F476808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 379 | 657 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300003856|Ga0058692_1000012|Ga0058692_1000012222 |
| Length | 251 |
| Sequence | MRPPAAAERTDSRDDAAGWPRLAPTEVRDPNMKDIHKLLQNNRDWADRIEKEDPEFFHQLAKQQHPEYLWIGCSDSRVPANQIIGMAPGEVFVHRNVANVVAHTDLNCLSVVQYAVDQLKVKHILIVGHYGCGGVHACLHNTRVGLADNWLRHVGDVMQKHAAIIDALETDELRHARLCELNVIEQVANLCRSTIVQDAWARGQKLMVHGWVYSLKDGRVREMGIDVGSPEDLQPAYEKALSYVPRKGKRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 5 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 6 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 7 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 10 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 11 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 12 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 13 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 14 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 15 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 16 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 17 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 18 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 19 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 20 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 21 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 22 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 23 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 24 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 25 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 26 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 27 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 28 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 29 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 30 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 31 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 32 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 33 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 34 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 35 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 36 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 37 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 38 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 39 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 40 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 41 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 42 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 43 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 44 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 45 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 46 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 47 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 48 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 49 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 50 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 51 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 52 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 53 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 54 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 55 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 56 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 57 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 67 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 68 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 77 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 94 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 114 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 117 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 232 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 233 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 234 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 235 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 248 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 250 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 251 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 252 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 253 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 254 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 255 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 267 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 275 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 278 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 279 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 280 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 318 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 346 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 347 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 348 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 376 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 377 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 378 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 379 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.99 |
| Metatranscriptomes | 0.28 |
| Isolates | 7.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 13.34 |
| Nodule | 0.14 |
| Rhizoplane | 1.12 |
| Rhizosphere | 72.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_361393 | 2162886007 | Bacteria | 1544 |
| 2 | JGI25152J39213_1000032 | 3300002773 | Bacteria | 96369 |
| 3 | JGI25150J39212_1000179 | 3300002774 | Bacteria | 35481 |
| 4 | JGI25151J46595_10000138 | 3300003187 | Bacteria | 96369 |
| 5 | JGI25151J46595_10000148 | 3300003187 | Bacteria | 92040 |
| 6 | JGI25151J46595_10006340 | 3300003187 | Bacteria | 5959 |
| 7 | JGI25151J46595_10063635 | 3300003187 | Bacteria | 1159 |
| 8 | JGI25153J46596_10000102 | 3300003215 | Bacteria | 96369 |
| 9 | rootH1_10150984 | 3300003323 | Bacteria | 2742 |
| 10 | Ga0055526_1000006 | 3300003771 | Bacteria | 330857 |
| 11 | Ga0055526_1000413 | 3300003771 | Bacteria | 34618 |
| 12 | Ga0055526_1009856 | 3300003771 | Bacteria | 4532 |
| 13 | Ga0055537_1000018 | 3300003773 | Bacteria | 123452 |
| 14 | Ga0055537_1000349 | 3300003773 | Bacteria | 31443 |
| 15 | Ga0055524_1000009 | 3300003775 | Bacteria | 295254 |
| 16 | Ga0055524_1010630 | 3300003775 | Bacteria | 3652 |
| 17 | Ga0055524_1018136 | 3300003775 | Bacteria | 2454 |
| 18 | Ga0055536_1002383 | 3300003781 | Bacteria | 10598 |
| 19 | Ga0055536_1003808 | 3300003781 | Bacteria | 7949 |
| 20 | Ga0055536_1052554 | 3300003781 | Bacteria | 886 |
| 21 | Ga0055534_1000004 | 3300003784 | Bacteria | 295251 |
| 22 | Ga0055534_1000073 | 3300003784 | Bacteria | 77473 |
| 23 | Ga0055528_1000003 | 3300003790 | Bacteria | 330875 |
| 24 | Ga0055528_1000080 | 3300003790 | Bacteria | 75390 |
| 25 | Ga0055530_10001767 | 3300003791 | Bacteria | 15103 |
| 26 | Ga0055530_10001774 | 3300003791 | Bacteria | 15004 |
| 27 | Ga0055540_1026811 | 3300003792 | Bacteria | 1388 |
| 28 | Ga0055531_10010111 | 3300003794 | Bacteria | 4736 |
| 29 | Ga0055531_10021508 | 3300003794 | Bacteria | 2499 |
| 30 | Ga0055531_10024202 | 3300003794 | Bacteria | 2249 |
| 31 | Ga0058692_1000012 | 3300003856 | Bacteria | 318930 |
| 32 | Ga0058692_1000023 | 3300003856 | Bacteria | 237263 |
| 33 | Ga0065165_1028945 | 3300005262 | Bacteria | 1781 |
| 34 | Ga0065704_10075451 | 3300005289 | Bacteria | 5582 |
| 35 | Ga0065704_10092418 | 3300005289 | Bacteria | 2655 |
| 36 | Ga0065704_10189581 | 3300005289 | Bacteria | 1196 |
| 37 | Ga0065715_10018126 | 3300005293 | Bacteria | 2680 |
| 38 | Ga0070683_100046821 | 3300005329 | Bacteria | 3996 |
| 39 | Ga0070683_100286536 | 3300005329 | Bacteria | 1567 |
| 40 | Ga0070683_100304324 | 3300005329 | Bacteria | 1517 |
| 41 | Ga0070683_100838805 | 3300005329 | Bacteria | 881 |
| 42 | Ga0070690_100020353 | 3300005330 | Bacteria | 4042 |
| 43 | Ga0070690_100359015 | 3300005330 | Bacteria | 1060 |
| 44 | Ga0070670_100005062 | 3300005331 | Bacteria | 11088 |
| 45 | Ga0070670_100006427 | 3300005331 | Bacteria | 9947 |
| 46 | Ga0070670_100257850 | 3300005331 | Bacteria | 1520 |
| 47 | Ga0068869_100098086 | 3300005334 | Bacteria | 2213 |
| 48 | Ga0068869_100395013 | 3300005334 | Bacteria | 1136 |
| 49 | Ga0070666_10045825 | 3300005335 | Bacteria | 2931 |
| 50 | Ga0070680_100001505 | 3300005336 | Bacteria | 16973 |
| 51 | Ga0068868_100069326 | 3300005338 | Bacteria | 2810 |
| 52 | Ga0068868_100199320 | 3300005338 | Bacteria | 1668 |
| 53 | Ga0070660_100013111 | 3300005339 | Bacteria | 5936 |
| 54 | Ga0070661_100004441 | 3300005344 | Bacteria | 9667 |
| 55 | Ga0070661_100034944 | 3300005344 | Bacteria | 3648 |
| 56 | Ga0070661_100169457 | 3300005344 | Bacteria | 1657 |
| 57 | Ga0070692_10079260 | 3300005345 | Bacteria | 1765 |
| 58 | Ga0070668_100036424 | 3300005347 | Bacteria | 3755 |
| 59 | Ga0070669_100034776 | 3300005353 | Bacteria | 3648 |
| 60 | Ga0070671_100441589 | 3300005355 | Bacteria | 1116 |
| 61 | Ga0070673_100346063 | 3300005364 | Bacteria | 1318 |
| 62 | Ga0070659_100085406 | 3300005366 | Bacteria | 2524 |
| 63 | Ga0070659_100092088 | 3300005366 | Bacteria | 2430 |
| 64 | Ga0070667_100307439 | 3300005367 | Bacteria | 1428 |
| 65 | Ga0070709_10061270 | 3300005434 | Bacteria | 2395 |
| 66 | Ga0070709_10202746 | 3300005434 | Bacteria | 1406 |
| 67 | Ga0070709_10613153 | 3300005434 | Bacteria | 839 |
| 68 | Ga0070711_100097760 | 3300005439 | Bacteria | 2129 |
| 69 | Ga0070708_100504604 | 3300005445 | Bacteria | 1141 |
| 70 | Ga0070663_100021396 | 3300005455 | Bacteria | 4302 |
| 71 | Ga0070663_100033313 | 3300005455 | Bacteria | 3558 |
| 72 | Ga0070678_100012656 | 3300005456 | Bacteria | 5257 |
| 73 | Ga0070678_100065671 | 3300005456 | Bacteria | 2695 |
| 74 | Ga0070678_100120486 | 3300005456 | Bacteria | 2068 |
| 75 | Ga0070662_100028679 | 3300005457 | Bacteria | 3875 |
| 76 | Ga0070681_10000012 | 3300005458 | Bacteria | 137191 |
| 77 | Ga0068867_100133985 | 3300005459 | Bacteria | 1929 |
| 78 | Ga0068867_100350436 | 3300005459 | Bacteria | 1232 |
| 79 | Ga0068867_100553248 | 3300005459 | Bacteria | 997 |
| 80 | Ga0070707_100520016 | 3300005468 | Bacteria | 1152 |
| 81 | Ga0070679_100287197 | 3300005530 | Bacteria | 1597 |
| 82 | Ga0070684_100132806 | 3300005535 | Bacteria | 2246 |
| 83 | Ga0070684_100168800 | 3300005535 | Bacteria | 1987 |
| 84 | Ga0068853_100002556 | 3300005539 | Bacteria | 13665 |
| 85 | Ga0068853_100035121 | 3300005539 | Bacteria | 4257 |
| 86 | Ga0068853_100044654 | 3300005539 | Bacteria | 3794 |
| 87 | Ga0068853_100057145 | 3300005539 | Bacteria | 3366 |
| 88 | Ga0068853_100088307 | 3300005539 | Bacteria | 2721 |
| 89 | Ga0070672_100194202 | 3300005543 | Bacteria | 1696 |
| 90 | Ga0070695_100286739 | 3300005545 | Bacteria | 1212 |
| 91 | Ga0070696_100160901 | 3300005546 | Bacteria | 1654 |
| 92 | Ga0070696_100168693 | 3300005546 | Bacteria | 1617 |
| 93 | Ga0070693_100014699 | 3300005547 | Bacteria | 4017 |
| 94 | Ga0070693_100042263 | 3300005547 | Bacteria | 2568 |
| 95 | Ga0070693_100053888 | 3300005547 | Bacteria | 2311 |
| 96 | Ga0070693_100081803 | 3300005547 | Bacteria | 1927 |
| 97 | Ga0070665_100008352 | 3300005548 | Bacteria | 10476 |
| 98 | Ga0070665_100024712 | 3300005548 | Bacteria | 6053 |
| 99 | Ga0070665_100052946 | 3300005548 | Bacteria | 4071 |
| 100 | Ga0070665_100122005 | 3300005548 | Bacteria | 2608 |
| 101 | Ga0070665_100218674 | 3300005548 | Bacteria | 1905 |
| 102 | Ga0070665_100329810 | 3300005548 | Bacteria | 1530 |
| 103 | Ga0070704_100162187 | 3300005549 | Bacteria | 1769 |
| 104 | Ga0070704_100513108 | 3300005549 | Bacteria | 1042 |
| 105 | Ga0068855_100023493 | 3300005563 | Bacteria | 7383 |
| 106 | Ga0068855_100026787 | 3300005563 | Bacteria | 6897 |
| 107 | Ga0068855_100050085 | 3300005563 | Bacteria | 4923 |
| 108 | Ga0068855_100189138 | 3300005563 | Bacteria | 2323 |
| 109 | Ga0068857_100111694 | 3300005577 | Bacteria | 2457 |
| 110 | Ga0068857_100398225 | 3300005577 | Bacteria | 1281 |
| 111 | Ga0068854_100025642 | 3300005578 | Bacteria | 4046 |
| 112 | Ga0068854_100062852 | 3300005578 | Bacteria | 2694 |
| 113 | Ga0068856_100027551 | 3300005614 | Bacteria | 5542 |
