bacteria 1279
170 Ga0070664_100000195 3300005564 Bacteria 42982
171 Ga0070664_100001042 3300005564 Bacteria 21764
172 Ga0070664_100006873 3300005564 Bacteria 9175
173 Ga0070664_100008847 3300005564 Bacteria 8159
174 Ga0070664_100009187 3300005564 Bacteria 8026
175 Ga0070664_100021933 3300005564 Bacteria 5265
176 Ga0070664_100025221 3300005564 Bacteria 4925
177 Ga0070664_100030886 3300005564 Bacteria 4472
178 Ga0070664_100085122 3300005564 Bacteria 2730
179 Ga0070664_100263743 3300005564 Bacteria 1550
180 Ga0070664_100429575 3300005564 Bacteria 1211
181 Ga0070664_100547385 3300005564 Bacteria 1070
182 Ga0068857_100005983 3300005577 Bacteria 10388
183 Ga0068857_100065719 3300005577 Bacteria 3226
184 Ga0068857_100072935 3300005577 Bacteria 3058
185 Ga0068854_100021662 3300005578 Bacteria 4364
186 Ga0068854_100038716 3300005578 Bacteria 3354
187 Ga0068854_100041453 3300005578 Bacteria 3253
188 Ga0068856_100000235 3300005614 Bacteria 60202
189 Ga0068856_100072721 3300005614 Bacteria 3404
190 Ga0068856_100089989 3300005614 Bacteria 3052
191 Ga0068856_100351528 3300005614 Bacteria 1492
192 Ga0068852_100000152 3300005616 Bacteria 46381
193 Ga0068852_100001903 3300005616 Bacteria 14203
194 Ga0068852_100005136 3300005616 Bacteria 9328
195 Ga0068852_100043125 3300005616 Bacteria 3825
196 Ga0068852_100083097 3300005616 Bacteria 2847
197 Ga0068852_100083325 3300005616 Bacteria 2843
198 Ga0068852_100831250 3300005616 Bacteria 939
199 Ga0068859_100113662 3300005617 Bacteria 2771
200 Ga0068859_100271799 3300005617 Bacteria 1787
201 Ga0068859_101213005 3300005617 Bacteria 831
202 Ga0068864_100002113 3300005618 Bacteria 16423
203 Ga0068864_100013216 3300005618 Bacteria 6837
204 Ga0068864_100056664 3300005618 Bacteria 3386
205 Ga0068864_100127339 3300005618 Bacteria 2283
206 Ga0068864_100144991 3300005618 Bacteria 2145
207 Ga0068864_100190200 3300005618 Bacteria 1881
208 Ga0068864_100521914 3300005618 Bacteria 1145
209 Ga0068866_10066224 3300005718 Bacteria 1892
210 Ga0068866_10186864 3300005718 Bacteria 1228
211 Ga0068861_100404818 3300005719 Bacteria 1212
212 Ga0068851_10026429 3300005834 Bacteria 2852
213 Ga0068870_10173993 3300005840 Bacteria 1287
214 Ga0068863_100003382 3300005841 Bacteria 15747
215 Ga0068863_100004220 3300005841 Bacteria 14191
216 Ga0068863_100157856 3300005841 Bacteria 2172
217 Ga0068863_100195156 3300005841 Bacteria 1946
218 Ga0068858_100005916 3300005842 Bacteria 11938
219 Ga0068858_100008456 3300005842 Bacteria 9895
220 Ga0068858_100010203 3300005842 Bacteria 8914
221 Ga0068858_100175656 3300005842 Bacteria 2021
222 Ga0068860_100104293 3300005843 Bacteria 2707
223 Ga0081539_10089811 3300005985 Bacteria 1590
224 Ga0075366_10103876 3300006195 Bacteria 1707
225 Ga0097621_100007831 3300006237 Bacteria 7661
226 Ga0097621_100192262 3300006237 Bacteria 1768
227 Ga0068871_100003116 3300006358 Bacteria 11382
228 Ga0068871_100007473 3300006358 Bacteria 7814
229 Ga0068871_100134774 3300006358 Bacteria 2097
230 Ga0068871_100150776 3300006358 Bacteria 1983
231 Ga0068871_100200635 3300006358 Bacteria 1722
232 Ga0068865_100115613 3300006881 Bacteria 1986
233 Ga0068865_100347061 3300006881 Bacteria 1201
234 Ga0097620_100113669 3300006931 Bacteria 2771
235 Ga0097620_100271828 3300006931 Bacteria 1787
236 Ga0097620_101213045 3300006931 Bacteria 831
237 Ga0105240_10080827 3300009093 Bacteria 3996
238 Ga0105240_10379092 3300009093 Bacteria 1598
239 Ga0105245_10235370 3300009098 Bacteria 1773
240 Ga0105241_10239911 3300009174 Unclassified 1532
241 Ga0105241_10550547 3300009174 Bacteria 1036
242 Ga0105242_10432014 3300009176 Bacteria 1237
243 Ga0105242_11237200 3300009176 Bacteria 767
244 Ga0105248_10000117 3300009177 Bacteria 90169
245 Ga0105248_10000269 3300009177 Bacteria 61063
246 Ga0105248_10002506 3300009177 Bacteria 20435
247 Ga0105248_10015071 3300009177 Bacteria 8512
248 Ga0105248_10017517 3300009177 Bacteria 7899
249 Ga0105248_10017893 3300009177 Bacteria 7821
250 Ga0105248_10116435 3300009177 Bacteria 3014
251 Ga0105248_11260153 3300009177 Bacteria 836
252 Ga0105238_10008581 3300009551 Bacteria 10224
253 Ga0105238_10071536 3300009551 Bacteria 3466
254 Ga0105238_10083056 3300009551 Bacteria 3193
255 Ga0105238_10369033 3300009551 Bacteria 1425
256 Ga0105239_10659936 3300010375 Bacteria 1195
257 Ga0105246_10033208 3300011119 Bacteria 3428
258 Ga0105246_10099915 3300011119 Bacteria 2110
259 Ga0105246_10303837 3300011119 Bacteria 1289
260 Ga0157373_10071404 3300013100 Bacteria 2452
261 Ga0157373_10125330 3300013100 Unclassified 1806
262 Ga0157373_10180871 3300013100 Bacteria 1485
263 Ga0157373_10331396 3300013100 Bacteria 1084
264 Ga0157371_10003808 3300013102 Bacteria 13496
265 Ga0157371_10018979 3300013102 Bacteria 5076
266 Ga0157371_10073602 3300013102 Bacteria 2420
267 Ga0157371_10271257 3300013102 Bacteria 1224
268 Ga0157371_10398643 3300013102 Bacteria 1007
269 Ga0157370_10029403 3300013104 Bacteria 5392
270 Ga0157370_10047167 3300013104 Bacteria 4130
271 Ga0157370_10084738 3300013104 Unclassified 2978
272 Ga0157370_10660788 3300013104 Bacteria 955
273 Ga0157369_10005512 3300013105 Bacteria 14699
274 Ga0157369_10086835 3300013105 Bacteria 3341
275 Ga0157369_10808419 3300013105 Bacteria 963
276 Ga0157374_10024942 3300013296 Bacteria 5364
277 Ga0157374_10164296 3300013296 Bacteria 2163
278 Ga0157374_10656857 3300013296 Bacteria 1060
279 Ga0157378_10058893 3300013297 Bacteria 3426
280 Ga0157378_10072728 3300013297 Bacteria 3090
281 Ga0157378_10109808 3300013297 Bacteria 2527
282 Ga0157378_10321360 3300013297 Bacteria 1504
283 Ga0163162_10003750 3300013306 Bacteria 14562
284 Ga0163162_10036125 3300013306 Bacteria 4923
285 Ga0163162_10896474 3300013306 Unclassified 1000
286 Ga0157372_10008124 3300013307 Bacteria 11158
287 Ga0157372_10195812 3300013307 Bacteria 2341
288 Ga0157372_10628296 3300013307 Bacteria 1251
289 Ga0157372_10697650 3300013307 Bacteria 1181
290 Ga0157372_10699097 3300013307 Bacteria 1180
291 Ga0157372_10916479 3300013307 Bacteria 1016
292 Ga0157375_10008955 3300013308 Bacteria 8759
293 Ga0157375_10063073 3300013308 Bacteria 3685
294 Ga0157375_10148044 3300013308 Bacteria 2480
295 Ga0163163_10000357 3300014325 Bacteria 43921
296 Ga0163163_10011391 3300014325 Bacteria 8062
297 Ga0163163_10011892 3300014325 Bacteria 7916
298 Ga0157377_10020712 3300014745 Bacteria 3450
299 Ga0157379_10230868 3300014968 Bacteria 1677
300 Ga0157379_10642323 3300014968 Bacteria 993
301 Ga0157379_10728949 3300014968 Bacteria 932
302 Ga0163161_10023715 3300017792 Bacteria 4330
303 Ga0206356_10307778 3300020070 Bacteria 5135
304 Ga0206354_11272291 3300020081 Unclassified 1312
305 Ga0206353_11146179 3300020082 Unclassified 2056
306 Ga0213876_10006428 3300021384 Bacteria 6408
307 Ga0207697_10001762 3300025315 Bacteria 11625
308 Ga0207697_10015046 3300025315 Bacteria 3202
309 Ga0207656_10047191 3300025321 Bacteria 1851
310 Ga0207682_10026221 3300025893 Bacteria 2316
311 Ga0207642_10051166 3300025899 Bacteria 1868
312 Ga0207642_10124574 3300025899 Bacteria 1335
313 Ga0207642_10151537 3300025899 Bacteria 1235
314 Ga0207688_10001676 3300025901 Bacteria 11727
315 Ga0207680_10000275 3300025903 Bacteria 24704
316 Ga0207680_10001481 3300025903 Bacteria 11114
317 Ga0207680_10006516 3300025903 Bacteria 5653
318 Ga0207680_10015080 3300025903 Bacteria 4022
319 Ga0207680_10059808 3300025903 Bacteria 2316
320 Ga0207680_10213516 3300025903 Bacteria 1320
321 Ga0207647_10015029 3300025904 Bacteria 5321
322 Ga0207647_10015347 3300025904 Bacteria 5253
323 Ga0207647_10016534 3300025904 Bacteria 5032
324 Ga0207647_10020320 3300025904 Bacteria 4454
325 Ga0207647_10031001 3300025904 Bacteria 3445
326 Ga0207647_10161838 3300025904 Bacteria 1305
327 Ga0207643_10110448 3300025908 Bacteria 1620
328 Ga0207643_10173192 3300025908 Bacteria 1303
329 Ga0207705_10000245 3300025909 Bacteria 53348
330 Ga0207705_10005670 3300025909 Bacteria 9320
331 Ga0207705_10006741 3300025909 Bacteria 8486
332 Ga0207705_10020145 3300025909 Bacteria 4771
333 Ga0207705_10105252 3300025909 Bacteria 2080
334 Ga0207705_10284510 3300025909 Bacteria 1266
335 Ga0207705_10586550 3300025909 Unclassified 867
336 Ga0207705_10717315 3300025909 Bacteria 777
337 Ga0207707_10049992 3300025912 Bacteria 3643
338 Ga0207707_10147314 3300025912 Bacteria 2058
339 Ga0207707_10263545 3300025912 Bacteria 1495
340 Ga0207695_10011980 3300025913 Bacteria 10434
341 Ga0207693_10041501 3300025915 Bacteria 3622
342 Ga0207660_10016665 3300025917 Bacteria 4869
343 Ga0207660_10021190 3300025917 Bacteria 4369
344 Ga0207660_10071692 3300025917 Bacteria 2521
345 Ga0207662_10028252 3300025918 Bacteria 3241
346 Ga0207657_10000244 3300025919 Bacteria 57833
347 Ga0207657_10002075 3300025919 Bacteria 21676
348 Ga0207657_10008279 3300025919 Bacteria 10584
349 Ga0207657_10010333 3300025919 Bacteria 9318
350 Ga0207657_10015997 3300025919 Bacteria 7243
351 Ga0207657_10019100 3300025919 Bacteria 6519
352 Ga0207657_10032917 3300025919 Bacteria 4677
353 Ga0207657_10060636 3300025919 Bacteria 3246
354 Ga0207657_10095590 3300025919 Bacteria 2472
355 Ga0207657_10136194 3300025919 Bacteria 2009
356 Ga0207657_10288921 3300025919 Bacteria 1301
357 Ga0207649_10000135 3300025920 Bacteria 63197
358 Ga0207649_10032128 3300025920 Bacteria 3126
359 Ga0207649_10047962 3300025920 Bacteria 2632
360 Ga0207649_10049821 3300025920 Bacteria 2588
361 Ga0207649_10065376 3300025920 Bacteria 2302
362 Ga0207649_10090340 3300025920 Bacteria 2004
363 Ga0207649_10109148 3300025920 Bacteria 1845
364 Ga0207649_10132982 3300025920 Bacteria 1692
365 Ga0207649_10352808 3300025920 Bacteria 1089
366 Ga0207649_10390583 3300025920 Bacteria 1039
367 Ga0207652_10038946 3300025921 Bacteria 4032
368 Ga0207652_10067710 3300025921 Bacteria 3097
369 Ga0207681_10089574 3300025923 Unclassified 2194
370 Ga0207694_10032274 3300025924 Bacteria 4007
371 Ga0207694_10418088 3300025924 Bacteria 1116
372 Ga0207694_10601358 3300025924 Bacteria 925
373 Ga0207650_10055782 3300025925 Bacteria 2934
374 Ga0207650_10059441 3300025925 Bacteria 2849
375 Ga0207650_10111096 3300025925 Bacteria 2122
376 Ga0207650_10189596 3300025925 Bacteria 1642
377 Ga0207650_10294758 3300025925 Bacteria 1323
378 Ga0207650_10497812 3300025925 Bacteria 1018
379 Ga0207650_10791898 3300025925 Bacteria 803
380 Ga0207659_10017549 3300025926 Bacteria 4677
381 Ga0207659_10070889 3300025926 Bacteria 2543
382 Ga0207687_10035202 3300025927 Bacteria 3405
383 Ga0207687_10139138 3300025927 Bacteria 1839
384 Ga0207644_10000425 3300025931 Bacteria 27368
385 Ga0207644_10001731 3300025931 Bacteria 14116
386 Ga0207644_10011078 3300025931 Bacteria 5956
387 Ga0207644_10015032 3300025931 Bacteria 5192
388 Ga0207644_10017401 3300025931 Bacteria 4852
389 Ga0207644_10017494 3300025931 Bacteria 4842
390 Ga0207644_10088005 3300025931 Bacteria 2309
391 Ga0207690_10000240 3300025932 Bacteria 39829
392 Ga0207690_10004526 3300025932 Bacteria 8211
393 Ga0207690_10020517 3300025932 Bacteria 4084
394 Ga0207690_10033597 3300025932 Bacteria 3299
395 Ga0207690_10081077 3300025932 Bacteria 2266
396 Ga0207690_10121102 3300025932 Bacteria 1901
397 Ga0207690_10176574 3300025932 Bacteria 1605
398 Ga0207690_10284392 3300025932 Bacteria 1289
399 Ga0207690_10403158 3300025932 Bacteria 1091
400 Ga0207690_10967227 3300025932 Bacteria 708
401 Ga0207706_10000335 3300025933 Bacteria 51098
402 Ga0207706_10011669 3300025933 Bacteria 8011
403 Ga0207706_10021610 3300025933 Bacteria 5778
404 Ga0207706_10024046 3300025933 Bacteria 5466
405 Ga0207706_10037656 3300025933 Bacteria 4293
406 Ga0207706_10059371 3300025933 Bacteria 3368
407 Ga0207706_10063872 3300025933 Bacteria 3241
408 Ga0207706_10071838 3300025933 Bacteria 3044
409 Ga0207706_10104030 3300025933 Bacteria 2498
410 Ga0207706_10127256 3300025933 Bacteria 2240
411 Ga0207706_10128252 3300025933 Bacteria 2231
412 Ga0207706_10144086 3300025933 Unclassified 2096
413 Ga0207706_10182857 3300025933 Bacteria 1841
414 Ga0207706_10244432 3300025933 Bacteria 1569
415 Ga0207706_10253195 3300025933 Bacteria 1538
416 Ga0207706_10321877 3300025933 Bacteria 1346
417 Ga0207669_10010395 3300025937 Bacteria 4479
418 Ga0207669_10061595 3300025937 Bacteria 2307
419 Ga0207669_10252305 3300025937 Bacteria 1314
420 Ga0207669_10284745 3300025937 Bacteria 1248
421 Ga0207691_10003304 3300025940 Bacteria 15712
422 Ga0207691_10030521 3300025940 Bacteria 5036
423 Ga0207691_10052520 3300025940 Bacteria 3722
424 Ga0207691_10063645 3300025940 Bacteria 3345
425 Ga0207691_10064573 3300025940 Bacteria 3316
426 Ga0207691_10071935 3300025940 Bacteria 3120
427 Ga0207691_10115852 3300025940 Bacteria 2379
428 Ga0207691_10124572 3300025940 Bacteria 2281
429 Ga0207691_10476925 3300025940 Bacteria 1060
430 Ga0207711_10000122 3300025941 Bacteria 81465
431 Ga0207711_10000245 3300025941 Bacteria 58210
432 Ga0207711_10001599 3300025941 Bacteria 20944
433 Ga0207711_10010443 3300025941 Bacteria 7709
434 Ga0207711_10014707 3300025941 Bacteria 6503
435 Ga0207711_10033023 3300025941 Bacteria 4377
436 Ga0207711_10171145 3300025941 Bacteria 1971
437 Ga0207689_10333344 3300025942 Bacteria 1260
438 Ga0207661_10015416 3300025944 Bacteria 5623
439 Ga0207661_10074018 3300025944 Bacteria 2791
440 Ga0207679_10000147 3300025945 Bacteria 57784
441 Ga0207679_10002397 3300025945 Bacteria 11542
442 Ga0207679_10005086 3300025945 Bacteria 8224
443 Ga0207679_10006616 3300025945 Bacteria 7332
444 Ga0207679_10021943 3300025945 Bacteria 4339
445 Ga0207679_10023324 3300025945 Bacteria 4229
446 Ga0207679_10024430 3300025945 Bacteria 4143
447 Ga0207679_10028545 3300025945 Bacteria 3873
448 Ga0207679_10081048 3300025945 Bacteria 2480
449 Ga0207679_10089723 3300025945 Bacteria 2374
450 Ga0207679_10360232 3300025945 Bacteria 1270
451 Ga0207679_10580433 3300025945 Bacteria 1008
452 Ga0207667_10007160 3300025949 Bacteria 13467
453 Ga0207667_10044436 3300025949 Bacteria 4707
454 Ga0207667_10086479 3300025949 Bacteria 3244
455 Ga0207667_10205547 3300025949 Bacteria 2019
456 Ga0207667_10210234 3300025949 Unclassified 1994
457 Ga0207651_10001171 3300025960 Bacteria 11755
458 Ga0207651_10007165 3300025960 Bacteria 5925
459 Ga0207651_10068631 3300025960 Bacteria 2500
460 Ga0207651_10246349 3300025960 Bacteria 1459
461 Ga0207668_10301724 3300025972 Bacteria 1322
462 Ga0207640_10013924 3300025981 Bacteria 4619
463 Ga0207640_10015534 3300025981 Bacteria 4410
464 Ga0207640_10073506 3300025981 Bacteria 2311
465 Ga0207640_10093492 3300025981 Bacteria 2089
466 Ga0207640_10134325 3300025981 Bacteria 1793
467 Ga0207640_10269355 3300025981 Bacteria 1331
468 Ga0207640_10407601 3300025981 Bacteria 1109
469 Ga0207658_10002039 3300025986 Bacteria 15083
470 Ga0207658_10115798 3300025986 Bacteria 2128
471 Ga0207658_10119884 3300025986 Bacteria 2095
472 Ga0207658_10131769 3300025986 Bacteria 2009
473 Ga0207658_10315996 3300025986 Bacteria 1351
474 Ga0207677_10000664 3300026023 Bacteria 20452
475 Ga0207677_10036980 3300026023 Bacteria 3187
476 Ga0207677_10053741 3300026023 Bacteria 2744
477 Ga0207677_10093758 3300026023 Bacteria 2190
478 Ga0207677_10348868 3300026023 Bacteria 1239
479 Ga0207703_10000608 3300026035 Bacteria 36334
480 Ga0207703_10010919 3300026035 Bacteria 7078
481 Ga0207703_10029052 3300026035 Bacteria 4361
482 Ga0207703_10268186 3300026035 Bacteria 1546
483 Ga0207639_10000135 3300026041 Bacteria 54465
484 Ga0207639_10015236 3300026041 Bacteria 5418
485 Ga0207639_10059127 3300026041 Bacteria 2951
486 Ga0207639_10406715 3300026041 Bacteria 1227
487 Ga0207639_10667953 3300026041 Bacteria 962
488 Ga0207639_10744243 3300026041 Bacteria 911
489 Ga0207678_10002273 3300026067 Bacteria 17392
490 Ga0207678_10003049 3300026067 Bacteria 15159
491 Ga0207678_10004888 3300026067 Bacteria 12041
492 Ga0207678_10009171 3300026067 Bacteria 8708
493 Ga0207678_10012693 3300026067 Bacteria 7400
494 Ga0207678_10017680 3300026067 Bacteria 6260
495 Ga0207678_10094977 3300026067 Bacteria 2548
496 Ga0207678_10192962 3300026067 Unclassified 1741
497 Ga0207678_10300379 3300026067 Bacteria 1380
498 Ga0207678_10562369 3300026067 Bacteria 998
499 Ga0207702_10001164 3300026078 Bacteria 26836
500 Ga0207702_10030454 3300026078 Bacteria 4497
501 Ga0207641_10009521 3300026088 Bacteria 8007
502 Ga0207641_10030159 3300026088 Bacteria 4491
503 Ga0207641_10092708 3300026088 Bacteria 2646
504 Ga0207641_10162283 3300026088 Bacteria 2033
505 Ga0207648_10004168 3300026089 Bacteria 14939
506 Ga0207648_10076872 3300026089 Bacteria 2910
507 Ga0207648_10105655 3300026089 Bacteria 2470
508 Ga0207648_10106463 3300026089 Bacteria 2461
509 Ga0207648_10264453 3300026089 Bacteria 1535
510 Ga0207676_10001021 3300026095 Bacteria 21437
511 Ga0207676_10003350 3300026095 Bacteria 11356
512 Ga0207676_10029462 3300026095 Bacteria 4111
513 Ga0207676_10087324 3300026095 Bacteria 2550
514 Ga0207676_10805868 3300026095 Bacteria 916
515 Ga0207674_10000082 3300026116 Bacteria 101650
516 Ga0207674_10004478 3300026116 Bacteria 16801
517 Ga0207674_10007189 3300026116 Bacteria 12996
518 Ga0207674_10035734 3300026116 Bacteria 5185
519 Ga0207674_10466804 3300026116 Bacteria 1220
520 Ga0207675_100026714 3300026118 Bacteria 5373
521 Ga0207683_10003516 3300026121 Bacteria 13661
522 Ga0207683_10046932 3300026121 Bacteria 3782
523 Ga0207683_10067520 3300026121 Bacteria 3154
524 Ga0207698_10000344 3300026142 Bacteria 27432
525 Ga0207698_10002558 3300026142 Bacteria 10794
526 Ga0207698_10006666 3300026142 Bacteria 7219
527 Ga0207698_10011903 3300026142 Bacteria 5665
528 Ga0207698_10016265 3300026142 Bacteria 5010
529 Ga0207698_10020932 3300026142 Bacteria 4514
530 Ga0207698_10658041 3300026142 Bacteria 1038
531 Ga0207698_10902484 3300026142 Bacteria 891
532 Ga0268266_10006871 3300028379 Bacteria 10357