| 114 | Ga0068856_100109651 | 3300005614 | Bacteria | 2757 |
| 115 | Ga0068856_100445861 | 3300005614 | Bacteria | 1315 |
| 116 | Ga0068852_100028067 | 3300005616 | Bacteria | 4600 |
| 117 | Ga0068852_100028444 | 3300005616 | Bacteria | 4576 |
| 118 | Ga0068852_100106305 | 3300005616 | Bacteria | 2544 |
| 119 | Ga0068852_100243827 | 3300005616 | Bacteria | 1719 |
| 120 | Ga0068852_100297989 | 3300005616 | Bacteria | 1560 |
| 121 | Ga0068852_100493277 | 3300005616 | Bacteria | 1219 |
| 122 | Ga0068859_100008242 | 3300005617 | Bacteria | 10570 |
| 123 | Ga0068859_100285598 | 3300005617 | Bacteria | 1743 |
| 124 | Ga0068859_100747029 | 3300005617 | Bacteria | 1067 |
| 125 | Ga0068864_100897479 | 3300005618 | Bacteria | 875 |
| 126 | Ga0068866_10000607 | 3300005718 | Bacteria | 16367 |
| 127 | Ga0068861_100282702 | 3300005719 | Bacteria | 1429 |
| 128 | Ga0068851_10001171 | 3300005834 | Bacteria | 11377 |
| 129 | Ga0068870_10263246 | 3300005840 | Bacteria | 1074 |
| 130 | Ga0068863_100001454 | 3300005841 | Bacteria | 23498 |
| 131 | Ga0068863_100027859 | 3300005841 | Bacteria | 5393 |
| 132 | Ga0068863_100094369 | 3300005841 | Bacteria | 2839 |
| 133 | Ga0068858_100000536 | 3300005842 | Bacteria | 39539 |
| 134 | Ga0068858_100026329 | 3300005842 | Bacteria | 5405 |
| 135 | Ga0068860_100101399 | 3300005843 | Bacteria | 2746 |
| 136 | Ga0068862_100224242 | 3300005844 | Bacteria | 1703 |
| 137 | Ga0068862_100638289 | 3300005844 | Bacteria | 1026 |
| 138 | Ga0081540_1047353 | 3300005983 | Bacteria | 2163 |
| 139 | Ga0075364_10001177 | 3300006051 | Bacteria | 14015 |
| 140 | Ga0075364_10327832 | 3300006051 | Bacteria | 1043 |
| 141 | Ga0075369_10025543 | 3300006186 | Bacteria | 2457 |
| 142 | Ga0097621_100005955 | 3300006237 | Bacteria | 8621 |
| 143 | Ga0097621_100008756 | 3300006237 | Bacteria | 7310 |
| 144 | Ga0097621_100186509 | 3300006237 | Bacteria | 1794 |
| 145 | Ga0097621_100676139 | 3300006237 | Unclassified | 949 |
| 146 | Ga0075370_10109882 | 3300006353 | Bacteria | 1600 |
| 147 | Ga0068871_100056678 | 3300006358 | Bacteria | 3186 |
| 148 | Ga0068871_100253128 | 3300006358 | Bacteria | 1534 |
| 149 | Ga0068871_100822044 | 3300006358 | Bacteria | 857 |
| 150 | Ga0075428_100395255 | 3300006844 | Bacteria | 1482 |
| 151 | Ga0075428_101169852 | 3300006844 | Bacteria | 811 |
| 152 | Ga0068865_100003919 | 3300006881 | Bacteria | 8931 |
| 153 | Ga0075436_100114536 | 3300006914 | Bacteria | 1883 |
| 154 | Ga0097620_100008242 | 3300006931 | Bacteria | 10570 |
| 155 | Ga0097620_100285595 | 3300006931 | Bacteria | 1743 |
| 156 | Ga0097620_100746999 | 3300006931 | Bacteria | 1067 |
| 157 | Ga0105251_10000108 | 3300009011 | Bacteria | 81679 |
| 158 | Ga0105251_10006958 | 3300009011 | Bacteria | 7082 |
| 159 | Ga0105244_10034596 | 3300009036 | Bacteria | 2658 |
| 160 | Ga0105240_10019161 | 3300009093 | Bacteria | 9149 |
| 161 | Ga0105240_10021493 | 3300009093 | Bacteria | 8580 |
| 162 | Ga0105240_10207087 | 3300009093 | Bacteria | 2295 |
| 163 | Ga0105240_10301577 | 3300009093 | Bacteria | 1833 |
| 164 | Ga0105240_11297319 | 3300009093 | Bacteria | 768 |
| 165 | Ga0111539_10137303 | 3300009094 | Bacteria | 2863 |
| 166 | Ga0111539_10139798 | 3300009094 | Bacteria | 2835 |
| 167 | Ga0105245_10129285 | 3300009098 | Bacteria | 2367 |
| 168 | Ga0105245_10257448 | 3300009098 | Bacteria | 1697 |
| 169 | Ga0105247_10083347 | 3300009101 | Bacteria | 2019 |
| 170 | Ga0105243_10003658 | 3300009148 | Bacteria | 12371 |
| 171 | Ga0105243_10099579 | 3300009148 | Bacteria | 2409 |
| 172 | Ga0105241_10108872 | 3300009174 | Bacteria | 2215 |
| 173 | Ga0105241_10123844 | 3300009174 | Bacteria | 2085 |
| 174 | Ga0105241_10185844 | 3300009174 | Bacteria | 1727 |
| 175 | Ga0105241_10193083 | 3300009174 | Bacteria | 1696 |
| 176 | Ga0105241_10486851 | 3300009174 | Bacteria | 1097 |
| 177 | Ga0105242_10060546 | 3300009176 | Bacteria | 3111 |
| 178 | Ga0105242_10375978 | 3300009176 | Bacteria | 1319 |
| 179 | Ga0105242_10392253 | 3300009176 | Bacteria | 1293 |
| 180 | Ga0105248_10038118 | 3300009177 | Bacteria | 5378 |
| 181 | Ga0105248_10039461 | 3300009177 | Bacteria | 5288 |
| 182 | Ga0105248_10132191 | 3300009177 | Bacteria | 2816 |
| 183 | Ga0105237_10089736 | 3300009545 | Bacteria | 3063 |
| 184 | Ga0105237_10737769 | 3300009545 | Bacteria | 991 |
| 185 | Ga0105238_10006153 | 3300009551 | Bacteria | 11913 |
| 186 | Ga0105238_10132174 | 3300009551 | Unclassified | 2474 |
| 187 | Ga0105238_10326143 | 3300009551 | Bacteria | 1522 |
| 188 | Ga0105238_11103891 | 3300009551 | Bacteria | 816 |
| 189 | Ga0105249_10035359 | 3300009553 | Bacteria | 4531 |
| 190 | Ga0105249_10040632 | 3300009553 | Bacteria | 4225 |
| 191 | Ga0105249_10160398 | 3300009553 | Bacteria | 2173 |
| 192 | Ga0105249_11013869 | 3300009553 | Bacteria | 899 |
| 193 | Ga0105239_10005877 | 3300010375 | Bacteria | 14301 |
| 194 | Ga0105239_10073434 | 3300010375 | Bacteria | 3761 |
| 195 | Ga0105239_10104064 | 3300010375 | Bacteria | 3143 |
| 196 | Ga0105239_10178608 | 3300010375 | Bacteria | 2375 |
| 197 | Ga0105239_10205582 | 3300010375 | Bacteria | 2206 |
| 198 | Ga0105239_10275318 | 3300010375 | Bacteria | 1894 |
| 199 | Ga0105246_10004572 | 3300011119 | Bacteria | 8423 |
| 200 | Ga0157324_1006905 | 3300012506 | Bacteria | 870 |
| 201 | Ga0157373_10709621 | 3300013100 | Bacteria | 737 |
| 202 | Ga0157371_10003647 | 3300013102 | Bacteria | 13861 |
| 203 | Ga0157371_10014602 | 3300013102 | Bacteria | 5920 |
| 204 | Ga0157370_10015715 | 3300013104 | Bacteria | 7686 |
| 205 | Ga0157370_10124688 | 3300013104 | Bacteria | 2405 |
| 206 | Ga0157370_10301153 | 3300013104 | Bacteria | 1480 |
| 207 | Ga0157370_10530528 | 3300013104 | Bacteria | 1080 |
| 208 | Ga0157369_10187283 | 3300013105 | Bacteria | 2176 |
| 209 | Ga0157369_10195896 | 3300013105 | Bacteria | 2122 |
| 210 | Ga0157369_10685206 | 3300013105 | Bacteria | 1056 |
| 211 | Ga0157374_10042784 | 3300013296 | Bacteria | 4180 |
| 212 | Ga0157378_10084089 | 3300013297 | Bacteria | 2881 |
| 213 | Ga0157378_10959925 | 3300013297 | Bacteria | 888 |
| 214 | Ga0163162_10549912 | 3300013306 | Bacteria | 1283 |
| 215 | Ga0163162_10570994 | 3300013306 | Bacteria | 1258 |
| 216 | Ga0157372_10070485 | 3300013307 | Bacteria | 3933 |
| 217 | Ga0157372_10205339 | 3300013307 | Bacteria | 2283 |
| 218 | Ga0157372_10340649 | 3300013307 | Bacteria | 1746 |
| 219 | Ga0157372_10741110 | 3300013307 | Bacteria | 1143 |
| 220 | Ga0157375_10080866 | 3300013308 | Bacteria | 3288 |
| 221 | Ga0157375_10143675 | 3300013308 | Bacteria | 2515 |
| 222 | Ga0157375_11226699 | 3300013308 | Bacteria | 880 |
| 223 | Ga0163163_10002084 | 3300014325 | Bacteria | 16888 |
| 224 | Ga0163163_10695035 | 3300014325 | Bacteria | 1081 |
| 225 | Ga0157380_10008451 | 3300014326 | Bacteria | 7353 |
| 226 | Ga0157380_10379597 | 3300014326 | Bacteria | 1333 |
| 227 | Ga0182008_10001765 | 3300014497 | Bacteria | 14173 |
| 228 | Ga0182008_10002596 | 3300014497 | Bacteria | 11222 |
| 229 | Ga0182008_10011603 | 3300014497 | Bacteria | 4679 |
| 230 | Ga0157377_10024904 | 3300014745 | Bacteria | 3185 |
| 231 | Ga0157379_10057159 | 3300014968 | Bacteria | 3486 |
| 232 | Ga0157376_10000734 | 3300014969 | Bacteria | 21294 |
| 233 | Ga0157376_10006463 | 3300014969 | Bacteria | 8281 |
| 234 | Ga0182006_1023402 | 3300015261 | Bacteria | 2559 |
| 235 | Ga0182006_1040986 | 3300015261 | Bacteria | 1820 |
| 236 | Ga0182007_10000353 | 3300015262 | Bacteria | 29023 |
| 237 | Ga0182005_1000344 | 3300015265 | Bacteria | 26562 |
| 238 | Ga0182005_1008509 | 3300015265 | Bacteria | 3022 |
| 239 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 240 | Ga0163161_10002464 | 3300017792 | Bacteria | 13212 |
| 241 | Ga0163161_10173715 | 3300017792 | Bacteria | 1649 |
| 242 | Ga0163161_10516927 | 3300017792 | Bacteria | 974 |
| 243 | Ga0206350_10119238 | 3300020080 | Bacteria | 1247 |
| 244 | Ga0224712_10059437 | 3300022467 | Bacteria | 1518 |
| 245 | Ga0207425_1000078 | 3300025245 | Bacteria | 104429 |
| 246 | Ga0207425_1013633 | 3300025245 | Bacteria | 1871 |
| 247 | Ga0209129_1000157 | 3300025258 | Bacteria | 105043 |
| 248 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 249 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 250 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 251 | Ga0209673_1000087 | 3300025273 | Bacteria | 205213 |
| 252 | Ga0209673_1050296 | 3300025273 | Bacteria | 1108 |
| 253 | Ga0209130_1008523 | 3300025284 | Bacteria | 3019 |
| 254 | Ga0209130_1016302 | 3300025284 | Bacteria | 1802 |
| 255 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 256 | Ga0209675_1000060 | 3300025291 | Bacteria | 184316 |
| 257 | Ga0209675_1012289 | 3300025291 | Bacteria | 2771 |
| 258 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 259 | Ga0209676_1000114 | 3300025292 | Bacteria | 207416 |
| 260 | Ga0209676_1000976 | 3300025292 | Bacteria | 34430 |
| 261 | Ga0209676_1005140 | 3300025292 | Bacteria | 6962 |
| 262 | Ga0209676_1007576 | 3300025292 | Bacteria | 5053 |
| 263 | Ga0209676_1016951 | 3300025292 | Bacteria | 2601 |
| 264 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 265 | Ga0209025_1000034 | 3300025294 | Bacteria | 413205 |
| 266 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 267 | Ga0209025_1005818 | 3300025294 | Bacteria | 9879 |
| 268 | Ga0209025_1017520 | 3300025294 | Bacteria | 4126 |
| 269 | Ga0209025_1035642 | 3300025294 | Bacteria | 2244 |
| 270 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 271 | Ga0209564_1000302 | 3300025295 | Bacteria | 97770 |
| 272 | Ga0209564_1012031 | 3300025295 | Bacteria | 3813 |
| 273 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 274 | Ga0209758_1014433 | 3300025297 | Bacteria | 4202 |
| 275 | Ga0209758_1036125 | 3300025297 | Bacteria | 1935 |
| 276 | Ga0209758_1037028 | 3300025297 | Bacteria | 1893 |
| 277 | Ga0209050_1001760 | 3300025298 | Bacteria | 21464 |
| 278 | Ga0209050_1002154 | 3300025298 | Bacteria | 17919 |
| 279 | Ga0209050_1009716 | 3300025298 | Bacteria | 4873 |
| 280 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 281 | Ga0209256_1001644 | 3300025299 | Bacteria | 21742 |
| 282 | Ga0209256_1003341 | 3300025299 | Bacteria | 11380 |
| 283 | Ga0209256_1017426 | 3300025299 | Bacteria | 2384 |
| 284 | Ga0209051_1000606 | 3300025303 | Bacteria | 41704 |
| 285 | Ga0209051_1015286 | 3300025303 | Bacteria | 3538 |
| 286 | Ga0209051_1015560 | 3300025303 | Bacteria | 3492 |
| 287 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 288 | Ga0209257_1000080 | 3300025304 | Bacteria | 312038 |
| 289 | Ga0209257_1000369 | 3300025304 | Bacteria | 90982 |
| 290 | Ga0209257_1002588 | 3300025304 | Bacteria | 17583 |
| 291 | Ga0209257_1006360 | 3300025304 | Bacteria | 7662 |
| 292 | Ga0209257_1009732 | 3300025304 | Bacteria | 5052 |
| 293 | Ga0209257_1052746 | 3300025304 | Bacteria | 1141 |
| 294 | Ga0207656_10003911 | 3300025321 | Bacteria | 5161 |
| 295 | Ga0207656_10269159 | 3300025321 | Bacteria | 838 |
| 296 | Ga0207713_1000507 | 3300025735 | Bacteria | 39676 |
| 297 | Ga0207713_1007579 | 3300025735 | Bacteria | 6371 |
| 298 | Ga0207710_10030140 | 3300025900 | Bacteria | 2365 |
| 299 | Ga0207680_10014375 | 3300025903 | Bacteria | 4093 |
| 300 | Ga0207680_10057263 | 3300025903 | Bacteria | 2358 |
| 301 | Ga0207647_10000091 | 3300025904 | Bacteria | 68421 |
| 302 | Ga0207699_10313383 | 3300025906 | Bacteria | 1099 |
| 303 | Ga0207645_10038396 | 3300025907 | Bacteria | 3070 |
| 304 | Ga0207705_10043453 | 3300025909 | Bacteria | 3229 |
| 305 | Ga0207654_10152279 | 3300025911 | Bacteria | 1485 |
| 306 | Ga0207654_10160426 | 3300025911 | Bacteria | 1452 |
| 307 | Ga0207707_10000948 | 3300025912 | Bacteria | 27952 |
| 308 | Ga0207695_10036911 | 3300025913 | Bacteria | 5277 |
| 309 | Ga0207695_10046068 | 3300025913 | Bacteria | 4624 |
| 310 | Ga0207695_10106215 | 3300025913 | Bacteria | 2794 |
| 311 | Ga0207695_10115289 | 3300025913 | Bacteria | 2661 |
| 312 | Ga0207695_10599837 | 3300025913 | Bacteria | 982 |
| 313 | Ga0207671_10016712 | 3300025914 | Bacteria | 5695 |
| 314 | Ga0207671_10049438 | 3300025914 | Bacteria | 3113 |
| 315 | Ga0207671_10132651 | 3300025914 | Bacteria | 1913 |
| 316 | Ga0207671_10175045 | 3300025914 | Bacteria | 1668 |