533 Ga0268266_10026204 3300028379 Bacteria 4960
534 Ga0268266_10036917 3300028379 Bacteria 4163
535 Ga0268266_10177895 3300028379 Bacteria 1935
536 Ga0268264_10085507 3300028381 Bacteria 2707
537 Ga0307413_10059313 3300031824 Bacteria 2350
538 Ga0307413_10103625 3300031824 Bacteria 1887
539 Ga0307410_10044947 3300031852 Bacteria 2937
540 Ga0307410_10079033 3300031852 Bacteria 2303
541 Ga0307410_10334367 3300031852 Bacteria 1205
542 Ga0307410_10352633 3300031852 Bacteria 1176
543 Ga0307406_10029154 3300031901 Bacteria 3340
544 Ga0307406_10764827 3300031901 Bacteria 812
545 Ga0307407_10029538 3300031903 Bacteria 2946
546 Ga0307412_10648484 3300031911 Bacteria 900
547 Ga0307409_100028293 3300031995 Bacteria 3990
548 Ga0307409_100235519 3300031995 Bacteria 1663
549 Ga0307409_100283438 3300031995 Bacteria 1533
550 Ga0307416_100014684 3300032002 Bacteria 5380
551 Ga0307416_100264188 3300032002 Bacteria 1684
552 Ga0307414_10296591 3300032004 Bacteria 1365
553 Ga0307411_10003089 3300032005 Bacteria 7614
554 Ga0307411_10033099 3300032005 Bacteria 3203
555 Ga0307411_10317605 3300032005 Bacteria 1256
556 Ga0307411_10483757 3300032005 Bacteria 1043
557 Ga0307411_10505465 3300032005 Bacteria 1022
558 Ga0307415_100006747 3300032126 Bacteria 6222
559 Ga0373931_0045158 3300035691 Bacteria 2326
560 Ga0395899_0001981 3300037312 Bacteria 16845
561 Ga0395899_0008386 3300037312 Bacteria 7957
562 Ga0395899_0023396 3300037312 Bacteria 4679
563 Ga0395899_0044721 3300037312 Unclassified 3298
564 Ga0395899_0073843 3300037312 Bacteria 2493
565 Ga0395899_0127143 3300037312 Bacteria 1822
566 Ga0395899_0183379 3300037312 Bacteria 1468
567 Ga0395899_0262192 3300037312 Bacteria 1181
568 Ga0395900_0009073 3300037418 Bacteria 10195
569 Ga0395900_0017574 3300037418 Bacteria 7297
570 Ga0395900_0036727 3300037418 Bacteria 5050
571 Ga0395900_0045440 3300037418 Bacteria 4524
572 Ga0395900_0103301 3300037418 Bacteria 2927
573 Ga0395900_0132080 3300037418 Bacteria 2558
574 Ga0395900_0147911 3300037418 Bacteria 2401
575 Ga0395900_0225818 3300037418 Bacteria 1885
576 Ga0395900_0272392 3300037418 Bacteria 1687
577 Ga0395900_0438793 3300037418 Bacteria 1263
578 Ga0395900_0639245 3300037418 Bacteria 1001
579 Ga0395898_0007460 3300037466 Bacteria 11611
580 Ga0395898_0041736 3300037466 Bacteria 4530
581 Ga0395898_0105421 3300037466 Bacteria 2703
582 Ga0395898_0111339 3300037466 Bacteria 2624
583 Ga0395898_0313560 3300037466 Bacteria 1496
584 Ga0395898_0752975 3300037466 Bacteria 915
585 Ga0395905_0001242 3300037471 Bacteria 31620
586 Ga0395905_0015907 3300037471 Bacteria 7148
587 Ga0395905_0023966 3300037471 Bacteria 5762
588 Ga0395905_0029230 3300037471 Bacteria 5195
589 Ga0395905_0030728 3300037471 Bacteria 5058
590 Ga0395905_0030825 3300037471 Bacteria 5050
591 Ga0395905_0063305 3300037471 Bacteria 3460
592 Ga0395905_0065279 3300037471 Bacteria 3407
593 Ga0395905_0082054 3300037471 Bacteria 3021
594 Ga0395905_0090062 3300037471 Bacteria 2875
595 Ga0395905_0140221 3300037471 Bacteria 2274
596 Ga0395905_0218739 3300037471 Bacteria 1783
597 Ga0395905_0254702 3300037471 Bacteria 1639
598 Ga0395905_0266538 3300037471 Bacteria 1598
599 Ga0395905_0452140 3300037471 Bacteria 1182
600 Ga0395905_0846796 3300037471 Bacteria 817
601 Ga0395901_0005431 3300038443 Bacteria 12898
602 Ga0395901_0014280 3300038443 Bacteria 8085
603 Ga0395901_0039984 3300038443 Bacteria 4854
604 Ga0395901_0054957 3300038443 Bacteria 4139
605 Ga0395901_0057046 3300038443 Bacteria 4062
606 Ga0395901_0075473 3300038443 Bacteria 3516
607 Ga0395901_0161586 3300038443 Bacteria 2352
608 Ga0395901_0172429 3300038443 Bacteria 2269
609 Ga0395901_0249985 3300038443 Bacteria 1847
610 Ga0395901_0315680 3300038443 Bacteria 1618
611 Ga0395901_0703907 3300038443 Bacteria 1007
612 Ga0395901_0844734 3300038443 Bacteria 901
613 Ga0395901_0921457 3300038443 Bacteria 854
614 Ga0436365_0201828 3300039437 Bacteria 6836
615 Ga0439436_0050330 3300041404 Bacteria 1179
616 Ga0439465_0131722 3300041413 Bacteria 883
617 Ga0439433_0082271 3300041999 Bacteria 784
618 Ga0439432_044004 3300042006 Bacteria 1407
619 Ga0439449_0015438 3300042007 Bacteria 2870
620 Ga0439449_0022933 3300042007 Bacteria 2336
621 Ga0450920_012849 3300042122 Bacteria 1573
622 Ga0439458_0000282 3300042157 Bacteria 12606
623 Ga0466965_0174523 3300044683 Bacteria 1132
624 Ga0466961_0142422 3300044693 Unclassified 1500
625 Ga0466963_0375469 3300044694 Bacteria 1002
626 Ga0466963_0538751 3300044694 Unclassified 824
627 Ga0466964_0181100 3300044706 Bacteria 999
628 Ga0466964_0220586 3300044706 Bacteria 921
629 Ga0466971_0108915 3300044719 Bacteria 1277
630 Ga0466971_0115474 3300044719 Unclassified 1241
631 Ga0466971_0156873 3300044719 Bacteria 1064
632 Ga0466970_0025680 3300044765 Bacteria 3085
633 Ga0466957_0028221 3300044842 Bacteria 3340
634 Ga0466957_0105962 3300044842 Bacteria 1778
635 Ga0466957_0177600 3300044842 Bacteria 1389
636 Ga0466957_0222221 3300044842 Unclassified 1247
637 Ga0466960_0393693 3300044901 Unclassified 797
638 Ga0466959_0195430 3300045049 Unclassified 1410
639 Ga0466958_0441106 3300045836 Unclassified 842
640 Ga0466958_0494553 3300045836 Bacteria 793
641 Ga0466958_0619028 3300045836 Bacteria 704
642 Ga0466967_0017165 3300045976 Bacteria 5736
643 Ga0466967_0602601 3300045976 Bacteria 1084
644 Ga0466967_0794157 3300045976 Bacteria 940
645 Ga0495642_0018463 3300046528 Bacteria 2730
646 Ga0495669_0002858 3300046684 Bacteria 7083
647 Ga0495669_0008963 3300046684 Bacteria 4215
648 Ga0495677_0078931 3300047445 Bacteria 1232
649 Ga0496100_0039690 3300048903 Bacteria 2990
650 Ga0496100_0053838 3300048903 Bacteria 2622
651 Ga0496101_0021997 3300048904 Bacteria 4385
652 Ga0496101_0040488 3300048904 Bacteria 3319
653 Ga0496101_0195655 3300048904 Bacteria 1562
654 Ga0496101_0253231 3300048904 Bacteria 1372
655 Ga0496101_0362627 3300048904 Bacteria 1139
656 Ga0496102_0113332 3300048905 Bacteria 2530
657 Ga0496102_0120442 3300048905 Bacteria 2451
658 Ga0496102_0212302 3300048905 Bacteria 1825
659 Ga0496102_0475260 3300048905 Bacteria 1171
660 Ga0496103_0109764 3300048906 Bacteria 1752
661 Ga0496103_0173803 3300048906 Bacteria 1384
662 Ga0496104_0488958 3300048907 Bacteria 1142
663 Ga0496104_1158253 3300048907 Bacteria 676
664 Ga0496106_0003191 3300048909 Bacteria 12265
665 Ga0496107_0006199 3300048910 Bacteria 8218
666 Ga0496107_0038863 3300048910 Bacteria 3413
667 Ga0496107_0061704 3300048910 Bacteria 2715
668 Ga0496108_0008973 3300048911 Bacteria 8104
669 Ga0496109_0000659 3300048912 Bacteria 28619
670 Ga0496109_0010595 3300048912 Bacteria 7885
671 Ga0496109_0015059 3300048912 Bacteria 6731
672 Ga0496110_0002640 3300048913 Bacteria 13507
673 Ga0496110_0009183 3300048913 Bacteria 7988
674 Ga0496111_0003703 3300048914 Bacteria 9505
675 Ga0496111_0009265 3300048914 Bacteria 6563
676 Ga0496111_0076601 3300048914 Bacteria 2438
677 Ga0496112_0014283 3300048915 Bacteria 7357
678 Ga0496112_0016029 3300048915 Bacteria 7007
679 Ga0496112_0019054 3300048915 Bacteria 6468
680 Ga0496112_0057140 3300048915 Bacteria 3841
681 Ga0496112_0228603 3300048915 Bacteria 1815
682 Ga0496112_0859082 3300048915 Bacteria 830
683 Ga0496113_0009966 3300048916 Bacteria 6261
684 Ga0496113_0030878 3300048916 Bacteria 3883
685 Ga0496113_0178753 3300048916 Bacteria 1682
686 Ga0496113_0181733 3300048916 Bacteria 1667
687 Ga0496114_0000033 3300048917 Bacteria 166897
688 Ga0496114_0024487 3300048917 Bacteria 4928
689 Ga0496114_0053296 3300048917 Bacteria 3372
690 Ga0496115_0001963 3300048918 Bacteria 14678
691 Ga0496115_0032731 3300048918 Bacteria 4103
692 Ga0501067_0364549 3300049583 Unclassified 805
693 Ga0501070_0138149 3300049586 Bacteria 2012
694 Ga0501198_025981 3300049649 Bacteria 954
695 Ga0501201_006458 3300049651 Bacteria 1111
696 Ga0501217_005978 3300049661 Bacteria 2567
697 Ga0501224_021089 3300049664 Bacteria 971
698 Ga0501235_011006 3300049669 Bacteria 1980
699 Ga0501247_002094 3300049677 Bacteria 2041
700 Ga0501249_016576 3300049679 Bacteria 1583
701 Ga0501257_040007 3300049686 Bacteria 1149
702 Ga0501262_016158 3300049759 Bacteria 986
703 Ga0501266_026483 3300049763 Bacteria 812
704 Ga0501268_007648 3300049765 Bacteria 1616
705 Ga0501270_047423 3300049767 Bacteria 768
706 Ga0501272_000361 3300049769 Bacteria 4000
707 Ga0501273_003899 3300049770 Bacteria 1611
708 nmdc:mga0k408_262091_c1 3300050493 Bacteria 1032
709 Ga0590071_037414 3300059421 Bacteria 1165
710 Ga0466962_0083656 3300061719 Bacteria 1527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100470246 Ga0070687_1004702461 168
2 3300037418 Ga0395900_0036727 Ga0395900_0036727_4294_4899 169
3 3300025933 Ga0207706_10244432 Ga0207706_102444322 171
4 3300025321 Ga0207656_10047191 Ga0207656_100471913 175
5 3300025903 Ga0207680_10000275 Ga0207680_100002753 175
6 3300014968 Ga0157379_10728949 Ga0157379_107289492 176
7 3300005344 Ga0070661_100315059 Ga0070661_1003150592 178
8 3300005616 Ga0068852_100083097 Ga0068852_1000830972 178
9 3300025919 Ga0207657_10288921 Ga0207657_102889212 178
10 3300001979 JGI24740J21852_10036897 JGI24740J21852_100368972 179
11 3300001989 JGI24739J22299_10001582 JGI24739J22299_1000158211 179
12 3300001990 JGI24737J22298_10000474 JGI24737J22298_1000047412 179
13 3300002067 JGI24735J21928_10034714 JGI24735J21928_100347142 179
14 3300002075 JGI24738J21930_10000247 JGI24738J21930_100002479 179
15 3300005327 Ga0070658_10000117 Ga0070658_1000011729 179
16 3300005329 Ga0070683_100001025 Ga0070683_1000010258 179
17 3300005331 Ga0070670_100140512 Ga0070670_1001405122 179
18 3300005339 Ga0070660_100000142 Ga0070660_10000014229 179
19 3300005344 Ga0070661_100000079 Ga0070661_10000007928 179
20 3300005355 Ga0070671_100038008 Ga0070671_1000380083 179
21 3300005366 Ga0070659_100000125 Ga0070659_10000012540 179
22 3300005366 Ga0070659_100010129 Ga0070659_1000101297 179
23 3300005455 Ga0070663_100000725 Ga0070663_10000072510 179
24 3300005457 Ga0070662_100000066 Ga0070662_10000006628 179
25 3300005535 Ga0070684_100008097 Ga0070684_1000080979 179
26 3300005539 Ga0068853_100000182 Ga0068853_10000018218 179
27 3300005547 Ga0070693_100000475 Ga0070693_10000047518 179
28 3300005548 Ga0070665_100009601 Ga0070665_1000096017 179
29 3300005563 Ga0068855_100000886 Ga0068855_10000088618 179
30 3300005564 Ga0070664_100000195 Ga0070664_10000019539 179
31 3300005564 Ga0070664_100025221 Ga0070664_1000252213 179
32 3300005614 Ga0068856_100000235 Ga0068856_10000023527 179
33 3300005616 Ga0068852_100000152 Ga0068852_10000015216 179
34 3300005618 Ga0068864_100056664 Ga0068864_1000566643 179
35 3300005842 Ga0068858_100005916 Ga0068858_1000059164 179
36 3300006358 Ga0068871_100007473 Ga0068871_1000074736 179
37 3300009177 Ga0105248_10000117 Ga0105248_1000011727 179
38 3300009551 Ga0105238_10083056 Ga0105238_100830563 179
39 3300013100 Ga0157373_10125330 Ga0157373_101253302 179
40 3300013102 Ga0157371_10003808 Ga0157371_100038084 179
41 3300013306 Ga0163162_10896474 Ga0163162_108964741 179
42 3300014325 Ga0163163_10000357 Ga0163163_1000035718 179
43 3300025904 Ga0207647_10015029 Ga0207647_100150296 179
44 3300025909 Ga0207705_10000245 Ga0207705_1000024515 179
45 3300025913 Ga0207695_10011980 Ga0207695_100119804 179
46 3300025917 Ga0207660_10021190 Ga0207660_100211904 179
47 3300025919 Ga0207657_10000244 Ga0207657_1000024439 179
48 3300025919 Ga0207657_10015997 Ga0207657_100159977 179
49 3300025920 Ga0207649_10000135 Ga0207649_1000013557 179
50 3300025920 Ga0207649_10032128 Ga0207649_100321282 179
51 3300025924 Ga0207694_10032274 Ga0207694_100322743 179
52 3300025925 Ga0207650_10111096 Ga0207650_101110962 179
53 3300025931 Ga0207644_10011078 Ga0207644_100110786 179
54 3300025932 Ga0207690_10000240 Ga0207690_1000024020 179
55 3300025933 Ga0207706_10000335 Ga0207706_1000033525 179
56 3300025933 Ga0207706_10024046 Ga0207706_100240467 179
57 3300025941 Ga0207711_10000245 Ga0207711_1000024528 179
58 3300025944 Ga0207661_10015416 Ga0207661_100154162 179
59 3300025945 Ga0207679_10000147 Ga0207679_1000014752 179
60 3300025945 Ga0207679_10081048 Ga0207679_100810483 179
61 3300025949 Ga0207667_10007160 Ga0207667_1000716011 179
62 3300026035 Ga0207703_10010919 Ga0207703_100109197 179
63 3300026041 Ga0207639_10000135 Ga0207639_1000013516 179
64 3300026041 Ga0207639_10015236 Ga0207639_100152368 179
65 3300026067 Ga0207678_10002273 Ga0207678_1000227310 179
66 3300026078 Ga0207702_10001164 Ga0207702_100011643 179
67 3300026095 Ga0207676_10029462 Ga0207676_100294623 179
68 3300026142 Ga0207698_10000344 Ga0207698_1000034425 179
69 3300026142 Ga0207698_10002558 Ga0207698_100025589 179
70 3300028379 Ga0268266_10006871 Ga0268266_100068712 179
71 3300048915 Ga0496112_0859082 Ga0496112_0859082_155_754 179
72 3300044683 Ga0466965_0174523 Ga0466965_0174523_108_695 181
73 3300044693 Ga0466961_0142422 Ga0466961_0142422_219_806 181
74 3300044694 Ga0466963_0375469 Ga0466963_0375469_221_808 181
75 3300044706 Ga0466964_0220586 Ga0466964_0220586_23_610 181
76 3300044719 Ga0466971_0115474 Ga0466971_0115474_454_1041 181
77 3300044842 Ga0466957_0222221 Ga0466957_0222221_618_1205 181
78 3300045049 Ga0466959_0195430 Ga0466959_0195430_89_676 181
79 3300045836 Ga0466958_0441106 Ga0466958_0441106_98_685 181
80 3300045836 Ga0466958_0619028 Ga0466958_0619028_75_662 181
81 3300005339 Ga0070660_100027577 Ga0070660_1000275773 182
82 3300005616 Ga0068852_100831250 Ga0068852_1008312502 182
83 3300013100 Ga0157373_10331396 Ga0157373_103313962 182
84 3300025909 Ga0207705_10105252 Ga0207705_101052523 182
85 3300025945 Ga0207679_10360232 Ga0207679_103602321 182
86 3300025981 Ga0207640_10073506 Ga0207640_100735061 182
87 3300026142 Ga0207698_10902484 Ga0207698_109024841 182
88 3300005614 Ga0068856_100072721 Ga0068856_1000727212 183
89 3300009093 Ga0105240_10379092 Ga0105240_103790922 183
90 3300010375 Ga0105239_10659936 Ga0105239_106599362 183
91 3300013307 Ga0157372_10195812 Ga0157372_101958122 183
92 3300013307 Ga0157372_10699097 Ga0157372_106990972 183
93 3300025949 Ga0207667_10205547 Ga0207667_102055473 183
94 3300026078 Ga0207702_10030454 Ga0207702_100304546 183
95 3300035691 Ga0373931_0045158 Ga0373931_0045158_1068_1673 183
96 3300038443 Ga0395901_0703907 Ga0395901_0703907_167_754 183
97 3300048915 Ga0496112_0228603 Ga0496112_0228603_496_1101 183
98 3300048916 Ga0496113_0178753 Ga0496113_0178753_932_1537 183
99 3300013296 Ga0157374_10164296 Ga0157374_101642963 184
100 3300031824 Ga0307413_10103625 Ga0307413_101036253 184
101 3300031852 Ga0307410_10044947 Ga0307410_100449472 184
102 3300031911 Ga0307412_10648484 Ga0307412_106484841 184
103 3300031995 Ga0307409_100028293 Ga0307409_1000282934 184
104 3300032002 Ga0307416_100264188 Ga0307416_1002641882 184
105 3300032005 Ga0307411_10317605 Ga0307411_103176052 184
106 3300037312 Ga0395899_0044721 Ga0395899_0044721_947_1534 184
107 3300037312 Ga0395899_0073843 Ga0395899_0073843_1189_1839 184
108 3300037418 Ga0395900_0103301 Ga0395900_0103301_1578_2135 184
109 3300037418 Ga0395900_0438793 Ga0395900_0438793_63_650 184
110 3300037466 Ga0395898_0313560 Ga0395898_0313560_339_926 184
111 3300037471 Ga0395905_0001242 Ga0395905_0001242_13574_14134 184
112 3300037471 Ga0395905_0030728 Ga0395905_0030728_3056_3694 184
113 3300038443 Ga0395901_0161586 Ga0395901_0161586_1440_2027 184
114 3300048904 Ga0496101_0195655 Ga0496101_0195655_535_1134 184
115 3300048907 Ga0496104_0488958 Ga0496104_0488958_19_618 184
116 3300048917 Ga0496114_0053296 Ga0496114_0053296_60_659 184
117 3300048918 Ga0496115_0001963 Ga0496115_0001963_10206_10805 184
118 3300005339 Ga0070660_100017020 Ga0070660_1000170202 185
119 3300005355 Ga0070671_100310364 Ga0070671_1003103642 185
120 3300005366 Ga0070659_100317975 Ga0070659_1003179752 185
121 3300005367 Ga0070667_100154722 Ga0070667_1001547222 185
122 3300005455 Ga0070663_100009729 Ga0070663_1000097297 185
123 3300005539 Ga0068853_100088305 Ga0068853_1000883053 185
124 3300005543 Ga0070672_100183114 Ga0070672_1001831141 185
125 3300005564 Ga0070664_100030886 Ga0070664_1000308864 185
126 3300005618 Ga0068864_100002113 Ga0068864_1000021138 185
127 3300005841 Ga0068863_100157856 Ga0068863_1001578562 185
128 3300009174 Ga0105241_10239911 Ga0105241_102399111 185
129 3300009177 Ga0105248_10116435 Ga0105248_101164354 185
130 3300009177 Ga0105248_11260153 Ga0105248_112601531 185
131 3300013297 Ga0157378_10058893 Ga0157378_100588932 185
132 3300025919 Ga0207657_10032917 Ga0207657_100329173 185
133 3300025931 Ga0207644_10017494 Ga0207644_100174943 185
134 3300025932 Ga0207690_10284392 Ga0207690_102843922 185
135 3300025933 Ga0207706_10321877 Ga0207706_103218772 185
136 3300025940 Ga0207691_10030521 Ga0207691_100305215 185
137 3300025941 Ga0207711_10000122 Ga0207711_1000012251 185
138 3300025945 Ga0207679_10005086 Ga0207679_100050865 185
139 3300025986 Ga0207658_10115798 Ga0207658_101157983 185
140 3300026067 Ga0207678_10017680 Ga0207678_100176803 185
141 3300026088 Ga0207641_10092708 Ga0207641_100927083 185
142 3300026095 Ga0207676_10001021 Ga0207676_1000102115 185
143 3300031824 Ga0307413_10059313 Ga0307413_100593133 185
144 3300031852 Ga0307410_10079033 Ga0307410_100790333 185
145 3300031901 Ga0307406_10029154 Ga0307406_100291542 185
146 3300031903 Ga0307407_10029538 Ga0307407_100295383 185
147 3300032002 Ga0307416_100014684 Ga0307416_1000146843 185
148 3300032004 Ga0307414_10296591 Ga0307414_102965911 185
149 3300032005 Ga0307411_10505465 Ga0307411_105054652 185
150 3300037418 Ga0395900_0132080 Ga0395900_0132080_282_854 185
151 3300037471 Ga0395905_0254702 Ga0395905_0254702_769_1341 185
152 3300038443 Ga0395901_0249985 Ga0395901_0249985_688_1260 185
153 3300041404 Ga0439436_0050330 Ga0439436_0050330_583_1158 185
154 3300041999 Ga0439433_0082271 Ga0439433_0082271_20_595 185