| 317 | Ga0207671_10187152 | 3300025914 | Bacteria | 1613 |
| 318 | Ga0207663_10112070 | 3300025916 | Bacteria | 1852 |
| 319 | Ga0207663_10364568 | 3300025916 | Bacteria | 1097 |
| 320 | Ga0207660_10017505 | 3300025917 | Bacteria | 4762 |
| 321 | Ga0207649_10014919 | 3300025920 | Bacteria | 4359 |
| 322 | Ga0207649_10319698 | 3300025920 | Bacteria | 1140 |
| 323 | Ga0207681_10735096 | 3300025923 | Bacteria | 822 |
| 324 | Ga0207694_10005892 | 3300025924 | Bacteria | 9394 |
| 325 | Ga0207694_10014435 | 3300025924 | Bacteria | 5955 |
| 326 | Ga0207694_10244093 | 3300025924 | Bacteria | 1468 |
| 327 | Ga0207650_10005976 | 3300025925 | Bacteria | 8307 |
| 328 | Ga0207650_10044411 | 3300025925 | Bacteria | 3266 |
| 329 | Ga0207650_10240986 | 3300025925 | Bacteria | 1461 |
| 330 | Ga0207644_10190828 | 3300025931 | Bacteria | 1611 |
| 331 | Ga0207706_10005093 | 3300025933 | Bacteria | 12271 |
| 332 | Ga0207686_10065515 | 3300025934 | Bacteria | 2317 |
| 333 | Ga0207686_10332711 | 3300025934 | Bacteria | 1138 |
| 334 | Ga0207709_10004718 | 3300025935 | Bacteria | 7831 |
| 335 | Ga0207709_10004839 | 3300025935 | Bacteria | 7716 |
| 336 | Ga0207670_10149810 | 3300025936 | Bacteria | 1730 |
| 337 | Ga0207704_10040853 | 3300025938 | Bacteria | 2715 |
| 338 | Ga0207691_10013867 | 3300025940 | Bacteria | 7692 |
| 339 | Ga0207691_10023402 | 3300025940 | Bacteria | 5814 |
| 340 | Ga0207691_10032680 | 3300025940 | Bacteria | 4850 |
| 341 | Ga0207691_10066248 | 3300025940 | Bacteria | 3268 |
| 342 | Ga0207711_10348087 | 3300025941 | Bacteria | 1372 |
| 343 | Ga0207689_10007328 | 3300025942 | Bacteria | 9677 |
| 344 | Ga0207689_10255683 | 3300025942 | Bacteria | 1449 |
| 345 | Ga0207661_10029832 | 3300025944 | Bacteria | 4193 |
| 346 | Ga0207661_10146624 | 3300025944 | Bacteria | 2037 |
| 347 | Ga0207661_10405971 | 3300025944 | Bacteria | 1236 |
| 348 | Ga0207667_10001306 | 3300025949 | Bacteria | 31238 |
| 349 | Ga0207667_10002925 | 3300025949 | Bacteria | 21206 |
| 350 | Ga0207667_10017552 | 3300025949 | Bacteria | 8050 |
| 351 | Ga0207667_10139507 | 3300025949 | Bacteria | 2496 |
| 352 | Ga0207667_10179655 | 3300025949 | Bacteria | 2173 |
| 353 | Ga0207667_10413324 | 3300025949 | Bacteria | 1373 |
| 354 | Ga0207651_10154167 | 3300025960 | Bacteria | 1793 |
| 355 | Ga0207712_10000254 | 3300025961 | Bacteria | 51558 |
| 356 | Ga0207712_10016600 | 3300025961 | Bacteria | 4772 |
| 357 | Ga0207668_10014664 | 3300025972 | Bacteria | 4854 |
| 358 | Ga0207668_10020502 | 3300025972 | Bacteria | 4201 |
| 359 | Ga0207668_10169891 | 3300025972 | Bacteria | 1709 |
| 360 | Ga0207640_10017834 | 3300025981 | Bacteria | 4160 |
| 361 | Ga0207640_10045968 | 3300025981 | Bacteria | 2806 |
| 362 | Ga0207640_11038987 | 3300025981 | Bacteria | 722 |
| 363 | Ga0207658_10078539 | 3300025986 | Bacteria | 2522 |
| 364 | Ga0207658_10183606 | 3300025986 | Bacteria | 1733 |
| 365 | Ga0207703_10000925 | 3300026035 | Bacteria | 28593 |
| 366 | Ga0207703_10018256 | 3300026035 | Bacteria | 5477 |
| 367 | Ga0207703_10041366 | 3300026035 | Bacteria | 3692 |
| 368 | Ga0207703_10688500 | 3300026035 | Bacteria | 972 |
| 369 | Ga0207639_10000234 | 3300026041 | Bacteria | 41445 |
| 370 | Ga0207639_10000772 | 3300026041 | Bacteria | 21837 |
| 371 | Ga0207639_10016173 | 3300026041 | Bacteria | 5271 |
| 372 | Ga0207639_10040551 | 3300026041 | Bacteria | 3476 |
| 373 | Ga0207678_10020429 | 3300026067 | Bacteria | 5807 |
| 374 | Ga0207678_10068183 | 3300026067 | Bacteria | 3053 |
| 375 | Ga0207678_10237318 | 3300026067 | Bacteria | 1561 |
| 376 | Ga0207678_10250041 | 3300026067 | Bacteria | 1518 |
| 377 | Ga0207702_10015023 | 3300026078 | Bacteria | 6420 |
| 378 | Ga0207702_10109566 | 3300026078 | Bacteria | 2452 |
| 379 | Ga0207702_10138612 | 3300026078 | Bacteria | 2198 |
| 380 | Ga0207702_10252260 | 3300026078 | Bacteria | 1657 |
| 381 | Ga0207702_10502343 | 3300026078 | Bacteria | 1182 |
| 382 | Ga0207641_10021908 | 3300026088 | Bacteria | 5253 |
| 383 | Ga0207641_10049896 | 3300026088 | Bacteria | 3538 |
| 384 | Ga0207641_10658556 | 3300026088 | Bacteria | 1029 |
| 385 | Ga0207641_10898435 | 3300026088 | Bacteria | 879 |
| 386 | Ga0207648_10019234 | 3300026089 | Bacteria | 6164 |
| 387 | Ga0207648_10087675 | 3300026089 | Bacteria | 2716 |
| 388 | Ga0207676_10192170 | 3300026095 | Bacteria | 1797 |
| 389 | Ga0207674_10422446 | 3300026116 | Bacteria | 1288 |
| 390 | Ga0207675_100006718 | 3300026118 | Bacteria | 10877 |
| 391 | Ga0207675_100073715 | 3300026118 | Bacteria | 3194 |
| 392 | Ga0207683_10003087 | 3300026121 | Bacteria | 14551 |
| 393 | Ga0207683_10030154 | 3300026121 | Bacteria | 4698 |
| 394 | Ga0207683_10178672 | 3300026121 | Bacteria | 1924 |
| 395 | Ga0207683_10202414 | 3300026121 | Bacteria | 1805 |
| 396 | Ga0207683_10282421 | 3300026121 | Bacteria | 1517 |
| 397 | Ga0207698_10069321 | 3300026142 | Bacteria | 2788 |
| 398 | Ga0207698_10098523 | 3300026142 | Bacteria | 2416 |
| 399 | Ga0207698_10116399 | 3300026142 | Bacteria | 2253 |
| 400 | Ga0207698_10863400 | 3300026142 | Bacteria | 910 |
| 401 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 402 | Ga0209371_1000059 | 3300027312 | Bacteria | 237154 |
| 403 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 404 | Ga0268266_10021365 | 3300028379 | Bacteria | 5514 |
| 405 | Ga0268266_10294979 | 3300028379 | Bacteria | 1511 |
| 406 | Ga0268265_10002801 | 3300028380 | Bacteria | 12848 |
| 407 | Ga0268265_10263336 | 3300028380 | Bacteria | 1534 |
| 408 | Ga0268264_10009178 | 3300028381 | Bacteria | 8194 |
| 409 | Ga0268264_10133032 | 3300028381 | Bacteria | 2208 |
| 410 | Ga0268264_10157462 | 3300028381 | Bacteria | 2043 |
| 411 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 412 | Ga0268256_1000055 | 3300030500 | Bacteria | 237299 |
| 413 | Ga0307511_10000003 | 3300030521 | Bacteria | 193269 |
| 414 | Ga0316176_1153914 | 3300030732 | Bacteria | 1789 |
| 415 | Ga0314311_1040974 | 3300030733 | Bacteria | 4728 |
| 416 | Ga0316183_1068246 | 3300030742 | Bacteria | 2858 |
| 417 | Ga0316181_1203139 | 3300030744 | Bacteria | 842 |
| 418 | Ga0265339_10104538 | 3300031249 | Bacteria | 1471 |
| 419 | Ga0265316_10499455 | 3300031344 | Unclassified | 869 |
| 420 | Ga0307509_10277799 | 3300031507 | Bacteria | 1438 |
| 421 | Ga0307408_100002840 | 3300031548 | Bacteria | 12016 |
| 422 | Ga0307408_100254352 | 3300031548 | Bacteria | 1450 |
| 423 | Ga0265314_10018124 | 3300031711 | Bacteria | 5501 |
| 424 | Ga0316576_10042200 | 3300031727 | Bacteria | 3287 |
| 425 | Ga0316578_10098995 | 3300031728 | Bacteria | 1747 |
| 426 | Ga0316577_10053334 | 3300031733 | Bacteria | 2257 |
| 427 | Ga0307413_10122562 | 3300031824 | Bacteria | 1764 |
| 428 | Ga0307413_10264385 | 3300031824 | Bacteria | 1284 |
| 429 | Ga0307410_10279501 | 3300031852 | Bacteria | 1309 |
| 430 | Ga0307406_10090306 | 3300031901 | Bacteria | 2061 |
| 431 | Ga0307406_10232961 | 3300031901 | Bacteria | 1376 |
| 432 | Ga0307407_10152782 | 3300031903 | Bacteria | 1502 |
| 433 | Ga0307407_10218511 | 3300031903 | Bacteria | 1287 |
| 434 | Ga0307412_10209788 | 3300031911 | Bacteria | 1485 |
| 435 | Ga0307412_10617837 | 3300031911 | Bacteria | 920 |
| 436 | Ga0307409_100903467 | 3300031995 | Bacteria | 897 |
| 437 | Ga0307416_100529727 | 3300032002 | Bacteria | 1248 |
| 438 | Ga0307414_10163842 | 3300032004 | Bacteria | 1769 |
| 439 | Ga0307414_10280672 | 3300032004 | Bacteria | 1399 |
| 440 | Ga0307411_10037108 | 3300032005 | Bacteria | 3060 |
| 441 | Ga0307411_10125552 | 3300032005 | Bacteria | 1865 |
| 442 | Ga0307411_10155936 | 3300032005 | Bacteria | 1703 |
| 443 | Ga0307411_10254234 | 3300032005 | Bacteria | 1383 |
| 444 | Ga0307415_100812735 | 3300032126 | Bacteria | 854 |
| 445 | Ga0316585_10031830 | 3300032137 | Bacteria | 1660 |
| 446 | Ga0307507_10135851 | 3300033179 | Bacteria | 1905 |
| 447 | Ga0307507_10183106 | 3300033179 | Bacteria | 1492 |
| 448 | Ga0307507_10238405 | 3300033179 | Bacteria | 1194 |
| 449 | Ga0373931_0088187 | 3300035691 | Bacteria | 1724 |
| 450 | Ga0373937_0341636 | 3300036401 | Bacteria | 1418 |
| 451 | Ga0316582_0001391 | 3300036647 | Bacteria | 10547 |
| 452 | Ga0316582_0307274 | 3300036647 | Bacteria | 1090 |
| 453 | Ga0316584_0001928 | 3300036712 | Bacteria | 12921 |
| 454 | Ga0395899_0021657 | 3300037312 | Bacteria | 4874 |
| 455 | Ga0395900_0016564 | 3300037418 | Bacteria | 7520 |
| 456 | Ga0395898_0108711 | 3300037466 | Bacteria | 2659 |
| 457 | Ga0395905_0000577 | 3300037471 | Bacteria | 49489 |
| 458 | Ga0395905_0155418 | 3300037471 | Bacteria | 2151 |
| 459 | Ga0395905_0185824 | 3300037471 | Bacteria | 1950 |
| 460 | Ga0316581_0000607 | 3300037588 | Bacteria | 7100 |
| 461 | Ga0436364_0752000 | 3300037853 | Bacteria | 7022 |
| 462 | Ga0237819_00252 | 3300038705 | Bacteria | 19595 |
| 463 | Ga0237819_04805 | 3300038705 | Bacteria | 2178 |
| 464 | Ga0237819_08451 | 3300038705 | Bacteria | 1424 |
| 465 | Ga0439436_0009189 | 3300041404 | Bacteria | 3032 |
| 466 | Ga0439436_0009600 | 3300041404 | Bacteria | 2968 |
| 467 | Ga0439439_0086282 | 3300041406 | Bacteria | 853 |
| 468 | Ga0439447_001882 | 3300041407 | Bacteria | 7675 |
| 469 | Ga0439465_0009303 | 3300041413 | Bacteria | 3095 |
| 470 | Ga0451800_0056998 | 3300041459 | Bacteria | 1435 |
| 471 | Ga0451806_353890 | 3300041462 | Bacteria | 796 |
| 472 | Ga0451807_0568998 | 3300041486 | Bacteria | 2052 |
| 473 | Ga0451807_2639821 | 3300041486 | Bacteria | 2105 |
| 474 | Ga0451837_1006580 | 3300041494 | Bacteria | 3664 |
| 475 | Ga0451837_1499872 | 3300041494 | Bacteria | 1544 |
| 476 | Ga0451843_1634350 | 3300041509 | Bacteria | 3214 |
| 477 | Ga0451853_3632959 | 3300041512 | Bacteria | 1600 |
| 478 | Ga0451853_3672467 | 3300041512 | Bacteria | 766 |
| 479 | Ga0439433_0038905 | 3300041999 | Bacteria | 1104 |
| 480 | Ga0439432_004313 | 3300042006 | Bacteria | 5201 |
| 481 | Ga0439432_030073 | 3300042006 | Bacteria | 1763 |
| 482 | Ga0439449_0004776 | 3300042007 | Bacteria | 5230 |
| 483 | Ga0439449_0013127 | 3300042007 | Bacteria | 3116 |
| 484 | Ga0439449_0015192 | 3300042007 | Bacteria | 2892 |
| 485 | Ga0439449_0119892 | 3300042007 | Bacteria | 976 |
| 486 | Ga0439462_0010907 | 3300042015 | Bacteria | 2308 |
| 487 | Ga0439434_0052358 | 3300042435 | Bacteria | 1267 |
| 488 | Ga0451577_0002034 | 3300042876 | Bacteria | 25030 |
| 489 | Ga0451577_0008871 | 3300042876 | Bacteria | 9733 |
| 490 | Ga0451577_0030380 | 3300042876 | Bacteria | 4883 |
| 491 | Ga0466969_0035455 | 3300044656 | Bacteria | 2523 |
| 492 | Ga0466972_0016307 | 3300044658 | Bacteria | 3713 |
| 493 | Ga0466977_0005295 | 3300044666 | Bacteria | 6687 |
| 494 | Ga0453683_0450766 | 3300044673 | Bacteria | 832 |
| 495 | Ga0466970_0007619 | 3300044765 | Bacteria | 5427 |
| 496 | Ga0451576_0166976 | 3300045051 | Bacteria | 2297 |
| 497 | Ga0495603_0023973 | 3300046455 | Bacteria | 3691 |
| 498 | Ga0495638_0010655 | 3300046460 | Bacteria | 6367 |
| 499 | Ga0495638_0104326 | 3300046460 | Bacteria | 1691 |
| 500 | Ga0495618_0384332 | 3300046514 | Bacteria | 861 |
| 501 | Ga0495643_0003481 | 3300046522 | Bacteria | 11485 |
| 502 | Ga0495643_0063033 | 3300046522 | Bacteria | 1961 |
| 503 | Ga0495644_0034682 | 3300046523 | Bacteria | 1905 |
| 504 | Ga0495621_0007405 | 3300046539 | Bacteria | 3249 |
| 505 | Ga0495633_0022960 | 3300046558 | Bacteria | 3094 |
| 506 | Ga0495656_0003220 | 3300046615 | Bacteria | 5505 |
| 507 | Ga0495656_0029624 | 3300046615 | Bacteria | 2205 |
| 508 | Ga0495656_0120780 | 3300046615 | Bacteria | 1236 |
| 509 | Ga0495668_0001767 | 3300046616 | Bacteria | 19788 |
| 510 | Ga0495625_0095761 | 3300046660 | Bacteria | 2045 |
| 511 | Ga0495659_0053577 | 3300046664 | Bacteria | 1474 |
| 512 | Ga0495657_0440063 | 3300046675 | Bacteria | 764 |
| 513 | Ga0495670_0146339 | 3300046691 | Bacteria | 1238 |
| 514 | Ga0495649_0185215 | 3300046694 | Bacteria | 1085 |
| 515 | Ga0495636_0000522 | 3300047318 | Bacteria | 14147 |
| 516 | Ga0495636_0026155 | 3300047318 | Bacteria | 2372 |
| 517 | Ga0495672_0000455 | 3300047320 | Bacteria | 48439 |
| 518 | Ga0495672_0193773 | 3300047320 | Bacteria | 1020 |
| 519 | Ga0495686_0034339 | 3300047472 | Bacteria | 3267 |