155 3300042007 Ga0439449_0022933 Ga0439449_0022933_557_1132 185
156 3300042122 Ga0450920_012849 Ga0450920_012849_676_1251 185
157 3300048903 Ga0496100_0039690 Ga0496100_0039690_1917_2480 185
158 3300048904 Ga0496101_0040488 Ga0496101_0040488_2231_2794 185
159 3300048905 Ga0496102_0475260 Ga0496102_0475260_305_868 185
160 3300048910 Ga0496107_0038863 Ga0496107_0038863_1309_1872 185
161 3300048917 Ga0496114_0024487 Ga0496114_0024487_1445_2008 185
162 3300048918 Ga0496115_0032731 Ga0496115_0032731_3131_3694 185
163 3300059421 Ga0590071_037414 Ga0590071_037414_250_825 185
164 3300005344 Ga0070661_100069643 Ga0070661_1000696432 186
165 3300005366 Ga0070659_100028112 Ga0070659_1000281123 186
166 3300005539 Ga0068853_100508613 Ga0068853_1005086132 186
167 3300005564 Ga0070664_100021933 Ga0070664_1000219337 186
168 3300005577 Ga0068857_100065719 Ga0068857_1000657192 186
169 3300005616 Ga0068852_100043125 Ga0068852_1000431252 186
170 3300013100 Ga0157373_10180871 Ga0157373_101808712 186
171 3300025919 Ga0207657_10060636 Ga0207657_100606363 186
172 3300025920 Ga0207649_10132982 Ga0207649_101329822 186
173 3300025932 Ga0207690_10004526 Ga0207690_100045264 186
174 3300025945 Ga0207679_10024430 Ga0207679_100244303 186
175 3300026116 Ga0207674_10035734 Ga0207674_100357346 186
176 3300005327 Ga0070658_10156326 Ga0070658_101563262 187
177 3300005327 Ga0070658_10332959 Ga0070658_103329592 187
178 3300005339 Ga0070660_100042850 Ga0070660_1000428502 187
179 3300005339 Ga0070660_100085374 Ga0070660_1000853741 187
180 3300005344 Ga0070661_100024161 Ga0070661_1000241615 187
181 3300005344 Ga0070661_100457020 Ga0070661_1004570202 187
182 3300005366 Ga0070659_100027475 Ga0070659_1000274752 187
183 3300005367 Ga0070667_100008368 Ga0070667_1000083689 187
184 3300005458 Ga0070681_10359665 Ga0070681_103596652 187
185 3300005530 Ga0070679_100760642 Ga0070679_1007606422 187
186 3300005539 Ga0068853_100030645 Ga0068853_1000306455 187
187 3300005539 Ga0068853_100174676 Ga0068853_1001746763 187
188 3300005563 Ga0068855_100528752 Ga0068855_1005287522 187
189 3300005614 Ga0068856_100351528 Ga0068856_1003515282 187
190 3300005616 Ga0068852_100005136 Ga0068852_1000051368 187
191 3300009174 Ga0105241_10550547 Ga0105241_105505472 187
192 3300009177 Ga0105248_10017893 Ga0105248_100178932 187
193 3300009551 Ga0105238_10008581 Ga0105238_1000858113 187
194 3300013102 Ga0157371_10271257 Ga0157371_102712572 187
195 3300013104 Ga0157370_10084738 Ga0157370_100847382 187
196 3300013105 Ga0157369_10005512 Ga0157369_1000551210 187
197 3300013105 Ga0157369_10808419 Ga0157369_108084192 187
198 3300013306 Ga0163162_10036125 Ga0163162_100361255 187
199 3300014968 Ga0157379_10642323 Ga0157379_106423232 187
200 3300025909 Ga0207705_10717315 Ga0207705_107173151 187
201 3300025912 Ga0207707_10263545 Ga0207707_102635452 187
202 3300025915 Ga0207693_10041501 Ga0207693_100415012 187
203 3300025925 Ga0207650_10294758 Ga0207650_102947581 187
204 3300025933 Ga0207706_10104030 Ga0207706_101040303 187
205 3300025941 Ga0207711_10033023 Ga0207711_100330235 187
206 3300025945 Ga0207679_10089723 Ga0207679_100897232 187
207 3300025949 Ga0207667_10210234 Ga0207667_102102343 187
208 3300025981 Ga0207640_10269355 Ga0207640_102693551 187
209 3300026041 Ga0207639_10059127 Ga0207639_100591272 187
210 3300026041 Ga0207639_10667953 Ga0207639_106679531 187
211 3300026142 Ga0207698_10006666 Ga0207698_100066665 187
212 3300026142 Ga0207698_10020932 Ga0207698_100209325 187
213 3300031852 Ga0307410_10334367 Ga0307410_103343671 187
214 3300032005 Ga0307411_10003089 Ga0307411_100030892 187
215 3300037312 Ga0395899_0262192 Ga0395899_0262192_436_1038 187
216 3300037471 Ga0395905_0218739 Ga0395905_0218739_344_922 187
217 3300038443 Ga0395901_0921457 Ga0395901_0921457_16_618 187
218 3300045836 Ga0466958_0494553 Ga0466958_0494553_89_691 187
219 3300045976 Ga0466967_0602601 Ga0466967_0602601_388_966 187
220 3300045976 Ga0466967_0794157 Ga0466967_0794157_101_706 187
221 3300048905 Ga0496102_0212302 Ga0496102_0212302_863_1468 187
222 3300001979 JGI24740J21852_10023685 JGI24740J21852_100236852 188
223 3300001989 JGI24739J22299_10008823 JGI24739J22299_100088232 188
224 3300001990 JGI24737J22298_10032747 JGI24737J22298_100327472 188
225 3300001990 JGI24737J22298_10083216 JGI24737J22298_100832162 188
226 3300002067 JGI24735J21928_10004652 JGI24735J21928_100046523 188
227 3300005327 Ga0070658_10014724 Ga0070658_100147241 188
228 3300005327 Ga0070658_10082660 Ga0070658_100826604 188
229 3300005328 Ga0070676_10099935 Ga0070676_100999352 188
230 3300005329 Ga0070683_100006463 Ga0070683_1000064634 188
231 3300005330 Ga0070690_100004862 Ga0070690_1000048624 188
232 3300005331 Ga0070670_100952070 Ga0070670_1009520701 188
233 3300005335 Ga0070666_10000534 Ga0070666_1000053414 188
234 3300005335 Ga0070666_10019990 Ga0070666_100199903 188
235 3300005337 Ga0070682_100017730 Ga0070682_1000177302 188
236 3300005338 Ga0068868_100000536 Ga0068868_10000053616 188
237 3300005338 Ga0068868_100166560 Ga0068868_1001665603 188
238 3300005339 Ga0070660_100005504 Ga0070660_1000055045 188
239 3300005339 Ga0070660_100113894 Ga0070660_1001138943 188
240 3300005339 Ga0070660_100829158 Ga0070660_1008291581 188
241 3300005343 Ga0070687_100022401 Ga0070687_1000224013 188
242 3300005344 Ga0070661_100082455 Ga0070661_1000824552 188
243 3300005345 Ga0070692_10028984 Ga0070692_100289842 188
244 3300005347 Ga0070668_100041353 Ga0070668_1000413532 188
245 3300005354 Ga0070675_100141908 Ga0070675_1001419084 188
246 3300005355 Ga0070671_100007273 Ga0070671_1000072739 188
247 3300005356 Ga0070674_100002604 Ga0070674_10000260410 188
248 3300005356 Ga0070674_100075206 Ga0070674_1000752062 188
249 3300005364 Ga0070673_100008413 Ga0070673_1000084132 188
250 3300005364 Ga0070673_100008885 Ga0070673_1000088854 188
251 3300005364 Ga0070673_100047406 Ga0070673_1000474063 188
252 3300005366 Ga0070659_100005619 Ga0070659_1000056192 188
253 3300005367 Ga0070667_100003322 Ga0070667_1000033225 188
254 3300005367 Ga0070667_100082485 Ga0070667_1000824853 188
255 3300005455 Ga0070663_100013983 Ga0070663_1000139832 188
256 3300005455 Ga0070663_100083356 Ga0070663_1000833563 188
257 3300005456 Ga0070678_100018418 Ga0070678_1000184186 188
258 3300005456 Ga0070678_100539368 Ga0070678_1005393682 188
259 3300005457 Ga0070662_100037193 Ga0070662_1000371932 188
260 3300005457 Ga0070662_100085293 Ga0070662_1000852932 188
261 3300005457 Ga0070662_100167625 Ga0070662_1001676251 188
262 3300005459 Ga0068867_100043296 Ga0068867_1000432963 188
263 3300005530 Ga0070679_100086693 Ga0070679_1000866932 188
264 3300005535 Ga0070684_100004262 Ga0070684_1000042624 188
265 3300005539 Ga0068853_100055536 Ga0068853_1000555362 188
266 3300005539 Ga0068853_100461264 Ga0068853_1004612642 188
267 3300005543 Ga0070672_100060468 Ga0070672_1000604683 188
268 3300005543 Ga0070672_100089029 Ga0070672_1000890292 188
269 3300005544 Ga0070686_100212534 Ga0070686_1002125342 188
270 3300005548 Ga0070665_100013620 Ga0070665_1000136204 188
271 3300005548 Ga0070665_100370389 Ga0070665_1003703892 188
272 3300005564 Ga0070664_100006873 Ga0070664_1000068736 188
273 3300005564 Ga0070664_100009187 Ga0070664_1000091872 188
274 3300005564 Ga0070664_100085122 Ga0070664_1000851222 188
275 3300005564 Ga0070664_100429575 Ga0070664_1004295752 188
276 3300005564 Ga0070664_100547385 Ga0070664_1005473852 188
277 3300005577 Ga0068857_100072935 Ga0068857_1000729354 188
278 3300005578 Ga0068854_100038716 Ga0068854_1000387162 188
279 3300005578 Ga0068854_100041453 Ga0068854_1000414532 188
280 3300005616 Ga0068852_100001903 Ga0068852_10000190313 188
281 3300005617 Ga0068859_100271799 Ga0068859_1002717992 188
282 3300005617 Ga0068859_101213005 Ga0068859_1012130051 188
283 3300005618 Ga0068864_100013216 Ga0068864_1000132168 188
284 3300005618 Ga0068864_100144991 Ga0068864_1001449913 188
285 3300005618 Ga0068864_100190200 Ga0068864_1001902002 188
286 3300005718 Ga0068866_10066224 Ga0068866_100662242 188
287 3300005834 Ga0068851_10026429 Ga0068851_100264292 188
288 3300005841 Ga0068863_100003382 Ga0068863_10000338210 188
289 3300005842 Ga0068858_100010203 Ga0068858_1000102033 188
290 3300005842 Ga0068858_100175656 Ga0068858_1001756563 188
291 3300005843 Ga0068860_100104293 Ga0068860_1001042932 188
292 3300006358 Ga0068871_100134774 Ga0068871_1001347744 188
293 3300006881 Ga0068865_100347061 Ga0068865_1003470612 188
294 3300006931 Ga0097620_100271828 Ga0097620_1002718282 188
295 3300006931 Ga0097620_101213045 Ga0097620_1012130452 188
296 3300009098 Ga0105245_10235370 Ga0105245_102353702 188
297 3300009177 Ga0105248_10002506 Ga0105248_1000250613 188
298 3300009177 Ga0105248_10017517 Ga0105248_100175172 188
299 3300013100 Ga0157373_10071404 Ga0157373_100714044 188
300 3300013102 Ga0157371_10018979 Ga0157371_100189794 188