| 520 | Ga0495602_0227825 | 3300048088 | Bacteria | 1402 |
| 521 | Ga0496100_0220480 | 3300048903 | Bacteria | 1392 |
| 522 | Ga0496104_0283679 | 3300048907 | Bacteria | 1569 |
| 523 | Ga0496105_0139808 | 3300048908 | Bacteria | 1993 |
| 524 | Ga0496108_0084460 | 3300048911 | Bacteria | 2694 |
| 525 | Ga0496116_0088184 | 3300048919 | Bacteria | 1896 |
| 526 | Ga0496117_0005879 | 3300048920 | Bacteria | 12682 |
| 527 | Ga0496117_0006203 | 3300048920 | Bacteria | 12192 |
| 528 | Ga0496117_0009735 | 3300048920 | Bacteria | 8868 |
| 529 | Ga0496117_0186420 | 3300048920 | Bacteria | 1186 |
| 530 | Ga0496118_0000362 | 3300048921 | Bacteria | 76786 |
| 531 | Ga0496118_0001608 | 3300048921 | Bacteria | 33395 |
| 532 | Ga0496118_0006389 | 3300048921 | Bacteria | 12979 |
| 533 | Ga0496118_0109391 | 3300048921 | Bacteria | 1839 |
| 534 | Ga0496119_0000851 | 3300048922 | Bacteria | 40261 |
| 535 | Ga0496119_0006339 | 3300048922 | Bacteria | 11010 |
| 536 | Ga0496119_0038877 | 3300048922 | Bacteria | 3066 |
| 537 | Ga0496120_0001387 | 3300048923 | Bacteria | 29403 |
| 538 | Ga0496120_0002462 | 3300048923 | Bacteria | 18657 |
| 539 | Ga0496120_0062248 | 3300048923 | Bacteria | 2079 |
| 540 | Ga0496121_0000755 | 3300048924 | Bacteria | 59452 |
| 541 | Ga0496121_0054362 | 3300048924 | Bacteria | 3346 |
| 542 | Ga0496122_0003014 | 3300048925 | Bacteria | 22846 |
| 543 | Ga0496122_0003143 | 3300048925 | Bacteria | 22097 |
| 544 | Ga0496122_0027624 | 3300048925 | Bacteria | 4843 |
| 545 | Ga0496122_0035854 | 3300048925 | Bacteria | 4025 |
| 546 | Ga0496122_0093335 | 3300048925 | Bacteria | 2042 |
| 547 | Ga0496123_0000619 | 3300048926 | Bacteria | 59624 |
| 548 | Ga0496123_0000624 | 3300048926 | Bacteria | 59382 |
| 549 | Ga0496123_0050826 | 3300048926 | Bacteria | 2766 |
| 550 | Ga0496123_0092211 | 3300048926 | Bacteria | 1793 |
| 551 | Ga0496124_0008706 | 3300048927 | Bacteria | 10546 |
| 552 | Ga0496124_0009017 | 3300048927 | Bacteria | 10320 |
| 553 | Ga0496124_0015807 | 3300048927 | Bacteria | 7211 |
| 554 | Ga0496124_0030624 | 3300048927 | Bacteria | 4773 |
| 555 | Ga0496124_0058441 | 3300048927 | Bacteria | 3243 |
| 556 | Ga0496124_0264456 | 3300048927 | Bacteria | 1263 |
| 557 | Ga0496124_0306334 | 3300048927 | Bacteria | 1144 |
| 558 | Ga0496124_0307127 | 3300048927 | Bacteria | 1143 |
| 559 | Ga0496125_0008250 | 3300048928 | Bacteria | 10940 |
| 560 | Ga0496125_0059747 | 3300048928 | Bacteria | 3068 |
| 561 | Ga0496125_0065237 | 3300048928 | Bacteria | 2886 |
| 562 | Ga0496125_0102563 | 3300048928 | Bacteria | 2102 |
| 563 | Ga0496125_0105881 | 3300048928 | Bacteria | 2054 |
| 564 | Ga0496125_0233973 | 3300048928 | Bacteria | 1172 |
| 565 | Ga0496126_0023054 | 3300048929 | Bacteria | 6035 |
| 566 | Ga0496126_0110602 | 3300048929 | Bacteria | 2393 |
| 567 | Ga0496126_0197160 | 3300048929 | Bacteria | 1702 |
| 568 | Ga0501031_0005651 | 3300049568 | Bacteria | 8147 |
| 569 | Ga0501031_0055663 | 3300049568 | Bacteria | 2577 |
| 570 | Ga0501032_0002312 | 3300049569 | Bacteria | 14953 |
| 571 | Ga0501032_0160109 | 3300049569 | Bacteria | 1478 |
| 572 | Ga0501033_0005030 | 3300049570 | Bacteria | 10525 |
| 573 | Ga0501033_0079198 | 3300049570 | Bacteria | 2411 |
| 574 | Ga0501034_0008806 | 3300049571 | Bacteria | 10620 |
| 575 | Ga0501034_0018896 | 3300049571 | Bacteria | 7060 |
| 576 | Ga0501034_0136878 | 3300049571 | Bacteria | 2430 |
| 577 | Ga0501034_0184183 | 3300049571 | Bacteria | 2052 |
| 578 | Ga0501036_0091661 | 3300049572 | Bacteria | 2567 |
| 579 | Ga0501037_0001246 | 3300049573 | Bacteria | 18764 |
| 580 | Ga0501037_0545376 | 3300049573 | Bacteria | 783 |
| 581 | Ga0501038_0001377 | 3300049574 | Bacteria | 22209 |
| 582 | Ga0501038_0013359 | 3300049574 | Bacteria | 7487 |
| 583 | Ga0501038_0159496 | 3300049574 | Bacteria | 1834 |
| 584 | Ga0501038_0531520 | 3300049574 | Bacteria | 896 |
| 585 | Ga0501039_0003424 | 3300049575 | Bacteria | 11840 |
| 586 | Ga0501039_0012931 | 3300049575 | Bacteria | 6382 |
| 587 | Ga0501040_0005666 | 3300049576 | Bacteria | 8072 |
| 588 | Ga0501042_0038328 | 3300049578 | Bacteria | 3405 |
| 589 | Ga0501042_0428833 | 3300049578 | Bacteria | 958 |
| 590 | Ga0501043_0005996 | 3300049579 | Bacteria | 9768 |
| 591 | Ga0501043_0157290 | 3300049579 | Bacteria | 1777 |
| 592 | Ga0501046_0006111 | 3300049580 | Bacteria | 10705 |
| 593 | Ga0501046_0026272 | 3300049580 | Bacteria | 4755 |
| 594 | Ga0501046_0038896 | 3300049580 | Bacteria | 3815 |
| 595 | Ga0501047_0009516 | 3300049581 | Bacteria | 9183 |
| 596 | Ga0501047_0121320 | 3300049581 | Bacteria | 2496 |
| 597 | Ga0501047_0136853 | 3300049581 | Bacteria | 2330 |
| 598 | Ga0501047_0167768 | 3300049581 | Bacteria | 2065 |
| 599 | Ga0501048_0054480 | 3300049582 | Bacteria | 2841 |
| 600 | Ga0501067_0162401 | 3300049583 | Bacteria | 1244 |
| 601 | Ga0501068_0069669 | 3300049584 | Bacteria | 2145 |
| 602 | Ga0501070_0153088 | 3300049586 | Bacteria | 1902 |
| 603 | Ga0501071_0005629 | 3300049587 | Bacteria | 8076 |
| 604 | Ga0501071_0125343 | 3300049587 | Bacteria | 1906 |
| 605 | Ga0501072_0010759 | 3300049588 | Bacteria | 6972 |
| 606 | Ga0501073_0024001 | 3300049589 | Bacteria | 4379 |
| 607 | Ga0501073_0126285 | 3300049589 | Bacteria | 1773 |
| 608 | Ga0501073_0272644 | 3300049589 | Bacteria | 1167 |
| 609 | Ga0501073_0299458 | 3300049589 | Bacteria | 1109 |
| 610 | Ga0501075_0000416 | 3300049591 | Bacteria | 24892 |
| 611 | Ga0501076_0003140 | 3300049592 | Bacteria | 11517 |
| 612 | Ga0501077_0024700 | 3300049593 | Bacteria | 3816 |
| 613 | Ga0501202_038795 | 3300049652 | Bacteria | 1022 |
| 614 | Ga0501207_032009 | 3300049654 | Bacteria | 887 |
| 615 | Ga0501209_000193 | 3300049656 | Bacteria | 7067 |
| 616 | Ga0501223_048880 | 3300049663 | Bacteria | 821 |
| 617 | Ga0501250_002719 | 3300049680 | Bacteria | 1627 |
| 618 | Ga0501250_011568 | 3300049680 | Bacteria | 1030 |
| 619 | Ga0501257_030626 | 3300049686 | Bacteria | 1296 |
| 620 | Ga0501079_0015199 | 3300049741 | Bacteria | 5870 |
| 621 | Ga0501079_0441093 | 3300049741 | Bacteria | 1022 |
| 622 | Ga0501079_0528987 | 3300049741 | Bacteria | 927 |
| 623 | Ga0501080_0066584 | 3300049742 | Bacteria | 3350 |
| 624 | Ga0501080_0080105 | 3300049742 | Bacteria | 3036 |
| 625 | Ga0501080_0108531 | 3300049742 | Bacteria | 2572 |
| 626 | Ga0501081_0001594 | 3300049743 | Bacteria | 13990 |
| 627 | Ga0501083_0176445 | 3300049744 | Bacteria | 1396 |
| 628 | Ga0501270_037842 | 3300049767 | Bacteria | 827 |
| 629 | Ga0501035_0005822 | 3300049822 | Bacteria | 11622 |
| 630 | Ga0501035_0147024 | 3300049822 | Bacteria | 2046 |
| 631 | Ga0501035_0377702 | 3300049822 | Bacteria | 1182 |
| 632 | Ga0501044_0008551 | 3300049823 | Bacteria | 11218 |
| 633 | Ga0501044_0011072 | 3300049823 | Bacteria | 9782 |
| 634 | Ga0501044_0108969 | 3300049823 | Bacteria | 2779 |
| 635 | Ga0501044_0272421 | 3300049823 | Bacteria | 1628 |
| 636 | Ga0501044_0402384 | 3300049823 | Bacteria | 1281 |
| 637 | Ga0501045_0000120 | 3300049824 | Bacteria | 40494 |
| 638 | nmdc:mga0k408_83794_c1 | 3300050493 | Bacteria | 1870 |
| 639 | nmdc:mga04h51_59713_c1 | 3300050495 | Bacteria | 1304 |
| 640 | nmdc:mga07m45_102654_c1 | 3300050496 | Bacteria | 1643 |
| 641 | nmdc:mga0qj67_64880_c1 | 3300050509 | Bacteria | 2906 |
| 642 | nmdc:mga0sz30_50814_c1 | 3300050516 | Bacteria | 1758 |
| 643 | Ga0500644_0082120 | 3300053088 | Bacteria | 1187 |
| 644 | Ga0500646_0001514 | 3300053090 | Bacteria | 6121 |
| 645 | Ga0500651_0006850 | 3300053093 | Bacteria | 6604 |
| 646 | Ga0500594_0058209 | 3300053118 | Bacteria | 1107 |
| 647 | Ga0500559_0146526 | 3300053136 | Bacteria | 1107 |
| 648 | Ga0500604_0016262 | 3300053151 | Bacteria | 2047 |
| 649 | Ga0500616_0147228 | 3300053153 | Bacteria | 1094 |
| 650 | Ga0500634_0000095 | 3300053161 | Bacteria | 34310 |
| 651 | Ga0500638_121744 | 3300053162 | Bacteria | 1193 |
| 652 | Ga0501084_0000861 | 3300054114 | Bacteria | 23412 |
| 653 | Ga0501084_0087040 | 3300054114 | Bacteria | 2623 |
| 654 | Ga0501084_0335618 | 3300054114 | Bacteria | 1277 |
| 655 | Ga0501084_0675220 | 3300054114 | Bacteria | 872 |
| 656 | Ga0501082_0000082 | 3300060353 | Bacteria | 71065 |
| 657 | Ga0501082_0020433 | 3300060353 | Bacteria | 5709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100189138 | Ga0068855_1001891383 | 194 |
| 2 | 3300025924 | Ga0207694_10244093 | Ga0207694_102440933 | 194 |
| 3 | 3300025944 | Ga0207661_10405971 | Ga0207661_104059712 | 194 |
| 4 | 3300025949 | Ga0207667_10179655 | Ga0207667_101796552 | 194 |
| 5 | 3300005719 | Ga0068861_100282702 | Ga0068861_1002827022 | 199 |
| 6 | 3300026118 | Ga0207675_100073715 | Ga0207675_1000737152 | 199 |
| 7 | 3300026142 | Ga0207698_10098523 | Ga0207698_100985232 | 199 |
| 8 | 3300005329 | Ga0070683_100046821 | Ga0070683_1000468212 | 200 |
| 9 | 3300005339 | Ga0070660_100013111 | Ga0070660_1000131112 | 200 |
| 10 | 3300005344 | Ga0070661_100004441 | Ga0070661_1000044419 | 200 |
| 11 | 3300005366 | Ga0070659_100092088 | Ga0070659_1000920882 | 200 |
| 12 | 3300005535 | Ga0070684_100132806 | Ga0070684_1001328062 | 200 |
| 13 | 3300005539 | Ga0068853_100044654 | Ga0068853_1000446543 | 200 |
| 14 | 3300005547 | Ga0070693_100042263 | Ga0070693_1000422632 | 200 |
| 15 | 3300005578 | Ga0068854_100062852 | Ga0068854_1000628523 | 200 |
| 16 | 3300005614 | Ga0068856_100027551 | Ga0068856_1000275512 | 200 |
| 17 | 3300005616 | Ga0068852_100028444 | Ga0068852_1000284445 | 200 |
| 18 | 3300013307 | Ga0157372_10340649 | Ga0157372_103406493 | 200 |
| 19 | 3300025909 | Ga0207705_10043453 | Ga0207705_100434532 | 200 |
| 20 | 3300025920 | Ga0207649_10014919 | Ga0207649_100149193 | 200 |
| 21 | 3300025944 | Ga0207661_10029832 | Ga0207661_100298324 | 200 |
| 22 | 3300025981 | Ga0207640_10045968 | Ga0207640_100459683 | 200 |
| 23 | 3300026078 | Ga0207702_10015023 | Ga0207702_100150233 | 200 |
| 24 | 3300031727 | Ga0316576_10042200 | Ga0316576_100422002 | 200 |
| 25 | 3300036647 | Ga0316582_0307274 | Ga0316582_0307274_379_984 | 200 |
| 26 | 3300049571 | Ga0501034_0184183 | Ga0501034_0184183_1032_1688 | 200 |
| 27 | 3300049573 | Ga0501037_0545376 | Ga0501037_0545376_34_690 | 200 |
| 28 | 3300049579 | Ga0501043_0157290 | Ga0501043_0157290_545_1201 | 200 |
| 29 | 3300049580 | Ga0501046_0026272 | Ga0501046_0026272_571_1227 | 200 |
| 30 | 3300049581 | Ga0501047_0167768 | Ga0501047_0167768_92_748 | 200 |
| 31 | 3300049586 | Ga0501070_0153088 | Ga0501070_0153088_640_1296 | 200 |
| 32 | 3300049589 | Ga0501073_0272644 | Ga0501073_0272644_165_821 | 200 |
| 33 | 3300049741 | Ga0501079_0528987 | Ga0501079_0528987_236_892 | 200 |
| 34 | 3300049742 | Ga0501080_0108531 | Ga0501080_0108531_367_1023 | 200 |
| 35 | 3300049744 | Ga0501083_0176445 | Ga0501083_0176445_420_1076 | 200 |
| 36 | 3300049822 | Ga0501035_0147024 | Ga0501035_0147024_596_1252 | 200 |
| 37 | 3300049823 | Ga0501044_0402384 | Ga0501044_0402384_320_976 | 200 |
| 38 | 3300054114 | Ga0501084_0087040 | Ga0501084_0087040_417_1073 | 200 |
| 39 | 3300060353 | Ga0501082_0000082 | Ga0501082_0000082_31573_32229 | 200 |
| 40 | 3300005330 | Ga0070690_100359015 | Ga0070690_1003590151 | 202 |
| 41 | 3300005455 | Ga0070663_100033313 | Ga0070663_1000333133 | 202 |
| 42 | 3300025940 | Ga0207691_10023402 | Ga0207691_100234022 | 202 |
| 43 | 3300026035 | Ga0207703_10018256 | Ga0207703_100182562 | 202 |
| 44 | 3300026067 | Ga0207678_10068183 | Ga0207678_100681833 | 202 |
| 45 | 3300026142 | Ga0207698_10116399 | Ga0207698_101163992 | 202 |
| 46 | 3300049574 | Ga0501038_0159496 | Ga0501038_0159496_473_1129 | 202 |
| 47 | 3300049578 | Ga0501042_0428833 | Ga0501042_0428833_73_681 | 202 |
| 48 | 3300049742 | Ga0501080_0066584 | Ga0501080_0066584_789_1445 | 202 |
| 49 | 3300049823 | Ga0501044_0272421 | Ga0501044_0272421_777_1433 | 202 |
| 50 | 3300005329 | Ga0070683_100286536 | Ga0070683_1002865363 | 204 |
| 51 | 3300005338 | Ga0068868_100199320 | Ga0068868_1001993201 | 204 |
| 52 | 3300005366 | Ga0070659_100085406 | Ga0070659_1000854062 | 204 |
| 53 | 3300005459 | Ga0068867_100350436 | Ga0068867_1003504361 | 204 |
| 54 | 3300005535 | Ga0070684_100168800 | Ga0070684_1001688002 | 204 |
| 55 | 3300005549 | Ga0070704_100162187 | Ga0070704_1001621872 | 204 |
| 56 | 3300005840 | Ga0068870_10263246 | Ga0068870_102632462 | 204 |
| 57 | 3300006881 | Ga0068865_100003919 | Ga0068865_1000039192 | 204 |
| 58 | 3300009098 | Ga0105245_10129285 | Ga0105245_101292853 | 204 |
| 59 | 3300009148 | Ga0105243_10003658 | Ga0105243_100036586 | 204 |
| 60 | 3300009177 | Ga0105248_10132191 | Ga0105248_101321914 | 204 |
| 61 | 3300009551 | Ga0105238_11103891 | Ga0105238_111038911 | 204 |
| 62 | 3300011119 | Ga0105246_10004572 | Ga0105246_100045724 | 204 |
| 63 | 3300013297 | Ga0157378_10959925 | Ga0157378_109599251 | 204 |
| 64 | 3300013306 | Ga0163162_10549912 | Ga0163162_105499122 | 204 |
| 65 | 3300014325 | Ga0163163_10695035 | Ga0163163_106950352 | 204 |
| 66 | 3300014326 | Ga0157380_10008451 | Ga0157380_100084517 | 204 |
| 67 | 3300014745 | Ga0157377_10024904 | Ga0157377_100249044 | 204 |
| 68 | 3300025940 | Ga0207691_10066248 | Ga0207691_100662483 | 204 |
| 69 | 3300026121 | Ga0207683_10030154 | Ga0207683_100301545 | 204 |
| 70 | 3300046455 | Ga0495603_0023973 | Ga0495603_0023973_2929_3543 | 204 |
| 71 | 3300046523 | Ga0495644_0034682 | Ga0495644_0034682_678_1292 | 204 |
| 72 | 3300046615 | Ga0495656_0029624 | Ga0495656_0029624_257_871 | 204 |
| 73 | 3300048903 | Ga0496100_0220480 | Ga0496100_0220480_288_902 | 204 |
| 74 | 3300048907 | Ga0496104_0283679 | Ga0496104_0283679_344_958 | 204 |
| 75 | 3300048911 | Ga0496108_0084460 | Ga0496108_0084460_667_1281 | 204 |
| 76 | iso_pu_bacteria | 2738541276 | 2738716239 | 204 |
| 77 | 3300005543 | Ga0070672_100194202 | Ga0070672_1001942021 | 207 |
| 78 | 3300005983 | Ga0081540_1047353 | Ga0081540_10473532 | 207 |
| 79 | 3300025916 | Ga0207663_10364568 | Ga0207663_103645682 | 207 |
| 80 | 3300026035 | Ga0207703_10688500 | Ga0207703_106885002 | 207 |
| 81 | 3300035691 | Ga0373931_0088187 | Ga0373931_0088187_604_1227 | 207 |
| 82 | 3300031548 | Ga0307408_100002840 | Ga0307408_1000028404 | 208 |
| 83 | 3300031711 | Ga0265314_10018124 | Ga0265314_100181243 | 208 |
| 84 | 3300031728 | Ga0316578_10098995 | Ga0316578_100989951 | 208 |
| 85 | 3300031733 | Ga0316577_10053334 | Ga0316577_100533341 | 208 |
| 86 | 3300031901 | Ga0307406_10090306 | Ga0307406_100903062 | 208 |
| 87 | 3300032137 | Ga0316585_10031830 | Ga0316585_100318302 | 208 |
| 88 | 3300036647 | Ga0316582_0001391 | Ga0316582_0001391_2406_3035 | 208 |
| 89 | 3300036712 | Ga0316584_0001928 | Ga0316584_0001928_11758_12387 | 208 |
| 90 | 3300037588 | Ga0316581_0000607 | Ga0316581_0000607_3825_4454 | 208 |
| 91 | 3300025294 | Ga0209025_1035642 | Ga0209025_10356422 | 209 |
| 92 | 3300005329 | Ga0070683_100304324 | Ga0070683_1003043242 | 210 |
| 93 | 3300005329 | Ga0070683_100838805 | Ga0070683_1008388051 | 210 |
| 94 | 3300005336 | Ga0070680_100001505 | Ga0070680_1000015055 | 210 |
| 95 | 3300005345 | Ga0070692_10079260 | Ga0070692_100792601 | 210 |
| 96 | 3300005577 | Ga0068857_100111694 | Ga0068857_1001116942 | 210 |
| 97 | 3300009174 | Ga0105241_10108872 | Ga0105241_101088723 | 210 |
| 98 | 3300009551 | Ga0105238_10132174 | Ga0105238_101321742 | 210 |
| 99 | 3300010375 | Ga0105239_10178608 | Ga0105239_101786083 | 210 |
| 100 | 3300013104 | Ga0157370_10530528 | Ga0157370_105305281 | 210 |
| 101 | 3300013105 | Ga0157369_10187283 | Ga0157369_101872832 | 210 |
| 102 | 3300013105 | Ga0157369_10685206 | Ga0157369_106852061 | 210 |
| 103 | 3300013307 | Ga0157372_10741110 | Ga0157372_107411101 | 210 |
| 104 | 3300020080 | Ga0206350_10119238 | Ga0206350_101192382 | 210 |
| 105 | 3300022467 | Ga0224712_10059437 | Ga0224712_100594374 | 210 |
| 106 | 3300025913 | Ga0207695_10115289 | Ga0207695_101152893 | 210 |
| 107 | 3300025914 | Ga0207671_10187152 | Ga0207671_101871522 | 210 |
| 108 | 3300025917 | Ga0207660_10017505 | Ga0207660_100175054 | 210 |
| 109 | 3300025944 | Ga0207661_10146624 | Ga0207661_101466243 | 210 |
| 110 | 3300026078 | Ga0207702_10109566 | Ga0207702_101095662 | 210 |
| 111 | 3300031249 | Ga0265339_10104538 | Ga0265339_101045382 | 210 |
| 112 | 3300031344 | Ga0265316_10499455 | Ga0265316_104994552 | 210 |
| 113 | 3300033179 | Ga0307507_10238405 | Ga0307507_102384052 | 210 |
| 114 | 3300041512 | Ga0451853_3672467 | Ga0451853_3672467_48_704 | 210 |
| 115 | 3300042876 | Ga0451577_0008871 | Ga0451577_0008871_4263_4895 | 210 |
| 116 | 3300045051 | Ga0451576_0166976 | Ga0451576_0166976_609_1241 | 210 |
| 117 | 3300049571 | Ga0501034_0018896 | Ga0501034_0018896_2280_2927 | 210 |
| 118 | iso_pu_bacteria | 2524614729 | 2525556785 | 212 |
| 119 | iso_pu_bacteria | 2627854209 | 2630648381 | 212 |
| 120 | iso_pu_bacteria | 2891633521 | 2891635053 | 212 |
| 121 | iso_pu_bacteria | 2919534386 | 2919537733 | 212 |
| 122 | 3300005331 | Ga0070670_100257850 | Ga0070670_1002578502 | 213 |
| 123 | 3300005434 | Ga0070709_10061270 | Ga0070709_100612702 | 213 |
| 124 | 3300005434 | Ga0070709_10202746 | Ga0070709_102027462 | 213 |
| 125 | 3300005439 | Ga0070711_100097760 | Ga0070711_1000977601 | 213 |
| 126 | 3300005459 | Ga0068867_100133985 | Ga0068867_1001339852 | 213 |
| 127 | 3300005545 | Ga0070695_100286739 | Ga0070695_1002867392 | 213 |
| 128 | 3300005546 | Ga0070696_100160901 | Ga0070696_1001609013 | 213 |
| 129 | 3300005547 | Ga0070693_100014699 | Ga0070693_1000146993 | 213 |
| 130 | 3300005547 | Ga0070693_100053888 | Ga0070693_1000538882 | 213 |
| 131 | 3300005548 | Ga0070665_100329810 | Ga0070665_1003298102 | 213 |
| 132 | 3300005563 | Ga0068855_100026787 | Ga0068855_1000267872 | 213 |
| 133 | 3300005614 | Ga0068856_100445861 | Ga0068856_1004458612 | 213 |
| 134 | 3300009093 | Ga0105240_10207087 | Ga0105240_102070872 | 213 |
| 135 | 3300009094 | Ga0111539_10139798 | Ga0111539_101397983 | 213 |
| 136 | 3300009174 | Ga0105241_10193083 | Ga0105241_101930832 | 213 |
| 137 | 3300009545 | Ga0105237_10737769 | Ga0105237_107377691 | 213 |
| 138 | 3300009553 | Ga0105249_11013869 | Ga0105249_110138692 | 213 |
| 139 | 3300013308 | Ga0157375_10143675 | Ga0157375_101436752 | 213 |
| 140 | 3300025906 | Ga0207699_10313383 | Ga0207699_103133832 | 213 |
| 141 | 3300025907 | Ga0207645_10038396 | Ga0207645_100383962 | 213 |
| 142 | 3300025911 | Ga0207654_10160426 | Ga0207654_101604262 | 213 |
| 143 | 3300025913 | Ga0207695_10599837 | Ga0207695_105998372 | 213 |
| 144 | 3300025914 | Ga0207671_10175045 | Ga0207671_101750452 | 213 |
| 145 | 3300025916 | Ga0207663_10112070 | Ga0207663_101120702 | 213 |
| 146 | 3300025923 | Ga0207681_10735096 | Ga0207681_107350962 | 213 |
| 147 | 3300025940 | Ga0207691_10032680 | Ga0207691_100326805 | 213 |
| 148 | 3300025949 | Ga0207667_10002925 | Ga0207667_100029256 | 213 |
| 149 | 3300025972 | Ga0207668_10169891 | Ga0207668_101698912 | 213 |
| 150 | 3300025986 | Ga0207658_10183606 | Ga0207658_101836062 | 213 |
| 151 | 3300026067 | Ga0207678_10237318 | Ga0207678_102373182 | 213 |
| 152 | 3300026088 | Ga0207641_10658556 | Ga0207641_106585562 | 213 |
| 153 | 3300026089 | Ga0207648_10087675 | Ga0207648_100876753 | 213 |
| 154 | 3300028379 | Ga0268266_10294979 | Ga0268266_102949792 | 213 |
| 155 | 3300033179 | Ga0307507_10135851 | Ga0307507_101358512 | 213 |
| 156 | 3300037471 | Ga0395905_0185824 | Ga0395905_0185824_624_1265 | 213 |
| 157 | 3300046514 | Ga0495618_0384332 | Ga0495618_0384332_103_759 | 213 |
| 158 | 3300046675 | Ga0495657_0440063 | Ga0495657_0440063_60_716 | 213 |
| 159 | 3300049587 | Ga0501071_0125343 | Ga0501071_0125343_190_837 | 213 |
| 160 | 3300049589 | Ga0501073_0126285 | Ga0501073_0126285_380_1027 | 213 |
| 161 | 3300049823 | Ga0501044_0108969 | Ga0501044_0108969_737_1384 | 213 |
| 162 | 3300053136 | Ga0500559_0146526 | Ga0500559_0146526_178_834 | 213 |
| 163 | iso_pu_bacteria | 2571042365 | 2572255015 | 213 |
| 164 | iso_pu_bacteria | 2643221695 | 2644529425 | 213 |
| 165 | 3300005330 | Ga0070690_100020353 | Ga0070690_1000203533 | 214 |
| 166 | 3300005347 | Ga0070668_100036424 | Ga0070668_1000364242 | 214 |
| 167 | 3300005548 | Ga0070665_100218674 | Ga0070665_1002186742 | 214 |
| 168 | 3300005563 | Ga0068855_100050085 | Ga0068855_1000500853 | 214 |
| 169 | 3300005841 | Ga0068863_100027859 | Ga0068863_1000278594 | 214 |
| 170 | 3300005842 | Ga0068858_100026329 | Ga0068858_1000263294 | 214 |
| 171 | 3300006237 | Ga0097621_100676139 | Ga0097621_1006761392 | 214 |
| 172 | 3300009093 | Ga0105240_10019161 | Ga0105240_100191615 | 214 |
| 173 | 3300009093 | Ga0105240_10021493 | Ga0105240_100214933 | 214 |
| 174 | 3300009174 | Ga0105241_10185844 | Ga0105241_101858442 | 214 |
| 175 | 3300009176 | Ga0105242_10392253 | Ga0105242_103922532 | 214 |
| 176 | 3300009177 | Ga0105248_10039461 | Ga0105248_100394615 | 214 |
| 177 | 3300010375 | Ga0105239_10073434 | Ga0105239_100734342 | 214 |
| 178 | 3300013104 | Ga0157370_10015715 | Ga0157370_100157156 | 214 |
| 179 | 3300014325 | Ga0163163_10002084 | Ga0163163_100020844 | 214 |
| 180 | 3300014968 | Ga0157379_10057159 | Ga0157379_100571593 | 214 |
| 181 | 3300025913 | Ga0207695_10036911 | Ga0207695_100369113 | 214 |
| 182 | 3300025913 | Ga0207695_10106215 | Ga0207695_101062153 | 214 |
| 183 | 3300025949 | Ga0207667_10017552 | Ga0207667_100175529 | 214 |
| 184 | 3300025972 | Ga0207668_10020502 | Ga0207668_100205024 | 214 |
| 185 | 3300026035 | Ga0207703_10041366 | Ga0207703_100413665 | 214 |
| 186 | 3300026078 | Ga0207702_10252260 | Ga0207702_102522601 | 214 |
| 187 | 3300026088 | Ga0207641_10898435 | Ga0207641_108984352 | 214 |
| 188 | 3300028381 | Ga0268264_10133032 | Ga0268264_101330322 | 214 |
| 189 | 3300046522 | Ga0495643_0063033 | Ga0495643_0063033_290_934 | 214 |
| 190 | 3300046694 | Ga0495649_0185215 | Ga0495649_0185215_355_1026 | 214 |
| 191 | 3300048088 | Ga0495602_0227825 | Ga0495602_0227825_581_1228 | 214 |
| 192 | 3300048929 | Ga0496126_0110602 | Ga0496126_0110602_203_856 | 215 |
| 193 | 3300049656 | Ga0501209_000193 | Ga0501209_000193_4067_4720 | 215 |
| 194 | iso_pu_bacteria | 2576861471 | 2578457872 | 215 |
| 195 | iso_pu_bacteria | 2643221559 | 2643817690 | 215 |
| 196 | iso_pu_bacteria | 2643221573 | 2643878914 | 215 |
| 197 | iso_pu_bacteria | 2643221586 | 2643940401 | 215 |
| 198 | iso_pu_bacteria | 2643221612 | 2644079475 | 215 |
| 199 | iso_pu_bacteria | 2643221720 | 2644660230 | 215 |
| 200 | iso_pu_bacteria | 2643221727 | 2644694917 | 215 |
| 201 | iso_pu_bacteria | 2643221728 | 2644697532 | 215 |
| 202 | iso_pu_bacteria | 2747842428 | 2747948027 | 215 |
| 203 | iso_pu_bacteria | 2765235840 | 2765579622 | 215 |
| 204 | iso_pu_bacteria | 2816332141 | 2816517702 | 215 |
| 205 | iso_pu_bacteria | 2842391507 | 2842391884 | 215 |
| 206 | iso_pu_bacteria | 2842757796 | 2842760162 | 215 |
| 207 | iso_pu_bacteria | 2852649853 | 2852650309 | 215 |
| 208 | iso_pu_bacteria | 2857442823 | 2857446787 | 215 |
| 209 | iso_pu_bacteria | 2874220319 | 2874222318 | 215 |
| 210 | iso_pu_bacteria | 2919089067 | 2919091093 | 215 |
| 211 | iso_pu_bacteria | 2919134579 | 2919135424 | 215 |
| 212 | iso_pu_bacteria | 2928496128 | 2928497643 | 215 |
| 213 | iso_pu_bacteria | 2931380184 | 2931384228 | 215 |
| 214 | iso_pu_bacteria | 2937610967 | 2937613287 | 215 |
| 215 | iso_pu_bacteria | 2939589442 | 2939592931 | 215 |
| 216 | iso_pu_bacteria | 2939622612 | 2939625671 | 215 |
| 217 | iso_pu_bacteria | 2939626828 | 2939628957 | 215 |
| 218 | iso_pu_bacteria | 2941475908 | 2941476385 | 215 |
| 219 | iso_pu_bacteria | 2961047084 | 2961049083 | 215 |
| 220 | iso_pu_bacteria | 2961064222 | 2961066221 | 215 |
| 221 | iso_pu_bacteria | 2974307012 | 2974308472 | 215 |
| 222 | iso_pu_bacteria | 2977247770 | 2977249226 | 215 |
| 223 | iso_pu_bacteria | 2984514374 | 2984516317 | 215 |
| 224 | iso_pu_bacteria | 2987605356 | 2987607265 | 215 |
| 225 | iso_pu_bacteria | 2995948881 | 2995951559 | 215 |
| 226 | 3300005293 | Ga0065715_10018126 | Ga0065715_100181262 | 216 |
| 227 | 3300005468 | Ga0070707_100520016 | Ga0070707_1005200162 | 216 |
| 228 | 3300005539 | Ga0068853_100088307 | Ga0068853_1000883072 | 216 |
| 229 | 3300005547 | Ga0070693_100081803 | Ga0070693_1000818031 | 216 |
| 230 | 3300005549 | Ga0070704_100513108 | Ga0070704_1005131082 | 216 |
| 231 | 3300005616 | Ga0068852_100106305 | Ga0068852_1001063052 | 216 |
| 232 | 3300005617 | Ga0068859_100008242 | Ga0068859_1000082424 | 216 |
| 233 | 3300005618 | Ga0068864_100897479 | Ga0068864_1008974791 | 216 |