301 3300013102 Ga0157371_10073602 Ga0157371_100736022 188
302 3300013104 Ga0157370_10029403 Ga0157370_100294035 188
303 3300013296 Ga0157374_10656857 Ga0157374_106568572 188
304 3300013297 Ga0157378_10109808 Ga0157378_101098082 188
305 3300013307 Ga0157372_10008124 Ga0157372_1000812410 188
306 3300013308 Ga0157375_10063073 Ga0157375_100630734 188
307 3300013308 Ga0157375_10148044 Ga0157375_101480441 188
308 3300014968 Ga0157379_10230868 Ga0157379_102308682 188
309 3300021384 Ga0213876_10006428 Ga0213876_100064282 188
310 3300025899 Ga0207642_10051166 Ga0207642_100511662 188
311 3300025903 Ga0207680_10001481 Ga0207680_100014813 188
312 3300025904 Ga0207647_10016534 Ga0207647_100165345 188
313 3300025904 Ga0207647_10161838 Ga0207647_101618382 188
314 3300025908 Ga0207643_10110448 Ga0207643_101104482 188
315 3300025909 Ga0207705_10006741 Ga0207705_100067419 188
316 3300025909 Ga0207705_10020145 Ga0207705_100201453 188
317 3300025909 Ga0207705_10284510 Ga0207705_102845102 188
318 3300025912 Ga0207707_10147314 Ga0207707_101473143 188
319 3300025917 Ga0207660_10071692 Ga0207660_100716922 188
320 3300025918 Ga0207662_10028252 Ga0207662_100282523 188
321 3300025919 Ga0207657_10002075 Ga0207657_1000207511 188
322 3300025919 Ga0207657_10008279 Ga0207657_100082794 188
323 3300025919 Ga0207657_10019100 Ga0207657_100191007 188
324 3300025920 Ga0207649_10047962 Ga0207649_100479621 188
325 3300025920 Ga0207649_10065376 Ga0207649_100653762 188
326 3300025920 Ga0207649_10090340 Ga0207649_100903402 188
327 3300025921 Ga0207652_10038946 Ga0207652_100389463 188
328 3300025921 Ga0207652_10067710 Ga0207652_100677102 188
329 3300025924 Ga0207694_10601358 Ga0207694_106013582 188
330 3300025925 Ga0207650_10791898 Ga0207650_107918982 188
331 3300025927 Ga0207687_10139138 Ga0207687_101391382 188
332 3300025931 Ga0207644_10000425 Ga0207644_100004255 188
333 3300025931 Ga0207644_10015032 Ga0207644_100150323 188
334 3300025932 Ga0207690_10020517 Ga0207690_100205172 188
335 3300025932 Ga0207690_10033597 Ga0207690_100335972 188
336 3300025932 Ga0207690_10121102 Ga0207690_101211023 188
337 3300025932 Ga0207690_10176574 Ga0207690_101765742 188
338 3300025932 Ga0207690_10967227 Ga0207690_109672271 188
339 3300025933 Ga0207706_10037656 Ga0207706_100376564 188
340 3300025933 Ga0207706_10059371 Ga0207706_100593713 188
341 3300025933 Ga0207706_10063872 Ga0207706_100638722 188
342 3300025933 Ga0207706_10071838 Ga0207706_100718382 188
343 3300025933 Ga0207706_10128252 Ga0207706_101282522 188
344 3300025937 Ga0207669_10061595 Ga0207669_100615952 188
345 3300025937 Ga0207669_10252305 Ga0207669_102523051 188
346 3300025940 Ga0207691_10052520 Ga0207691_100525202 188
347 3300025940 Ga0207691_10115852 Ga0207691_101158522 188
348 3300025941 Ga0207711_10001599 Ga0207711_1000159915 188
349 3300025941 Ga0207711_10014707 Ga0207711_100147073 188
350 3300025944 Ga0207661_10074018 Ga0207661_100740182 188
351 3300025945 Ga0207679_10023324 Ga0207679_100233242 188
352 3300025945 Ga0207679_10028545 Ga0207679_100285454 188
353 3300025945 Ga0207679_10580433 Ga0207679_105804331 188
354 3300025949 Ga0207667_10086479 Ga0207667_100864792 188
355 3300025960 Ga0207651_10007165 Ga0207651_100071656 188
356 3300025960 Ga0207651_10068631 Ga0207651_100686313 188
357 3300025972 Ga0207668_10301724 Ga0207668_103017242 188
358 3300025981 Ga0207640_10013924 Ga0207640_100139242 188
359 3300025981 Ga0207640_10407601 Ga0207640_104076011 188
360 3300025986 Ga0207658_10002039 Ga0207658_1000203919 188
361 3300025986 Ga0207658_10131769 Ga0207658_101317693 188
362 3300026023 Ga0207677_10000664 Ga0207677_1000066416 188
363 3300026023 Ga0207677_10053741 Ga0207677_100537413 188
364 3300026023 Ga0207677_10348868 Ga0207677_103488682 188
365 3300026035 Ga0207703_10000608 Ga0207703_1000060819 188
366 3300026035 Ga0207703_10268186 Ga0207703_102681861 188
367 3300026041 Ga0207639_10406715 Ga0207639_104067152 188
368 3300026041 Ga0207639_10744243 Ga0207639_107442431 188
369 3300026067 Ga0207678_10003049 Ga0207678_100030494 188
370 3300026067 Ga0207678_10009171 Ga0207678_1000917113 188
371 3300026067 Ga0207678_10192962 Ga0207678_101929622 188
372 3300026067 Ga0207678_10562369 Ga0207678_105623692 188
373 3300026088 Ga0207641_10030159 Ga0207641_100301593 188
374 3300026089 Ga0207648_10076872 Ga0207648_100768722 188
375 3300026089 Ga0207648_10106463 Ga0207648_101064633 188
376 3300026095 Ga0207676_10087324 Ga0207676_100873241 188
377 3300026095 Ga0207676_10805868 Ga0207676_108058682 188
378 3300026116 Ga0207674_10007189 Ga0207674_1000718911 188
379 3300026116 Ga0207674_10466804 Ga0207674_104668041 188
380 3300026121 Ga0207683_10067520 Ga0207683_100675203 188
381 3300026142 Ga0207698_10016265 Ga0207698_100162653 188
382 3300026142 Ga0207698_10658041 Ga0207698_106580411 188
383 3300028379 Ga0268266_10026204 Ga0268266_100262043 188
384 3300028379 Ga0268266_10177895 Ga0268266_101778952 188
385 3300028381 Ga0268264_10085507 Ga0268264_100855072 188
386 3300031852 Ga0307410_10352633 Ga0307410_103526332 188
387 3300031901 Ga0307406_10764827 Ga0307406_107648271 188
388 3300032005 Ga0307411_10033099 Ga0307411_100330995 188
389 3300032126 Ga0307415_100006747 Ga0307415_1000067472 188
390 3300037312 Ga0395899_0001981 Ga0395899_0001981_3395_3970 188
391 3300037312 Ga0395899_0008386 Ga0395899_0008386_5001_5582 188
392 3300037418 Ga0395900_0009073 Ga0395900_0009073_1568_2149 188
393 3300037418 Ga0395900_0147911 Ga0395900_0147911_927_1502 188
394 3300037466 Ga0395898_0007460 Ga0395898_0007460_10137_10712 188
395 3300037471 Ga0395905_0015907 Ga0395905_0015907_1001_1576 188
396 3300037471 Ga0395905_0090062 Ga0395905_0090062_1506_2081 188
397 3300038443 Ga0395901_0039984 Ga0395901_0039984_3851_4432 188
398 3300038443 Ga0395901_0172429 Ga0395901_0172429_923_1498 188
399 3300039437 Ga0436365_0201828 Ga0436365_0201828_3901_4482 188
400 3300044901 Ga0466960_0393693 Ga0466960_0393693_143_733 188
401 3300048904 Ga0496101_0362627 Ga0496101_0362627_192_854 188
402 3300048912 Ga0496109_0015059 Ga0496109_0015059_2203_2865 188
403 3300048914 Ga0496111_0076601 Ga0496111_0076601_1691_2353 188
404 3300048915 Ga0496112_0016029 Ga0496112_0016029_1534_2196 188
405 3300048916 Ga0496113_0030878 Ga0496113_0030878_1726_2388 188
406 3300049583 Ga0501067_0364549 Ga0501067_0364549_174_761 188
407 3300001915 JGI24741J21665_1006104 JGI24741J21665_10061043 189
408 3300001977 JGI24746J21847_1003575 JGI24746J21847_10035752 189
409 3300001989 JGI24739J22299_10002879 JGI24739J22299_100028796 189
410 3300001989 JGI24739J22299_10066189 JGI24739J22299_100661891 189
411 3300001990 JGI24737J22298_10037657 JGI24737J22298_100376572 189
412 3300002067 JGI24735J21928_10001422 JGI24735J21928_1000142212 189
413 3300002073 JGI24745J21846_1002550 JGI24745J21846_10025502 189
414 3300002075 JGI24738J21930_10015941 JGI24738J21930_100159411 189
415 3300002077 JGI24744J21845_10001657 JGI24744J21845_100016574 189
416 3300005293 Ga0065715_10136426 Ga0065715_101364262 189
417 3300005327 Ga0070658_10272935 Ga0070658_102729352 189
418 3300005327 Ga0070658_10763191 Ga0070658_107631911 189
419 3300005329 Ga0070683_100133412 Ga0070683_1001334122 189
420 3300005331 Ga0070670_100014077 Ga0070670_1000140777 189
421 3300005331 Ga0070670_100118480 Ga0070670_1001184803 189
422 3300005331 Ga0070670_100130081 Ga0070670_1001300812 189
423 3300005331 Ga0070670_100209120 Ga0070670_1002091203 189
424 3300005333 Ga0070677_10169602 Ga0070677_101696021 189
425 3300005334 Ga0068869_100134367 Ga0068869_1001343672 189
426 3300005335 Ga0070666_10001262 Ga0070666_100012625 189
427 3300005335 Ga0070666_10054857 Ga0070666_100548572 189
428 3300005335 Ga0070666_10064087 Ga0070666_100640872 189
429 3300005336 Ga0070680_100189766 Ga0070680_1001897662 189
430 3300005338 Ga0068868_100060515 Ga0068868_1000605152 189
431 3300005338 Ga0068868_101098053 Ga0068868_1010980531 189
432 3300005339 Ga0070660_100140126 Ga0070660_1001401262 189
433 3300005339 Ga0070660_100826879 Ga0070660_1008268791 189
434 3300005344 Ga0070661_100072851 Ga0070661_1000728512 189
435 3300005344 Ga0070661_100115486 Ga0070661_1001154861 189
436 3300005344 Ga0070661_100649028 Ga0070661_1006490281 189
437 3300005344 Ga0070661_100867100 Ga0070661_1008671001 189
438 3300005353 Ga0070669_100070880 Ga0070669_1000708804 189
439 3300005354 Ga0070675_100054103 Ga0070675_1000541033 189
440 3300005354 Ga0070675_100095796 Ga0070675_1000957962 189
441 3300005355 Ga0070671_100001217 Ga0070671_1000012177 189
442 3300005355 Ga0070671_100002941 Ga0070671_10000294119 189
443 3300005355 Ga0070671_100043709 Ga0070671_1000437093 189
444 3300005355 Ga0070671_100068784 Ga0070671_1000687843 189
445 3300005355 Ga0070671_100089243 Ga0070671_1000892432 189
446 3300005355 Ga0070671_100144036 Ga0070671_1001440363 189
447 3300005356 Ga0070674_100033583 Ga0070674_1000335834 189