| 234 | 3300005844 | Ga0068862_100638289 | Ga0068862_1006382892 | 216 |
| 235 | 3300006237 | Ga0097621_100186509 | Ga0097621_1001865092 | 216 |
| 236 | 3300006358 | Ga0068871_100253128 | Ga0068871_1002531282 | 216 |
| 237 | 3300006358 | Ga0068871_100822044 | Ga0068871_1008220442 | 216 |
| 238 | 3300006931 | Ga0097620_100008242 | Ga0097620_1000082424 | 216 |
| 239 | 3300009094 | Ga0111539_10137303 | Ga0111539_101373034 | 216 |
| 240 | 3300009551 | Ga0105238_10326143 | Ga0105238_103261432 | 216 |
| 241 | 3300013297 | Ga0157378_10084089 | Ga0157378_100840891 | 216 |
| 242 | 3300013308 | Ga0157375_11226699 | Ga0157375_112266992 | 216 |
| 243 | 3300014969 | Ga0157376_10006463 | Ga0157376_100064639 | 216 |
| 244 | 3300025321 | Ga0207656_10269159 | Ga0207656_102691591 | 216 |
| 245 | 3300025924 | Ga0207694_10014435 | Ga0207694_100144355 | 216 |
| 246 | 3300026095 | Ga0207676_10192170 | Ga0207676_101921702 | 216 |
| 247 | 3300026142 | Ga0207698_10069321 | Ga0207698_100693213 | 216 |
| 248 | 3300031824 | Ga0307413_10122562 | Ga0307413_101225621 | 216 |
| 249 | 3300032005 | Ga0307411_10155936 | Ga0307411_101559362 | 216 |
| 250 | 3300047320 | Ga0495672_0193773 | Ga0495672_0193773_160_813 | 216 |
| 251 | iso_pu_bacteria | 2747842501 | 2748015773 | 216 |
| 252 | iso_pu_bacteria | 2818991457 | 2819663040 | 216 |
| 253 | iso_pu_bacteria | 2852684882 | 2852685967 | 216 |
| 254 | iso_pu_bacteria | 2919130084 | 2919133505 | 216 |
| 255 | iso_pu_bacteria | 2929195423 | 2929197441 | 216 |
| 256 | iso_pu_bacteria | 8021622325 | 8021624225 | 216 |
| 257 | iso_pu_bacteria | 8021626552 | 8021628271 | 216 |
| 258 | iso_pu_bacteria | 8021648035 | 8021652030 | 216 |
| 259 | 3300005344 | Ga0070661_100034944 | Ga0070661_1000349442 | 217 |
| 260 | 3300005434 | Ga0070709_10613153 | Ga0070709_106131531 | 217 |
| 261 | 3300005458 | Ga0070681_10000012 | Ga0070681_1000001299 | 217 |
| 262 | 3300005459 | Ga0068867_100553248 | Ga0068867_1005532482 | 217 |
| 263 | 3300005614 | Ga0068856_100109651 | Ga0068856_1001096512 | 217 |
| 264 | 3300005616 | Ga0068852_100493277 | Ga0068852_1004932772 | 217 |
| 265 | 3300005843 | Ga0068860_100101399 | Ga0068860_1001013992 | 217 |
| 266 | 3300006844 | Ga0075428_101169852 | Ga0075428_1011698521 | 217 |
| 267 | 3300009101 | Ga0105247_10083347 | Ga0105247_100833472 | 217 |
| 268 | 3300010375 | Ga0105239_10104064 | Ga0105239_101040643 | 217 |
| 269 | 3300012506 | Ga0157324_1006905 | Ga0157324_10069052 | 217 |
| 270 | 3300025303 | Ga0209051_1015286 | Ga0209051_10152863 | 217 |
| 271 | 3300025900 | Ga0207710_10030140 | Ga0207710_100301402 | 217 |
| 272 | 3300025912 | Ga0207707_10000948 | Ga0207707_1000094815 | 217 |
| 273 | 3300026041 | Ga0207639_10016173 | Ga0207639_100161733 | 217 |
| 274 | 3300026078 | Ga0207702_10502343 | Ga0207702_105023432 | 217 |
| 275 | 3300026142 | Ga0207698_10863400 | Ga0207698_108634002 | 217 |
| 276 | 3300028380 | Ga0268265_10002801 | Ga0268265_100028018 | 217 |
| 277 | 3300028381 | Ga0268264_10009178 | Ga0268264_100091784 | 217 |
| 278 | 3300031548 | Ga0307408_100254352 | Ga0307408_1002543523 | 217 |
| 279 | 3300031824 | Ga0307413_10264385 | Ga0307413_102643852 | 217 |
| 280 | 3300031852 | Ga0307410_10279501 | Ga0307410_102795012 | 217 |
| 281 | 3300031901 | Ga0307406_10232961 | Ga0307406_102329612 | 217 |
| 282 | 3300031903 | Ga0307407_10152782 | Ga0307407_101527822 | 217 |
| 283 | 3300031911 | Ga0307412_10209788 | Ga0307412_102097883 | 217 |
| 284 | 3300031911 | Ga0307412_10617837 | Ga0307412_106178372 | 217 |
| 285 | 3300031995 | Ga0307409_100903467 | Ga0307409_1009034671 | 217 |
| 286 | 3300032002 | Ga0307416_100529727 | Ga0307416_1005297272 | 217 |
| 287 | 3300032005 | Ga0307411_10037108 | Ga0307411_100371082 | 217 |
| 288 | 3300032005 | Ga0307411_10125552 | Ga0307411_101255522 | 217 |
| 289 | 3300032005 | Ga0307411_10254234 | Ga0307411_102542343 | 217 |
| 290 | 3300032126 | Ga0307415_100812735 | Ga0307415_1008127352 | 217 |
| 291 | 3300041404 | Ga0439436_0009189 | Ga0439436_0009189_1418_2092 | 217 |
| 292 | 3300041404 | Ga0439436_0009600 | Ga0439436_0009600_1907_2572 | 217 |
| 293 | 3300041406 | Ga0439439_0086282 | Ga0439439_0086282_77_751 | 217 |
| 294 | 3300041494 | Ga0451837_1006580 | Ga0451837_1006580_2551_3204 | 217 |
| 295 | 3300041509 | Ga0451843_1634350 | Ga0451843_1634350_1836_2489 | 217 |
| 296 | 3300041999 | Ga0439433_0038905 | Ga0439433_0038905_250_915 | 217 |
| 297 | 3300042006 | Ga0439432_004313 | Ga0439432_004313_4069_4731 | 217 |
| 298 | 3300042006 | Ga0439432_030073 | Ga0439432_030073_452_1117 | 217 |
| 299 | 3300042007 | Ga0439449_0013127 | Ga0439449_0013127_2318_2983 | 217 |
| 300 | 3300042007 | Ga0439449_0015192 | Ga0439449_0015192_424_1089 | 217 |
| 301 | 3300042007 | Ga0439449_0119892 | Ga0439449_0119892_231_896 | 217 |
| 302 | 3300042015 | Ga0439462_0010907 | Ga0439462_0010907_607_1272 | 217 |
| 303 | 3300042435 | Ga0439434_0052358 | Ga0439434_0052358_248_922 | 217 |
| 304 | 3300042876 | Ga0451577_0002034 | Ga0451577_0002034_20693_21355 | 217 |
| 305 | 3300042876 | Ga0451577_0030380 | Ga0451577_0030380_772_1425 | 217 |
| 306 | 3300046539 | Ga0495621_0007405 | Ga0495621_0007405_1082_1747 | 217 |
| 307 | 3300046615 | Ga0495656_0120780 | Ga0495656_0120780_389_1054 | 217 |
| 308 | 3300046664 | Ga0495659_0053577 | Ga0495659_0053577_142_804 | 217 |
| 309 | 3300047318 | Ga0495636_0000522 | Ga0495636_0000522_7195_7860 | 217 |
| 310 | 3300049568 | Ga0501031_0005651 | Ga0501031_0005651_892_1545 | 217 |
| 311 | 3300049569 | Ga0501032_0002312 | Ga0501032_0002312_8174_8827 | 217 |
| 312 | 3300049570 | Ga0501033_0005030 | Ga0501033_0005030_8173_8826 | 217 |
| 313 | 3300049571 | Ga0501034_0008806 | Ga0501034_0008806_1598_2251 | 217 |
| 314 | 3300049572 | Ga0501036_0091661 | Ga0501036_0091661_1699_2352 | 217 |
| 315 | 3300049573 | Ga0501037_0001246 | Ga0501037_0001246_5900_6553 | 217 |
| 316 | 3300049574 | Ga0501038_0001377 | Ga0501038_0001377_8174_8827 | 217 |
| 317 | 3300049575 | Ga0501039_0012931 | Ga0501039_0012931_1744_2397 | 217 |
| 318 | 3300049580 | Ga0501046_0006111 | Ga0501046_0006111_6924_7577 | 217 |
| 319 | 3300049581 | Ga0501047_0009516 | Ga0501047_0009516_6181_6834 | 217 |
| 320 | 3300049583 | Ga0501067_0162401 | Ga0501067_0162401_211_864 | 217 |
| 321 | 3300049589 | Ga0501073_0024001 | Ga0501073_0024001_2052_2705 | 217 |
| 322 | 3300049652 | Ga0501202_038795 | Ga0501202_038795_166_837 | 217 |
| 323 | 3300049654 | Ga0501207_032009 | Ga0501207_032009_131_802 | 217 |
| 324 | 3300049663 | Ga0501223_048880 | Ga0501223_048880_19_690 | 217 |
| 325 | 3300049680 | Ga0501250_002719 | Ga0501250_002719_267_938 | 217 |
| 326 | 3300049680 | Ga0501250_011568 | Ga0501250_011568_306_971 | 217 |
| 327 | 3300049742 | Ga0501080_0080105 | Ga0501080_0080105_159_812 | 217 |
| 328 | 3300049767 | Ga0501270_037842 | Ga0501270_037842_19_690 | 217 |
| 329 | 3300049822 | Ga0501035_0005822 | Ga0501035_0005822_2796_3449 | 217 |
| 330 | 3300049823 | Ga0501044_0011072 | Ga0501044_0011072_7217_7870 | 217 |
| 331 | 3300054114 | Ga0501084_0335618 | Ga0501084_0335618_607_1260 | 217 |
| 332 | iso_pu_bacteria | 2895498888 | 2895500654 | 217 |
| 333 | iso_pu_bacteria | 2895511927 | 2895516476 | 217 |
| 334 | iso_pu_bacteria | 2895522137 | 2895523604 | 217 |
| 335 | iso_pu_bacteria | 2895525241 | 2895526814 | 217 |
| 336 | iso_pu_bacteria | 639633007 | 639789144 | 217 |
| 337 | iso_pu_bacteria | 8003014200 | 8003016092 | 217 |
| 338 | 3300003187 | JGI25151J46595_10006340 | JGI25151J46595_100063402 | 218 |
| 339 | 3300005334 | Ga0068869_100395013 | Ga0068869_1003950131 | 218 |
| 340 | 3300005355 | Ga0070671_100441589 | Ga0070671_1004415892 | 218 |
| 341 | 3300005456 | Ga0070678_100012656 | Ga0070678_1000126562 | 218 |
| 342 | 3300005530 | Ga0070679_100287197 | Ga0070679_1002871972 | 218 |
| 343 | 3300005841 | Ga0068863_100094369 | Ga0068863_1000943693 | 218 |
| 344 | 3300006237 | Ga0097621_100005955 | Ga0097621_1000059556 | 218 |
| 345 | 3300006358 | Ga0068871_100056678 | Ga0068871_1000566782 | 218 |
| 346 | 3300009177 | Ga0105248_10038118 | Ga0105248_100381182 | 218 |
| 347 | 3300010375 | Ga0105239_10205582 | Ga0105239_102055824 | 218 |
| 348 | 3300013308 | Ga0157375_10080866 | Ga0157375_100808664 | 218 |
| 349 | 3300014969 | Ga0157376_10000734 | Ga0157376_1000073415 | 218 |
| 350 | 3300017792 | Ga0163161_10516927 | Ga0163161_105169272 | 218 |
| 351 | 3300025294 | Ga0209025_1000034 | Ga0209025_100003469 | 218 |
| 352 | 3300025920 | Ga0207649_10319698 | Ga0207649_103196981 | 218 |
| 353 | 3300025925 | Ga0207650_10240986 | Ga0207650_102409862 | 218 |
| 354 | 3300025931 | Ga0207644_10190828 | Ga0207644_101908281 | 218 |
| 355 | 3300025936 | Ga0207670_10149810 | Ga0207670_101498102 | 218 |
| 356 | 3300025940 | Ga0207691_10013867 | Ga0207691_100138674 | 218 |
| 357 | 3300025941 | Ga0207711_10348087 | Ga0207711_103480871 | 218 |
| 358 | 3300025942 | Ga0207689_10255683 | Ga0207689_102556832 | 218 |
| 359 | 3300025949 | Ga0207667_10413324 | Ga0207667_104133242 | 218 |
| 360 | 3300025972 | Ga0207668_10014664 | Ga0207668_100146642 | 218 |
| 361 | 3300026088 | Ga0207641_10021908 | Ga0207641_100219084 | 218 |
| 362 | 3300026089 | Ga0207648_10019234 | Ga0207648_100192346 | 218 |
| 363 | 3300026121 | Ga0207683_10003087 | Ga0207683_1000308710 | 218 |
| 364 | 3300026121 | Ga0207683_10202414 | Ga0207683_102024142 | 218 |
| 365 | 3300028381 | Ga0268264_10157462 | Ga0268264_101574622 | 218 |
| 366 | 3300031507 | Ga0307509_10277799 | Ga0307509_102777992 | 218 |
| 367 | 3300031903 | Ga0307407_10218511 | Ga0307407_102185112 | 218 |
| 368 | 3300033179 | Ga0307507_10183106 | Ga0307507_101831061 | 218 |
| 369 | 3300036401 | Ga0373937_0341636 | Ga0373937_0341636_607_1263 | 218 |
| 370 | 3300044656 | Ga0466969_0035455 | Ga0466969_0035455_1406_2086 | 218 |
| 371 | 3300044666 | Ga0466977_0005295 | Ga0466977_0005295_3879_4559 | 218 |
| 372 | 3300046616 | Ga0495668_0001767 | Ga0495668_0001767_16312_17040 | 218 |
| 373 | 3300050509 | nmdc:mga0qj67_64880_c1 | nmdc:mga0qj67_64880_c1_148_804 | 218 |
| 374 | 3300003323 | rootH1_10150984 | rootH1_101509842 | 219 |
| 375 | 3300003771 | Ga0055526_1000006 | Ga0055526_100000612 | 219 |
| 376 | 3300003771 | Ga0055526_1000413 | Ga0055526_100041325 | 219 |
| 377 | 3300003773 | Ga0055537_1000018 | Ga0055537_100001812 | 219 |
| 378 | 3300003773 | Ga0055537_1000349 | Ga0055537_100034919 | 219 |
| 379 | 3300003775 | Ga0055524_1000009 | Ga0055524_1000009215 | 219 |
| 380 | 3300003775 | Ga0055524_1018136 | Ga0055524_10181363 | 219 |
| 381 | 3300003781 | Ga0055536_1002383 | Ga0055536_10023832 | 219 |
| 382 | 3300003781 | Ga0055536_1003808 | Ga0055536_10038085 | 219 |
| 383 | 3300003781 | Ga0055536_1052554 | Ga0055536_10525541 | 219 |
| 384 | 3300003784 | Ga0055534_1000004 | Ga0055534_1000004215 | 219 |
| 385 | 3300003784 | Ga0055534_1000073 | Ga0055534_100007335 | 219 |
| 386 | 3300003790 | Ga0055528_1000003 | Ga0055528_1000003248 | 219 |
| 387 | 3300003790 | Ga0055528_1000080 | Ga0055528_100008030 | 219 |
| 388 | 3300003791 | Ga0055530_10001767 | Ga0055530_1000176712 | 219 |
| 389 | 3300003791 | Ga0055530_10001774 | Ga0055530_1000177410 | 219 |
| 390 | 3300003792 | Ga0055540_1026811 | Ga0055540_10268112 | 219 |
| 391 | 3300003794 | Ga0055531_10010111 | Ga0055531_100101114 | 219 |
| 392 | 3300003794 | Ga0055531_10021508 | Ga0055531_100215083 | 219 |
| 393 | 3300003794 | Ga0055531_10024202 | Ga0055531_100242024 | 219 |
| 394 | 3300005262 | Ga0065165_1028945 | Ga0065165_10289452 | 219 |
| 395 | 3300005289 | Ga0065704_10092418 | Ga0065704_100924182 | 219 |
| 396 | 3300005289 | Ga0065704_10189581 | Ga0065704_101895812 | 219 |
| 397 | 3300005334 | Ga0068869_100098086 | Ga0068869_1000980862 | 219 |
| 398 | 3300005353 | Ga0070669_100034776 | Ga0070669_1000347764 | 219 |
| 399 | 3300005456 | Ga0070678_100065671 | Ga0070678_1000656713 | 219 |
| 400 | 3300005539 | Ga0068853_100002556 | Ga0068853_1000025566 | 219 |
| 401 | 3300005546 | Ga0070696_100168693 | Ga0070696_1001686932 | 219 |
| 402 | 3300005548 | Ga0070665_100008352 | Ga0070665_10000835211 | 219 |
| 403 | 3300005548 | Ga0070665_100052946 | Ga0070665_1000529463 | 219 |
| 404 | 3300005548 | Ga0070665_100122005 | Ga0070665_1001220052 | 219 |
| 405 | 3300005563 | Ga0068855_100023493 | Ga0068855_1000234937 | 219 |