448 3300005356 Ga0070674_100049915 Ga0070674_1000499153 189
449 3300005356 Ga0070674_100133053 Ga0070674_1001330532 189
450 3300005364 Ga0070673_100001439 Ga0070673_10000143910 189
451 3300005364 Ga0070673_100083750 Ga0070673_1000837502 189
452 3300005366 Ga0070659_100118961 Ga0070659_1001189612 189
453 3300005366 Ga0070659_100162474 Ga0070659_1001624742 189
454 3300005366 Ga0070659_100487180 Ga0070659_1004871801 189
455 3300005367 Ga0070667_100005526 Ga0070667_1000055263 189
456 3300005367 Ga0070667_100713032 Ga0070667_1007130321 189
457 3300005455 Ga0070663_100190813 Ga0070663_1001908131 189
458 3300005455 Ga0070663_100247068 Ga0070663_1002470681 189
459 3300005455 Ga0070663_100506338 Ga0070663_1005063381 189
460 3300005456 Ga0070678_100024099 Ga0070678_1000240994 189
461 3300005456 Ga0070678_100337205 Ga0070678_1003372051 189
462 3300005457 Ga0070662_100000664 Ga0070662_1000006647 189
463 3300005457 Ga0070662_100052776 Ga0070662_1000527762 189
464 3300005457 Ga0070662_100105033 Ga0070662_1001050332 189
465 3300005457 Ga0070662_100172680 Ga0070662_1001726801 189
466 3300005457 Ga0070662_100215818 Ga0070662_1002158182 189
467 3300005457 Ga0070662_100305321 Ga0070662_1003053212 189
468 3300005458 Ga0070681_10193235 Ga0070681_101932352 189
469 3300005458 Ga0070681_10827604 Ga0070681_108276041 189
470 3300005459 Ga0068867_100199745 Ga0068867_1001997453 189
471 3300005459 Ga0068867_100368911 Ga0068867_1003689112 189
472 3300005530 Ga0070679_100089596 Ga0070679_1000895962 189
473 3300005539 Ga0068853_100162125 Ga0068853_1001621252 189
474 3300005543 Ga0070672_100009243 Ga0070672_1000092433 189
475 3300005543 Ga0070672_100040725 Ga0070672_1000407252 189
476 3300005543 Ga0070672_100077159 Ga0070672_1000771592 189
477 3300005543 Ga0070672_100247192 Ga0070672_1002471923 189
478 3300005548 Ga0070665_100027660 Ga0070665_1000276606 189
479 3300005563 Ga0068855_100509775 Ga0068855_1005097752 189
480 3300005564 Ga0070664_100001042 Ga0070664_10000104219 189
481 3300005564 Ga0070664_100008847 Ga0070664_1000088477 189
482 3300005564 Ga0070664_100263743 Ga0070664_1002637433 189
483 3300005577 Ga0068857_100005983 Ga0068857_1000059839 189
484 3300005578 Ga0068854_100021662 Ga0068854_1000216622 189
485 3300005614 Ga0068856_100089989 Ga0068856_1000899892 189
486 3300005616 Ga0068852_100083325 Ga0068852_1000833253 189
487 3300005617 Ga0068859_100113662 Ga0068859_1001136622 189
488 3300005618 Ga0068864_100127339 Ga0068864_1001273393 189
489 3300005618 Ga0068864_100521914 Ga0068864_1005219141 189
490 3300005718 Ga0068866_10186864 Ga0068866_101868642 189
491 3300005719 Ga0068861_100404818 Ga0068861_1004048182 189
492 3300005840 Ga0068870_10173993 Ga0068870_101739932 189
493 3300005841 Ga0068863_100004220 Ga0068863_1000042209 189
494 3300005841 Ga0068863_100195156 Ga0068863_1001951562 189
495 3300005842 Ga0068858_100008456 Ga0068858_1000084566 189
496 3300005985 Ga0081539_10089811 Ga0081539_100898113 189
497 3300006195 Ga0075366_10103876 Ga0075366_101038762 189
498 3300006237 Ga0097621_100007831 Ga0097621_1000078318 189
499 3300006237 Ga0097621_100192262 Ga0097621_1001922622 189
500 3300006358 Ga0068871_100003116 Ga0068871_1000031162 189
501 3300006358 Ga0068871_100150776 Ga0068871_1001507762 189
502 3300006358 Ga0068871_100200635 Ga0068871_1002006352 189
503 3300006881 Ga0068865_100115613 Ga0068865_1001156131 189
504 3300006931 Ga0097620_100113669 Ga0097620_1001136692 189
505 3300009093 Ga0105240_10080827 Ga0105240_100808274 189
506 3300009176 Ga0105242_10432014 Ga0105242_104320141 189
507 3300009176 Ga0105242_11237200 Ga0105242_112372001 189
508 3300009177 Ga0105248_10000269 Ga0105248_1000026957 189
509 3300009177 Ga0105248_10015071 Ga0105248_100150717 189
510 3300009551 Ga0105238_10071536 Ga0105238_100715362 189
511 3300009551 Ga0105238_10369033 Ga0105238_103690332 189
512 3300011119 Ga0105246_10033208 Ga0105246_100332082 189
513 3300011119 Ga0105246_10099915 Ga0105246_100999153 189
514 3300011119 Ga0105246_10303837 Ga0105246_103038372 189
515 3300013102 Ga0157371_10398643 Ga0157371_103986431 189
516 3300013104 Ga0157370_10047167 Ga0157370_100471672 189
517 3300013104 Ga0157370_10660788 Ga0157370_106607881 189
518 3300013105 Ga0157369_10086835 Ga0157369_100868354 189
519 3300013296 Ga0157374_10024942 Ga0157374_100249421 189
520 3300013297 Ga0157378_10072728 Ga0157378_100727284 189
521 3300013297 Ga0157378_10321360 Ga0157378_103213601 189
522 3300013306 Ga0163162_10003750 Ga0163162_1000375018 189
523 3300013307 Ga0157372_10628296 Ga0157372_106282962 189
524 3300013307 Ga0157372_10697650 Ga0157372_106976502 189
525 3300013307 Ga0157372_10916479 Ga0157372_109164792 189
526 3300013308 Ga0157375_10008955 Ga0157375_100089558 189
527 3300014325 Ga0163163_10011391 Ga0163163_100113915 189
528 3300014325 Ga0163163_10011892 Ga0163163_100118929 189
529 3300014745 Ga0157377_10020712 Ga0157377_100207122 189
530 3300017792 Ga0163161_10023715 Ga0163161_100237156 189
531 3300020070 Ga0206356_10307778 Ga0206356_103077784 189
532 3300020081 Ga0206354_11272291 Ga0206354_112722912 189
533 3300020082 Ga0206353_11146179 Ga0206353_111461792 189
534 3300025315 Ga0207697_10001762 Ga0207697_100017624 189
535 3300025315 Ga0207697_10015046 Ga0207697_100150463 189
536 3300025893 Ga0207682_10026221 Ga0207682_100262212 189
537 3300025899 Ga0207642_10124574 Ga0207642_101245742 189
538 3300025899 Ga0207642_10151537 Ga0207642_101515372 189
539 3300025901 Ga0207688_10001676 Ga0207688_100016764 189
540 3300025903 Ga0207680_10006516 Ga0207680_100065166 189
541 3300025903 Ga0207680_10015080 Ga0207680_100150803 189
542 3300025903 Ga0207680_10059808 Ga0207680_100598081 189
543 3300025903 Ga0207680_10213516 Ga0207680_102135162 189
544 3300025904 Ga0207647_10015347 Ga0207647_100153477 189
545 3300025904 Ga0207647_10020320 Ga0207647_100203203 189
546 3300025904 Ga0207647_10031001 Ga0207647_100310012 189
547 3300025908 Ga0207643_10173192 Ga0207643_101731921 189
548 3300025909 Ga0207705_10005670 Ga0207705_100056708 189
549 3300025909 Ga0207705_10586550 Ga0207705_105865502 189
550 3300025912 Ga0207707_10049992 Ga0207707_100499922 189
551 3300025917 Ga0207660_10016665 Ga0207660_100166653 189
552 3300025919 Ga0207657_10010333 Ga0207657_100103332 189
553 3300025919 Ga0207657_10095590 Ga0207657_100955902 189
554 3300025919 Ga0207657_10136194 Ga0207657_101361942 189
555 3300025920 Ga0207649_10049821 Ga0207649_100498212 189
556 3300025920 Ga0207649_10109148 Ga0207649_101091483 189
557 3300025920 Ga0207649_10352808 Ga0207649_103528081 189
558 3300025920 Ga0207649_10390583 Ga0207649_103905832 189
559 3300025923 Ga0207681_10089574 Ga0207681_100895742 189
560 3300025924 Ga0207694_10418088 Ga0207694_104180882 189
561 3300025925 Ga0207650_10055782 Ga0207650_100557822 189
562 3300025925 Ga0207650_10059441 Ga0207650_100594413 189
563 3300025925 Ga0207650_10189596 Ga0207650_101895962 189
564 3300025925 Ga0207650_10497812 Ga0207650_104978121 189
565 3300025926 Ga0207659_10017549 Ga0207659_100175492 189
566 3300025926 Ga0207659_10070889 Ga0207659_100708893 189
567 3300025927 Ga0207687_10035202 Ga0207687_100352021 189
568 3300025931 Ga0207644_10001731 Ga0207644_1000173110 189
569 3300025931 Ga0207644_10017401 Ga0207644_100174016 189
570 3300025931 Ga0207644_10088005 Ga0207644_100880052 189
571 3300025932 Ga0207690_10081077 Ga0207690_100810772 189
572 3300025932 Ga0207690_10403158 Ga0207690_104031581 189
573 3300025933 Ga0207706_10011669 Ga0207706_100116695 189
574 3300025933 Ga0207706_10021610 Ga0207706_100216109 189
575 3300025933 Ga0207706_10127256 Ga0207706_101272562 189
576 3300025933 Ga0207706_10144086 Ga0207706_101440862 189
577 3300025933 Ga0207706_10182857 Ga0207706_101828572 189
578 3300025933 Ga0207706_10253195 Ga0207706_102531952 189
579 3300025937 Ga0207669_10010395 Ga0207669_100103953 189
580 3300025937 Ga0207669_10284745 Ga0207669_102847451 189
581 3300025940 Ga0207691_10003304 Ga0207691_100033043 189
582 3300025940 Ga0207691_10063645 Ga0207691_100636452 189
583 3300025940 Ga0207691_10064573 Ga0207691_100645732 189
584 3300025940 Ga0207691_10071935 Ga0207691_100719353 189
585 3300025940 Ga0207691_10124572 Ga0207691_101245722 189
586 3300025940 Ga0207691_10476925 Ga0207691_104769251 189
587 3300025941 Ga0207711_10010443 Ga0207711_100104435 189
588 3300025941 Ga0207711_10171145 Ga0207711_101711452 189
589 3300025942 Ga0207689_10333344 Ga0207689_103333442 189
590 3300025945 Ga0207679_10002397 Ga0207679_100023975 189
591 3300025945 Ga0207679_10006616 Ga0207679_100066169 189
592 3300025945 Ga0207679_10021943 Ga0207679_100219432 189
593 3300025949 Ga0207667_10044436 Ga0207667_100444362 189
594 3300025960 Ga0207651_10001171 Ga0207651_100011715 189
595 3300025960 Ga0207651_10246349 Ga0207651_102463492 189
596 3300025981 Ga0207640_10015534 Ga0207640_100155346 189
597 3300025981 Ga0207640_10093492 Ga0207640_100934921 189