| 406 | 3300005577 | Ga0068857_100398225 | Ga0068857_1003982252 | 219 |
| 407 | 3300005616 | Ga0068852_100297989 | Ga0068852_1002979892 | 219 |
| 408 | 3300005617 | Ga0068859_100285598 | Ga0068859_1002855982 | 219 |
| 409 | 3300005718 | Ga0068866_10000607 | Ga0068866_1000060716 | 219 |
| 410 | 3300005841 | Ga0068863_100001454 | Ga0068863_1000014546 | 219 |
| 411 | 3300005844 | Ga0068862_100224242 | Ga0068862_1002242422 | 219 |
| 412 | 3300006051 | Ga0075364_10327832 | Ga0075364_103278322 | 219 |
| 413 | 3300006237 | Ga0097621_100008756 | Ga0097621_1000087561 | 219 |
| 414 | 3300006844 | Ga0075428_100395255 | Ga0075428_1003952552 | 219 |
| 415 | 3300006914 | Ga0075436_100114536 | Ga0075436_1001145362 | 219 |
| 416 | 3300006931 | Ga0097620_100285595 | Ga0097620_1002855952 | 219 |
| 417 | 3300009011 | Ga0105251_10006958 | Ga0105251_100069587 | 219 |
| 418 | 3300009036 | Ga0105244_10034596 | Ga0105244_100345964 | 219 |
| 419 | 3300009098 | Ga0105245_10257448 | Ga0105245_102574481 | 219 |
| 420 | 3300009174 | Ga0105241_10486851 | Ga0105241_104868512 | 219 |
| 421 | 3300009176 | Ga0105242_10060546 | Ga0105242_100605462 | 219 |
| 422 | 3300009545 | Ga0105237_10089736 | Ga0105237_100897363 | 219 |
| 423 | 3300009553 | Ga0105249_10040632 | Ga0105249_100406323 | 219 |
| 424 | 3300009553 | Ga0105249_10160398 | Ga0105249_101603982 | 219 |
| 425 | 3300010375 | Ga0105239_10005877 | Ga0105239_100058776 | 219 |
| 426 | 3300013100 | Ga0157373_10709621 | Ga0157373_107096211 | 219 |
| 427 | 3300013102 | Ga0157371_10003647 | Ga0157371_100036475 | 219 |
| 428 | 3300013102 | Ga0157371_10014602 | Ga0157371_100146025 | 219 |
| 429 | 3300013104 | Ga0157370_10124688 | Ga0157370_101246882 | 219 |
| 430 | 3300013104 | Ga0157370_10301153 | Ga0157370_103011531 | 219 |
| 431 | 3300014326 | Ga0157380_10379597 | Ga0157380_103795972 | 219 |
| 432 | 3300014497 | Ga0182008_10001765 | Ga0182008_100017655 | 219 |
| 433 | 3300014497 | Ga0182008_10002596 | Ga0182008_1000259610 | 219 |
| 434 | 3300015261 | Ga0182006_1023402 | Ga0182006_10234024 | 219 |
| 435 | 3300015261 | Ga0182006_1040986 | Ga0182006_10409863 | 219 |
| 436 | 3300015262 | Ga0182007_10000353 | Ga0182007_1000035319 | 219 |
| 437 | 3300015265 | Ga0182005_1000344 | Ga0182005_100034420 | 219 |
| 438 | 3300015689 | Ga0183360_10001 | Ga0183360_100011635 | 219 |
| 439 | 3300017792 | Ga0163161_10002464 | Ga0163161_100024645 | 219 |
| 440 | 3300017792 | Ga0163161_10173715 | Ga0163161_101737153 | 219 |
| 441 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012179 | 219 |
| 442 | 3300025263 | Ga0209565_1000022 | Ga0209565_100002255 | 219 |
| 443 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012179 | 219 |
| 444 | 3300025273 | Ga0209673_1000087 | Ga0209673_1000087174 | 219 |
| 445 | 3300025273 | Ga0209673_1050296 | Ga0209673_10502962 | 219 |
| 446 | 3300025284 | Ga0209130_1016302 | Ga0209130_10163022 | 219 |
| 447 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001353 | 219 |
| 448 | 3300025291 | Ga0209675_1000060 | Ga0209675_100006013 | 219 |
| 449 | 3300025291 | Ga0209675_1012289 | Ga0209675_10122893 | 219 |
| 450 | 3300025292 | Ga0209676_1000011 | Ga0209676_10000118 | 219 |
| 451 | 3300025292 | Ga0209676_1000114 | Ga0209676_100011438 | 219 |
| 452 | 3300025292 | Ga0209676_1000976 | Ga0209676_100097636 | 219 |
| 453 | 3300025292 | Ga0209676_1005140 | Ga0209676_10051404 | 219 |
| 454 | 3300025292 | Ga0209676_1007576 | Ga0209676_10075765 | 219 |
| 455 | 3300025292 | Ga0209676_1016951 | Ga0209676_10169513 | 219 |
| 456 | 3300025294 | Ga0209025_1017520 | Ga0209025_10175204 | 219 |
| 457 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001515 | 219 |
| 458 | 3300025295 | Ga0209564_1000302 | Ga0209564_100030248 | 219 |
| 459 | 3300025297 | Ga0209758_1037028 | Ga0209758_10370282 | 219 |
| 460 | 3300025298 | Ga0209050_1001760 | Ga0209050_100176014 | 219 |
| 461 | 3300025298 | Ga0209050_1002154 | Ga0209050_10021547 | 219 |
| 462 | 3300025298 | Ga0209050_1009716 | Ga0209050_10097164 | 219 |
| 463 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000021037 | 219 |
| 464 | 3300025299 | Ga0209256_1001644 | Ga0209256_10016447 | 219 |
| 465 | 3300025299 | Ga0209256_1003341 | Ga0209256_10033419 | 219 |
| 466 | 3300025299 | Ga0209256_1017426 | Ga0209256_10174262 | 219 |
| 467 | 3300025303 | Ga0209051_1000606 | Ga0209051_10006067 | 219 |
| 468 | 3300025304 | Ga0209257_1000014 | Ga0209257_100001467 | 219 |
| 469 | 3300025304 | Ga0209257_1000080 | Ga0209257_1000080119 | 219 |
| 470 | 3300025304 | Ga0209257_1006360 | Ga0209257_10063608 | 219 |
| 471 | 3300025304 | Ga0209257_1009732 | Ga0209257_10097324 | 219 |
| 472 | 3300025735 | Ga0207713_1007579 | Ga0207713_10075792 | 219 |
| 473 | 3300025903 | Ga0207680_10057263 | Ga0207680_100572632 | 219 |
| 474 | 3300025911 | Ga0207654_10152279 | Ga0207654_101522792 | 219 |
| 475 | 3300025914 | Ga0207671_10049438 | Ga0207671_100494382 | 219 |
| 476 | 3300025934 | Ga0207686_10065515 | Ga0207686_100655152 | 219 |
| 477 | 3300025935 | Ga0207709_10004839 | Ga0207709_100048391 | 219 |
| 478 | 3300025942 | Ga0207689_10007328 | Ga0207689_100073283 | 219 |
| 479 | 3300025949 | Ga0207667_10001306 | Ga0207667_1000130630 | 219 |
| 480 | 3300025961 | Ga0207712_10016600 | Ga0207712_100166004 | 219 |
| 481 | 3300025981 | Ga0207640_11038987 | Ga0207640_110389871 | 219 |
| 482 | 3300025986 | Ga0207658_10078539 | Ga0207658_100785392 | 219 |
| 483 | 3300026041 | Ga0207639_10000772 | Ga0207639_100007726 | 219 |
| 484 | 3300026041 | Ga0207639_10040551 | Ga0207639_100405512 | 219 |
| 485 | 3300026067 | Ga0207678_10250041 | Ga0207678_102500412 | 219 |
| 486 | 3300026088 | Ga0207641_10049896 | Ga0207641_100498965 | 219 |
| 487 | 3300026116 | Ga0207674_10422446 | Ga0207674_104224462 | 219 |
| 488 | 3300026118 | Ga0207675_100006718 | Ga0207675_10000671812 | 219 |
| 489 | 3300026121 | Ga0207683_10178672 | Ga0207683_101786723 | 219 |
| 490 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007169 | 219 |
| 491 | 3300028379 | Ga0268266_10021365 | Ga0268266_100213655 | 219 |
| 492 | 3300028380 | Ga0268265_10263336 | Ga0268265_102633362 | 219 |
| 493 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008781 | 219 |
| 494 | 3300030732 | Ga0316176_1153914 | Ga0316176_11539142 | 219 |
| 495 | 3300030742 | Ga0316183_1068246 | Ga0316183_10682465 | 219 |
| 496 | 3300030744 | Ga0316181_1203139 | Ga0316181_12031391 | 219 |
| 497 | 3300032004 | Ga0307414_10163842 | Ga0307414_101638422 | 219 |
| 498 | 3300032004 | Ga0307414_10280672 | Ga0307414_102806722 | 219 |
| 499 | 3300037312 | Ga0395899_0021657 | Ga0395899_0021657_262_930 | 219 |
| 500 | 3300037418 | Ga0395900_0016564 | Ga0395900_0016564_542_1210 | 219 |
| 501 | 3300037466 | Ga0395898_0108711 | Ga0395898_0108711_971_1639 | 219 |
| 502 | 3300037471 | Ga0395905_0000577 | Ga0395905_0000577_2309_2977 | 219 |
| 503 | 3300037471 | Ga0395905_0155418 | Ga0395905_0155418_497_1165 | 219 |
| 504 | 3300037853 | Ga0436364_0752000 | Ga0436364_0752000_5152_5844 | 219 |
| 505 | 3300038705 | Ga0237819_08451 | Ga0237819_08451_577_1239 | 219 |
| 506 | 3300041413 | Ga0439465_0009303 | Ga0439465_0009303_243_914 | 219 |
| 507 | 3300041486 | Ga0451807_0568998 | Ga0451807_0568998_439_1098 | 219 |
| 508 | 3300041512 | Ga0451853_3632959 | Ga0451853_3632959_121_780 | 219 |
| 509 | 3300042007 | Ga0439449_0004776 | Ga0439449_0004776_1793_2464 | 219 |
| 510 | 3300044658 | Ga0466972_0016307 | Ga0466972_0016307_1335_2030 | 219 |
| 511 | 3300044765 | Ga0466970_0007619 | Ga0466970_0007619_1297_1992 | 219 |
| 512 | 3300046460 | Ga0495638_0010655 | Ga0495638_0010655_3966_4628 | 219 |
| 513 | 3300046460 | Ga0495638_0104326 | Ga0495638_0104326_328_999 | 219 |
| 514 | 3300046522 | Ga0495643_0003481 | Ga0495643_0003481_9092_9754 | 219 |
| 515 | 3300046558 | Ga0495633_0022960 | Ga0495633_0022960_1186_1848 | 219 |
| 516 | 3300046615 | Ga0495656_0003220 | Ga0495656_0003220_4792_5463 | 219 |
| 517 | 3300046660 | Ga0495625_0095761 | Ga0495625_0095761_712_1374 | 219 |
| 518 | 3300046691 | Ga0495670_0146339 | Ga0495670_0146339_432_1103 | 219 |
| 519 | 3300047318 | Ga0495636_0026155 | Ga0495636_0026155_469_1140 | 219 |
| 520 | 3300047320 | Ga0495672_0000455 | Ga0495672_0000455_1897_2559 | 219 |
| 521 | 3300048908 | Ga0496105_0139808 | Ga0496105_0139808_961_1623 | 219 |
| 522 | 3300048919 | Ga0496116_0088184 | Ga0496116_0088184_374_1036 | 219 |
| 523 | 3300048920 | Ga0496117_0005879 | Ga0496117_0005879_2063_2725 | 219 |
| 524 | 3300048920 | Ga0496117_0006203 | Ga0496117_0006203_1885_2547 | 219 |
| 525 | 3300048920 | Ga0496117_0186420 | Ga0496117_0186420_154_816 | 219 |
| 526 | 3300048921 | Ga0496118_0000362 | Ga0496118_0000362_9869_10531 | 219 |
| 527 | 3300048921 | Ga0496118_0001608 | Ga0496118_0001608_3823_4521 | 219 |
| 528 | 3300048921 | Ga0496118_0006389 | Ga0496118_0006389_1346_2008 | 219 |
| 529 | 3300048922 | Ga0496119_0000851 | Ga0496119_0000851_28159_28821 | 219 |
| 530 | 3300048922 | Ga0496119_0038877 | Ga0496119_0038877_391_1053 | 219 |
| 531 | 3300048923 | Ga0496120_0001387 | Ga0496120_0001387_17292_17954 | 219 |
| 532 | 3300048923 | Ga0496120_0062248 | Ga0496120_0062248_993_1655 | 219 |
| 533 | 3300048924 | Ga0496121_0000755 | Ga0496121_0000755_10135_10800 | 219 |
| 534 | 3300048924 | Ga0496121_0054362 | Ga0496121_0054362_1662_2324 | 219 |
| 535 | 3300048925 | Ga0496122_0003143 | Ga0496122_0003143_11944_12606 | 219 |
| 536 | 3300048925 | Ga0496122_0027624 | Ga0496122_0027624_2516_3178 | 219 |
| 537 | 3300048925 | Ga0496122_0035854 | Ga0496122_0035854_1637_2299 | 219 |
| 538 | 3300048925 | Ga0496122_0093335 | Ga0496122_0093335_1008_1670 | 219 |
| 539 | 3300048926 | Ga0496123_0000624 | Ga0496123_0000624_9688_10350 | 219 |
| 540 | 3300048926 | Ga0496123_0050826 | Ga0496123_0050826_1072_1734 | 219 |
| 541 | 3300048926 | Ga0496123_0092211 | Ga0496123_0092211_751_1413 | 219 |
| 542 | 3300048927 | Ga0496124_0009017 | Ga0496124_0009017_1599_2261 | 219 |
| 543 | 3300048927 | Ga0496124_0015807 | Ga0496124_0015807_1372_2034 | 219 |
| 544 | 3300048927 | Ga0496124_0030624 | Ga0496124_0030624_2812_3474 | 219 |
| 545 | 3300048927 | Ga0496124_0058441 | Ga0496124_0058441_1857_2519 | 219 |
| 546 | 3300048927 | Ga0496124_0264456 | Ga0496124_0264456_556_1218 | 219 |
| 547 | 3300048927 | Ga0496124_0306334 | Ga0496124_0306334_434_1096 | 219 |
| 548 | 3300048927 | Ga0496124_0307127 | Ga0496124_0307127_122_784 | 219 |
| 549 | 3300048928 | Ga0496125_0008250 | Ga0496125_0008250_9521_10183 | 219 |
| 550 | 3300048928 | Ga0496125_0059747 | Ga0496125_0059747_378_1040 | 219 |
| 551 | 3300048928 | Ga0496125_0065237 | Ga0496125_0065237_757_1419 | 219 |
| 552 | 3300048928 | Ga0496125_0102563 | Ga0496125_0102563_127_789 | 219 |
| 553 | 3300048928 | Ga0496125_0105881 | Ga0496125_0105881_792_1454 | 219 |
| 554 | 3300048928 | Ga0496125_0233973 | Ga0496125_0233973_323_985 | 219 |
| 555 | 3300048929 | Ga0496126_0197160 | Ga0496126_0197160_179_841 | 219 |
| 556 | 3300049570 | Ga0501033_0079198 | Ga0501033_0079198_912_1577 | 219 |
| 557 | 3300049571 | Ga0501034_0136878 | Ga0501034_0136878_1518_2180 | 219 |
| 558 | 3300049574 | Ga0501038_0531520 | Ga0501038_0531520_90_755 | 219 |
| 559 | 3300049575 | Ga0501039_0003424 | Ga0501039_0003424_9635_10300 | 219 |
| 560 | 3300049576 | Ga0501040_0005666 | Ga0501040_0005666_4479_5144 | 219 |
| 561 | 3300049578 | Ga0501042_0038328 | Ga0501042_0038328_2611_3276 | 219 |
| 562 | 3300049580 | Ga0501046_0038896 | Ga0501046_0038896_1542_2207 | 219 |
| 563 | 3300049582 | Ga0501048_0054480 | Ga0501048_0054480_2121_2786 | 219 |
| 564 | 3300049587 | Ga0501071_0005629 | Ga0501071_0005629_4149_4814 | 219 |
| 565 | 3300049588 | Ga0501072_0010759 | Ga0501072_0010759_1716_2381 | 219 |
| 566 | 3300049591 | Ga0501075_0000416 | Ga0501075_0000416_19259_19924 | 219 |
| 567 | 3300049592 | Ga0501076_0003140 | Ga0501076_0003140_1942_2607 | 219 |
| 568 | 3300049593 | Ga0501077_0024700 | Ga0501077_0024700_353_1018 | 219 |
| 569 | 3300049741 | Ga0501079_0015199 | Ga0501079_0015199_3491_4156 | 219 |
| 570 | 3300049743 | Ga0501081_0001594 | Ga0501081_0001594_9114_9779 | 219 |
| 571 | 3300049822 | Ga0501035_0377702 | Ga0501035_0377702_419_1084 | 219 |