598 3300025981 Ga0207640_10134325 Ga0207640_101343252 189
599 3300025986 Ga0207658_10119884 Ga0207658_101198842 189
600 3300025986 Ga0207658_10315996 Ga0207658_103159962 189
601 3300026023 Ga0207677_10036980 Ga0207677_100369802 189
602 3300026023 Ga0207677_10093758 Ga0207677_100937582 189
603 3300026035 Ga0207703_10029052 Ga0207703_100290522 189
604 3300026067 Ga0207678_10004888 Ga0207678_1000488814 189
605 3300026067 Ga0207678_10012693 Ga0207678_100126934 189
606 3300026067 Ga0207678_10094977 Ga0207678_100949772 189
607 3300026067 Ga0207678_10300379 Ga0207678_103003792 189
608 3300026088 Ga0207641_10009521 Ga0207641_100095219 189
609 3300026088 Ga0207641_10162283 Ga0207641_101622832 189
610 3300026089 Ga0207648_10004168 Ga0207648_1000416818 189
611 3300026089 Ga0207648_10105655 Ga0207648_101056552 189
612 3300026089 Ga0207648_10264453 Ga0207648_102644533 189
613 3300026095 Ga0207676_10003350 Ga0207676_1000335011 189
614 3300026116 Ga0207674_10000082 Ga0207674_1000008254 189
615 3300026116 Ga0207674_10004478 Ga0207674_1000447811 189
616 3300026118 Ga0207675_100026714 Ga0207675_1000267143 189
617 3300026121 Ga0207683_10003516 Ga0207683_100035165 189
618 3300026121 Ga0207683_10046932 Ga0207683_100469322 189
619 3300026142 Ga0207698_10011903 Ga0207698_100119032 189
620 3300028379 Ga0268266_10036917 Ga0268266_100369174 189
621 3300031995 Ga0307409_100235519 Ga0307409_1002355192 189
622 3300031995 Ga0307409_100283438 Ga0307409_1002834382 189
623 3300032005 Ga0307411_10483757 Ga0307411_104837572 189
624 3300037312 Ga0395899_0023396 Ga0395899_0023396_673_1251 189
625 3300037312 Ga0395899_0127143 Ga0395899_0127143_338_916 189
626 3300037312 Ga0395899_0183379 Ga0395899_0183379_856_1437 189
627 3300037418 Ga0395900_0017574 Ga0395900_0017574_752_1360 189
628 3300037418 Ga0395900_0045440 Ga0395900_0045440_1137_1739 189
629 3300037418 Ga0395900_0225818 Ga0395900_0225818_174_752 189
630 3300037418 Ga0395900_0272392 Ga0395900_0272392_671_1249 189
631 3300037418 Ga0395900_0639245 Ga0395900_0639245_290_868 189
632 3300037466 Ga0395898_0041736 Ga0395898_0041736_3191_3769 189
633 3300037466 Ga0395898_0105421 Ga0395898_0105421_220_801 189
634 3300037466 Ga0395898_0111339 Ga0395898_0111339_1364_1972 189
635 3300037466 Ga0395898_0752975 Ga0395898_0752975_94_711 189
636 3300037471 Ga0395905_0023966 Ga0395905_0023966_992_1600 189
637 3300037471 Ga0395905_0029230 Ga0395905_0029230_333_914 189
638 3300037471 Ga0395905_0030825 Ga0395905_0030825_330_911 189
639 3300037471 Ga0395905_0063305 Ga0395905_0063305_438_1016 189
640 3300037471 Ga0395905_0065279 Ga0395905_0065279_507_1085 189
641 3300037471 Ga0395905_0082054 Ga0395905_0082054_1296_1913 189
642 3300037471 Ga0395905_0140221 Ga0395905_0140221_1544_2146 189
643 3300037471 Ga0395905_0266538 Ga0395905_0266538_299_877 189
644 3300037471 Ga0395905_0452140 Ga0395905_0452140_68_646 189
645 3300037471 Ga0395905_0846796 Ga0395905_0846796_99_677 189
646 3300038443 Ga0395901_0005431 Ga0395901_0005431_4545_5153 189
647 3300038443 Ga0395901_0014280 Ga0395901_0014280_6923_7525 189
648 3300038443 Ga0395901_0054957 Ga0395901_0054957_739_1317 189
649 3300038443 Ga0395901_0057046 Ga0395901_0057046_3207_3785 189
650 3300038443 Ga0395901_0075473 Ga0395901_0075473_19_636 189
651 3300038443 Ga0395901_0315680 Ga0395901_0315680_544_1122 189
652 3300038443 Ga0395901_0844734 Ga0395901_0844734_78_656 189
653 3300041413 Ga0439465_0131722 Ga0439465_0131722_53_667 189
654 3300042006 Ga0439432_044004 Ga0439432_044004_375_989 189
655 3300042007 Ga0439449_0015438 Ga0439449_0015438_519_1133 189
656 3300042157 Ga0439458_0000282 Ga0439458_0000282_108_692 189
657 3300044694 Ga0466963_0538751 Ga0466963_0538751_155_727 189
658 3300044706 Ga0466964_0181100 Ga0466964_0181100_377_949 189
659 3300044719 Ga0466971_0108915 Ga0466971_0108915_63_635 189
660 3300044719 Ga0466971_0156873 Ga0466971_0156873_457_1029 189
661 3300044765 Ga0466970_0025680 Ga0466970_0025680_2365_2934 189
662 3300044842 Ga0466957_0028221 Ga0466957_0028221_1592_2203 189
663 3300044842 Ga0466957_0105962 Ga0466957_0105962_835_1416 189
664 3300044842 Ga0466957_0177600 Ga0466957_0177600_190_762 189
665 3300045976 Ga0466967_0017165 Ga0466967_0017165_1952_2524 189
666 3300046528 Ga0495642_0018463 Ga0495642_0018463_258_830 189
667 3300046684 Ga0495669_0002858 Ga0495669_0002858_6259_6951 189
668 3300046684 Ga0495669_0008963 Ga0495669_0008963_3388_3960 189
669 3300047445 Ga0495677_0078931 Ga0495677_0078931_53_625 189
670 3300048903 Ga0496100_0053838 Ga0496100_0053838_1910_2482 189
671 3300048904 Ga0496101_0021997 Ga0496101_0021997_2237_2809 189
672 3300048904 Ga0496101_0253231 Ga0496101_0253231_230_814 189
673 3300048905 Ga0496102_0113332 Ga0496102_0113332_1229_1813 189
674 3300048905 Ga0496102_0120442 Ga0496102_0120442_529_1107 189
675 3300048906 Ga0496103_0109764 Ga0496103_0109764_979_1557 189
676 3300048906 Ga0496103_0173803 Ga0496103_0173803_644_1228 189
677 3300048907 Ga0496104_1158253 Ga0496104_1158253_77_649 189
678 3300048909 Ga0496106_0003191 Ga0496106_0003191_7232_7804 189
679 3300048910 Ga0496107_0006199 Ga0496107_0006199_5591_6163 189
680 3300048910 Ga0496107_0061704 Ga0496107_0061704_1914_2498 189
681 3300048911 Ga0496108_0008973 Ga0496108_0008973_2519_3103 189
682 3300048912 Ga0496109_0000659 Ga0496109_0000659_10177_10749 189
683 3300048912 Ga0496109_0010595 Ga0496109_0010595_7123_7707 189
684 3300048913 Ga0496110_0002640 Ga0496110_0002640_8566_9150 189
685 3300048913 Ga0496110_0009183 Ga0496110_0009183_6207_6779 189
686 3300048914 Ga0496111_0003703 Ga0496111_0003703_5892_6464 189
687 3300048914 Ga0496111_0009265 Ga0496111_0009265_2317_2901 189
688 3300048915 Ga0496112_0014283 Ga0496112_0014283_2639_3223 189
689 3300048915 Ga0496112_0019054 Ga0496112_0019054_3052_3624 189
690 3300048915 Ga0496112_0057140 Ga0496112_0057140_968_1546 189
691 3300048916 Ga0496113_0009966 Ga0496113_0009966_4564_5148 189
692 3300048916 Ga0496113_0181733 Ga0496113_0181733_22_594 189
693 3300048917 Ga0496114_0000033 Ga0496114_0000033_108047_108625 189
694 3300049586 Ga0501070_0138149 Ga0501070_0138149_705_1289 189
695 3300049649 Ga0501198_025981 Ga0501198_025981_77_691 189
696 3300049651 Ga0501201_006458 Ga0501201_006458_235_849 189
697 3300049661 Ga0501217_005978 Ga0501217_005978_1017_1631 189
698 3300049664 Ga0501224_021089 Ga0501224_021089_236_850 189
699 3300049669 Ga0501235_011006 Ga0501235_011006_850_1464 189
700 3300049677 Ga0501247_002094 Ga0501247_002094_122_736 189
701 3300049679 Ga0501249_016576 Ga0501249_016576_28_642 189
702 3300049686 Ga0501257_040007 Ga0501257_040007_178_792 189
703 3300049759 Ga0501262_016158 Ga0501262_016158_139_753 189
704 3300049763 Ga0501266_026483 Ga0501266_026483_18_632 189
705 3300049765 Ga0501268_007648 Ga0501268_007648_669_1283 189
706 3300049767 Ga0501270_047423 Ga0501270_047423_180_758 189
707 3300049769 Ga0501272_000361 Ga0501272_000361_1837_2451 189
708 3300049770 Ga0501273_003899 Ga0501273_003899_437_1051 189
709 3300050493 nmdc:mga0k408_262091_c1 nmdc:mga0k408_262091_c1_71_652 189
710 3300061719 Ga0466962_0083656 Ga0466962_0083656_93_680 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

119

228

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uwv-assembly5.cif.gz_C crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8789 78 187
5uwv-assembly1.cif.gz_B crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8701 79 187
5uwv-assembly3.cif.gz_D crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8681 79 187
5uwv-assembly2.cif.gz_A crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.867 78 187
4gsq-assembly1.cif.gz_A structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains 0.867 78 187
ID Description Score Start End Superfamily
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8681 79 187 2.40.440.10
6iywC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8557 78 187 2.40.440.10
6d51A02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8539 79 187 2.40.440.10
4jmxA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8532 79 187 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8403 77 187 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A520YEC3-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.935 64 189 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A520YEC3-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.928 64 189 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A7H0G9H8-F1-model_v4 deleted 0.9263 44 187
AF-A0A0Q8RT77-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9201 61 187 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A0W1DM40-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9197 62 187 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972

Feature Viewer

pLDDT pTM Quality
84.46 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map