| 572 | 3300049824 | Ga0501045_0000120 | Ga0501045_0000120_23646_24311 | 219 |
| 573 | 3300054114 | Ga0501084_0000861 | Ga0501084_0000861_16251_16916 | 219 |
| 574 | 3300054114 | Ga0501084_0675220 | Ga0501084_0675220_23_685 | 219 |
| 575 | 3300060353 | Ga0501082_0020433 | Ga0501082_0020433_268_933 | 219 |
| 576 | 3300002773 | JGI25152J39213_1000032 | JGI25152J39213_100003254 | 220 |
| 577 | 3300002774 | JGI25150J39212_1000179 | JGI25150J39212_10001796 | 220 |
| 578 | 3300003187 | JGI25151J46595_10000138 | JGI25151J46595_1000013854 | 220 |
| 579 | 3300003215 | JGI25153J46596_10000102 | JGI25153J46596_1000010254 | 220 |
| 580 | 3300003856 | Ga0058692_1000023 | Ga0058692_1000023155 | 220 |
| 581 | 3300005289 | Ga0065704_10075451 | Ga0065704_100754512 | 220 |
| 582 | 3300005331 | Ga0070670_100005062 | Ga0070670_10000506210 | 220 |
| 583 | 3300005331 | Ga0070670_100006427 | Ga0070670_1000064277 | 220 |
| 584 | 3300005335 | Ga0070666_10045825 | Ga0070666_100458251 | 220 |
| 585 | 3300005338 | Ga0068868_100069326 | Ga0068868_1000693262 | 220 |
| 586 | 3300005344 | Ga0070661_100169457 | Ga0070661_1001694572 | 220 |
| 587 | 3300005364 | Ga0070673_100346063 | Ga0070673_1003460632 | 220 |
| 588 | 3300005367 | Ga0070667_100307439 | Ga0070667_1003074391 | 220 |
| 589 | 3300005445 | Ga0070708_100504604 | Ga0070708_1005046042 | 220 |
| 590 | 3300005455 | Ga0070663_100021396 | Ga0070663_1000213963 | 220 |
| 591 | 3300005456 | Ga0070678_100120486 | Ga0070678_1001204862 | 220 |
| 592 | 3300005457 | Ga0070662_100028679 | Ga0070662_1000286794 | 220 |
| 593 | 3300005539 | Ga0068853_100035121 | Ga0068853_1000351214 | 220 |
| 594 | 3300005539 | Ga0068853_100057145 | Ga0068853_1000571453 | 220 |
| 595 | 3300005548 | Ga0070665_100024712 | Ga0070665_1000247124 | 220 |
| 596 | 3300005578 | Ga0068854_100025642 | Ga0068854_1000256423 | 220 |
| 597 | 3300005616 | Ga0068852_100028067 | Ga0068852_1000280673 | 220 |
| 598 | 3300005616 | Ga0068852_100243827 | Ga0068852_1002438273 | 220 |
| 599 | 3300005617 | Ga0068859_100747029 | Ga0068859_1007470292 | 220 |
| 600 | 3300005834 | Ga0068851_10001171 | Ga0068851_1000117111 | 220 |
| 601 | 3300005842 | Ga0068858_100000536 | Ga0068858_1000005365 | 220 |
| 602 | 3300006186 | Ga0075369_10025543 | Ga0075369_100255432 | 220 |
| 603 | 3300006353 | Ga0075370_10109882 | Ga0075370_101098823 | 220 |
| 604 | 3300006931 | Ga0097620_100746999 | Ga0097620_1007469992 | 220 |
| 605 | 3300009011 | Ga0105251_10000108 | Ga0105251_1000010851 | 220 |
| 606 | 3300009093 | Ga0105240_10301577 | Ga0105240_103015772 | 220 |
| 607 | 3300009093 | Ga0105240_11297319 | Ga0105240_112973191 | 220 |
| 608 | 3300009148 | Ga0105243_10099579 | Ga0105243_100995793 | 220 |
| 609 | 3300009174 | Ga0105241_10123844 | Ga0105241_101238442 | 220 |
| 610 | 3300009176 | Ga0105242_10375978 | Ga0105242_103759781 | 220 |
| 611 | 3300009551 | Ga0105238_10006153 | Ga0105238_100061538 | 220 |
| 612 | 3300009553 | Ga0105249_10035359 | Ga0105249_100353595 | 220 |
| 613 | 3300010375 | Ga0105239_10275318 | Ga0105239_102753182 | 220 |
| 614 | 3300013105 | Ga0157369_10195896 | Ga0157369_101958962 | 220 |
| 615 | 3300013296 | Ga0157374_10042784 | Ga0157374_100427842 | 220 |
| 616 | 3300013306 | Ga0163162_10570994 | Ga0163162_105709942 | 220 |
| 617 | 3300013307 | Ga0157372_10070485 | Ga0157372_100704854 | 220 |
| 618 | 3300013307 | Ga0157372_10205339 | Ga0157372_102053392 | 220 |
| 619 | 3300015265 | Ga0182005_1008509 | Ga0182005_10085096 | 220 |
| 620 | 3300025245 | Ga0207425_1000078 | Ga0207425_100007854 | 220 |
| 621 | 3300025258 | Ga0209129_1000157 | Ga0209129_100015739 | 220 |
| 622 | 3300025294 | Ga0209025_1000054 | Ga0209025_1000054221 | 220 |
| 623 | 3300025297 | Ga0209758_1000062 | Ga0209758_1000062221 | 220 |
| 624 | 3300025321 | Ga0207656_10003911 | Ga0207656_100039113 | 220 |
| 625 | 3300025735 | Ga0207713_1000507 | Ga0207713_100050714 | 220 |
| 626 | 3300025903 | Ga0207680_10014375 | Ga0207680_100143753 | 220 |
| 627 | 3300025904 | Ga0207647_10000091 | Ga0207647_100000912 | 220 |
| 628 | 3300025913 | Ga0207695_10046068 | Ga0207695_100460682 | 220 |
| 629 | 3300025914 | Ga0207671_10016712 | Ga0207671_100167125 | 220 |
| 630 | 3300025924 | Ga0207694_10005892 | Ga0207694_1000589210 | 220 |
| 631 | 3300025925 | Ga0207650_10005976 | Ga0207650_100059767 | 220 |
| 632 | 3300025925 | Ga0207650_10044411 | Ga0207650_100444113 | 220 |
| 633 | 3300025933 | Ga0207706_10005093 | Ga0207706_100050935 | 220 |
| 634 | 3300025934 | Ga0207686_10332711 | Ga0207686_103327112 | 220 |
| 635 | 3300025935 | Ga0207709_10004718 | Ga0207709_100047188 | 220 |
| 636 | 3300025938 | Ga0207704_10040853 | Ga0207704_100408532 | 220 |
| 637 | 3300025949 | Ga0207667_10139507 | Ga0207667_101395074 | 220 |
| 638 | 3300025960 | Ga0207651_10154167 | Ga0207651_101541672 | 220 |
| 639 | 3300025961 | Ga0207712_10000254 | Ga0207712_1000025444 | 220 |
| 640 | 3300025981 | Ga0207640_10017834 | Ga0207640_100178343 | 220 |
| 641 | 3300026035 | Ga0207703_10000925 | Ga0207703_1000092520 | 220 |
| 642 | 3300026041 | Ga0207639_10000234 | Ga0207639_100002345 | 220 |
| 643 | 3300026067 | Ga0207678_10020429 | Ga0207678_100204293 | 220 |
| 644 | 3300026078 | Ga0207702_10138612 | Ga0207702_101386122 | 220 |
| 645 | 3300026121 | Ga0207683_10282421 | Ga0207683_102824212 | 220 |
| 646 | 3300027312 | Ga0209371_1000059 | Ga0209371_1000059154 | 220 |
| 647 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006361 | 220 |
| 648 | 3300030500 | Ga0268256_1000055 | Ga0268256_100005545 | 220 |
| 649 | 3300030521 | Ga0307511_10000003 | Ga0307511_10000003115 | 220 |
| 650 | 3300041459 | Ga0451800_0056998 | Ga0451800_0056998_681_1343 | 220 |
| 651 | 3300041462 | Ga0451806_353890 | Ga0451806_353890_101_763 | 220 |
| 652 | 3300041486 | Ga0451807_2639821 | Ga0451807_2639821_594_1256 | 220 |
| 653 | 3300041494 | Ga0451837_1499872 | Ga0451837_1499872_808_1470 | 220 |
| 654 | 3300048929 | Ga0496126_0023054 | Ga0496126_0023054_3283_3945 | 220 |
| 655 | 3300049568 | Ga0501031_0055663 | Ga0501031_0055663_264_926 | 220 |
| 656 | 3300049569 | Ga0501032_0160109 | Ga0501032_0160109_597_1259 | 220 |
| 657 | 3300049574 | Ga0501038_0013359 | Ga0501038_0013359_493_1155 | 220 |
| 658 | 3300049581 | Ga0501047_0121320 | Ga0501047_0121320_307_969 | 220 |
| 659 | 3300049581 | Ga0501047_0136853 | Ga0501047_0136853_605_1267 | 220 |
| 660 | 3300049584 | Ga0501068_0069669 | Ga0501068_0069669_199_861 | 220 |
| 661 | 3300049589 | Ga0501073_0299458 | Ga0501073_0299458_199_861 | 220 |
| 662 | 3300049686 | Ga0501257_030626 | Ga0501257_030626_510_1172 | 220 |
| 663 | 3300049741 | Ga0501079_0441093 | Ga0501079_0441093_81_743 | 220 |
| 664 | 3300049823 | Ga0501044_0008551 | Ga0501044_0008551_8454_9116 | 220 |
| 665 | 3300050493 | nmdc:mga0k408_83794_c1 | nmdc:mga0k408_83794_c1_741_1418 | 220 |
| 666 | 3300050495 | nmdc:mga04h51_59713_c1 | nmdc:mga04h51_59713_c1_58_735 | 220 |
| 667 | 3300050496 | nmdc:mga07m45_102654_c1 | nmdc:mga07m45_102654_c1_473_1150 | 220 |
| 668 | 3300050516 | nmdc:mga0sz30_50814_c1 | nmdc:mga0sz30_50814_c1_137_802 | 220 |
| 669 | 3300053088 | Ga0500644_0082120 | Ga0500644_0082120_316_981 | 220 |
| 670 | 3300053090 | Ga0500646_0001514 | Ga0500646_0001514_908_1573 | 220 |
| 671 | 3300053093 | Ga0500651_0006850 | Ga0500651_0006850_2532_3197 | 220 |
| 672 | 3300053118 | Ga0500594_0058209 | Ga0500594_0058209_404_1069 | 220 |
| 673 | 3300053151 | Ga0500604_0016262 | Ga0500604_0016262_1345_2010 | 220 |
| 674 | 3300053153 | Ga0500616_0147228 | Ga0500616_0147228_178_843 | 220 |
| 675 | 3300053161 | Ga0500634_0000095 | Ga0500634_0000095_7401_8063 | 220 |
| 676 | 3300053162 | Ga0500638_121744 | Ga0500638_121744_293_982 | 220 |
| 677 | 3300006051 | Ga0075364_10001177 | Ga0075364_100011776 | 221 |
| 678 | 3300044673 | Ga0453683_0450766 | Ga0453683_0450766_31_708 | 221 |
| 679 | 3300003187 | JGI25151J46595_10000148 | JGI25151J46595_100001484 | 222 |
| 680 | 3300003187 | JGI25151J46595_10063635 | JGI25151J46595_100636351 | 222 |
| 681 | 3300003771 | Ga0055526_1009856 | Ga0055526_10098565 | 222 |
| 682 | 3300003775 | Ga0055524_1010630 | Ga0055524_10106302 | 222 |
| 683 | 3300003856 | Ga0058692_1000012 | Ga0058692_1000012222 | 222 |
| 684 | 3300014497 | Ga0182008_10011603 | Ga0182008_100116032 | 222 |
| 685 | 3300025245 | Ga0207425_1013633 | Ga0207425_10136332 | 222 |
| 686 | 3300025284 | Ga0209130_1008523 | Ga0209130_10085233 | 222 |
| 687 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005648 | 222 |
| 688 | 3300025294 | Ga0209025_1005818 | Ga0209025_10058189 | 222 |
| 689 | 3300025295 | Ga0209564_1012031 | Ga0209564_10120312 | 222 |
| 690 | 3300025297 | Ga0209758_1014433 | Ga0209758_10144336 | 222 |
| 691 | 3300025297 | Ga0209758_1036125 | Ga0209758_10361252 | 222 |
| 692 | 3300025303 | Ga0209051_1015560 | Ga0209051_10155602 | 222 |
| 693 | 3300025304 | Ga0209257_1000369 | Ga0209257_100036913 | 222 |
| 694 | 3300025304 | Ga0209257_1002588 | Ga0209257_100258816 | 222 |
| 695 | 3300025304 | Ga0209257_1052746 | Ga0209257_10527462 | 222 |
| 696 | 3300038705 | Ga0237819_04805 | Ga0237819_04805_1049_1777 | 222 |
| 697 | 3300041407 | Ga0439447_001882 | Ga0439447_001882_4416_5144 | 222 |
| 698 | 3300049579 | Ga0501043_0005996 | Ga0501043_0005996_5760_6446 | 222 |
| 699 | iso_pu_bacteria | 2643221593 | 2643976710 | 222 |
| 700 | iso_pu_bacteria | 2941489479 | 2941490473 | 222 |
| 701 | 2162886007 | SwRhRL2b_contig_361393 | SwRhRL2b_0571.00007880 | 223 |
| 702 | 3300025914 | Ga0207671_10132651 | Ga0207671_101326512 | 223 |
| 703 | 3300030733 | Ga0314311_1040974 | Ga0314311_10409744 | 223 |
| 704 | 3300038705 | Ga0237819_00252 | Ga0237819_00252_9269_9940 | 223 |
| 705 | 3300047472 | Ga0495686_0034339 | Ga0495686_0034339_927_1598 | 223 |
| 706 | 3300048920 | Ga0496117_0009735 | Ga0496117_0009735_1387_2058 | 223 |
| 707 | 3300048921 | Ga0496118_0109391 | Ga0496118_0109391_796_1467 | 223 |
| 708 | 3300048922 | Ga0496119_0006339 | Ga0496119_0006339_2598_3269 | 223 |
| 709 | 3300048923 | Ga0496120_0002462 | Ga0496120_0002462_15472_16143 | 223 |
| 710 | 3300048925 | Ga0496122_0003014 | Ga0496122_0003014_15484_16155 | 223 |
| 711 | 3300048926 | Ga0496123_0000619 | Ga0496123_0000619_56750_57421 | 223 |
| 712 | 3300048927 | Ga0496124_0008706 | Ga0496124_0008706_2118_2789 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wak-assembly1.cif.gz_A-2 | h. influenzae beta-carbonic anhydrase variant w39v/g41a | 0.9664 | 37 | 219 |
| 4wam-assembly1.cif.gz_B-2 | h. influenzae beta-carbonic anhydrase variant w39v/g41a/p48s/a49p | 0.9654 | 37 | 221 |
| 4waj-assembly1.cif.gz_A-2 | h. influenzae beta-carbonic anhydase variant p48s/a49p | 0.965 | 36 | 221 |
| 4wak-assembly1.cif.gz_B-2 | h. influenzae beta-carbonic anhydrase variant w39v/g41a | 0.9627 | 38 | 217 |
| 3qy1-assembly1.cif.gz_B | 1.54a resolution crystal structure of a beta-carbonic anhydrase from salmonella enterica subsp. enterica serovar typhimurium str. lt2 | 0.9619 | 5 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wamA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9567 | 37 | 223 | 3.40.1050.10 |
| 2a8cA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9541 | 4 | 219 | 3.40.1050.10 |
| 1ddzB02 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9495 | 36 | 223 | 3.40.1050.10 |
| 4wamA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9411 | 37 | 223 | 3.40.1050.10 |
| 2a8cA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.925 | 4 | 219 | 3.40.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354YFJ4-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.9996 | 101 | 223 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A354YFJ4-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.9915 | 101 | 223 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A080M7H3-F1-model_v4 | Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) | 0.9884 | 50 | 218 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A3L7X137-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.9881 | 92 | 214 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A7V7ZFG5-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.9873 | 22 | 217 |
GO:0004089
GO:0008270 GO:0015976 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar