F476808

General Info

Members Datasets Scaffolds Average Seq Length
712 379 657 219

Family's Representative Sequence

Representative Sequence 3300003856|Ga0058692_1000012|Ga0058692_1000012222
Length 251
Sequence MRPPAAAERTDSRDDAAGWPRLAPTEVRDPNMKDIHKLLQNNRDWADRIEKEDPEFFHQLAKQQHPEYLWIGCSDSRVPANQIIGMAPGEVFVHRNVANVVAHTDLNCLSVVQYAVDQLKVKHILIVGHYGCGGVHACLHNTRVGLADNWLRHVGDVMQKHAAIIDALETDELRHARLCELNVIEQVANLCRSTIVQDAWARGQKLMVHGWVYSLKDGRVREMGIDVGSPEDLQPAYEKALSYVPRKGKRD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
26 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
27 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
28 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
29 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
30 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
31 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
32 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
33 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
34 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
35 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
36 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
37 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
38 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
39 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
40 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
41 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
42 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
43 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
44 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
45 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
46 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
47 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
48 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
49 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
50 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
51 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
231 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
232 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
233 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
234 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
235 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
251 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
252 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
253 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
254 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
255 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
272 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
273 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
274 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
275 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
278 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
318 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
346 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
347 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
348 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
349 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
350 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
365 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
372 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 639633007 Azoarcus olearius BH72 Isolate Unclassified
376 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
377 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
378 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
379 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.99
Metatranscriptomes 0.28
Isolates 7.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 13.34
Nodule 0.14
Rhizoplane 1.12
Rhizosphere 72.89
Stem 0
Stem Tuber 0
Unclassified 12.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_361393 2162886007 Bacteria 1544
2 JGI25152J39213_1000032 3300002773 Bacteria 96369
3 JGI25150J39212_1000179 3300002774 Bacteria 35481
4 JGI25151J46595_10000138 3300003187 Bacteria 96369
5 JGI25151J46595_10000148 3300003187 Bacteria 92040
6 JGI25151J46595_10006340 3300003187 Bacteria 5959
7 JGI25151J46595_10063635 3300003187 Bacteria 1159
8 JGI25153J46596_10000102 3300003215 Bacteria 96369
9 rootH1_10150984 3300003323 Bacteria 2742
10 Ga0055526_1000006 3300003771 Bacteria 330857
11 Ga0055526_1000413 3300003771 Bacteria 34618
12 Ga0055526_1009856 3300003771 Bacteria 4532
13 Ga0055537_1000018 3300003773 Bacteria 123452
14 Ga0055537_1000349 3300003773 Bacteria 31443
15 Ga0055524_1000009 3300003775 Bacteria 295254
16 Ga0055524_1010630 3300003775 Bacteria 3652
17 Ga0055524_1018136 3300003775 Bacteria 2454
18 Ga0055536_1002383 3300003781 Bacteria 10598
19 Ga0055536_1003808 3300003781 Bacteria 7949
20 Ga0055536_1052554 3300003781 Bacteria 886
21 Ga0055534_1000004 3300003784 Bacteria 295251
22 Ga0055534_1000073 3300003784 Bacteria 77473
23 Ga0055528_1000003 3300003790 Bacteria 330875
24 Ga0055528_1000080 3300003790 Bacteria 75390
25 Ga0055530_10001767 3300003791 Bacteria 15103
26 Ga0055530_10001774 3300003791 Bacteria 15004
27 Ga0055540_1026811 3300003792 Bacteria 1388
28 Ga0055531_10010111 3300003794 Bacteria 4736
29 Ga0055531_10021508 3300003794 Bacteria 2499
30 Ga0055531_10024202 3300003794 Bacteria 2249
31 Ga0058692_1000012 3300003856 Bacteria 318930
32 Ga0058692_1000023 3300003856 Bacteria 237263
33 Ga0065165_1028945 3300005262 Bacteria 1781
34 Ga0065704_10075451 3300005289 Bacteria 5582
35 Ga0065704_10092418 3300005289 Bacteria 2655
36 Ga0065704_10189581 3300005289 Bacteria 1196
37 Ga0065715_10018126 3300005293 Bacteria 2680
38 Ga0070683_100046821 3300005329 Bacteria 3996
39 Ga0070683_100286536 3300005329 Bacteria 1567
40 Ga0070683_100304324 3300005329 Bacteria 1517
41 Ga0070683_100838805 3300005329 Bacteria 881
42 Ga0070690_100020353 3300005330 Bacteria 4042
43 Ga0070690_100359015 3300005330 Bacteria 1060
44 Ga0070670_100005062 3300005331 Bacteria 11088
45 Ga0070670_100006427 3300005331 Bacteria 9947
46 Ga0070670_100257850 3300005331 Bacteria 1520
47 Ga0068869_100098086 3300005334 Bacteria 2213
48 Ga0068869_100395013 3300005334 Bacteria 1136
49 Ga0070666_10045825 3300005335 Bacteria 2931
50 Ga0070680_100001505 3300005336 Bacteria 16973
51 Ga0068868_100069326 3300005338 Bacteria 2810
52 Ga0068868_100199320 3300005338 Bacteria 1668
53 Ga0070660_100013111 3300005339 Bacteria 5936
54 Ga0070661_100004441 3300005344 Bacteria 9667
55 Ga0070661_100034944 3300005344 Bacteria 3648
56 Ga0070661_100169457 3300005344 Bacteria 1657
57 Ga0070692_10079260 3300005345 Bacteria 1765
58 Ga0070668_100036424 3300005347 Bacteria 3755
59 Ga0070669_100034776 3300005353 Bacteria 3648
60 Ga0070671_100441589 3300005355 Bacteria 1116
61 Ga0070673_100346063 3300005364 Bacteria 1318
62 Ga0070659_100085406 3300005366 Bacteria 2524
63 Ga0070659_100092088 3300005366 Bacteria 2430
64 Ga0070667_100307439 3300005367 Bacteria 1428
65 Ga0070709_10061270 3300005434 Bacteria 2395
66 Ga0070709_10202746 3300005434 Bacteria 1406
67 Ga0070709_10613153 3300005434 Bacteria 839
68 Ga0070711_100097760 3300005439 Bacteria 2129
69 Ga0070708_100504604 3300005445 Bacteria 1141
70 Ga0070663_100021396 3300005455 Bacteria 4302
71 Ga0070663_100033313 3300005455 Bacteria 3558
72 Ga0070678_100012656 3300005456 Bacteria 5257
73 Ga0070678_100065671 3300005456 Bacteria 2695
74 Ga0070678_100120486 3300005456 Bacteria 2068
75 Ga0070662_100028679 3300005457 Bacteria 3875
76 Ga0070681_10000012 3300005458 Bacteria 137191
77 Ga0068867_100133985 3300005459 Bacteria 1929
78 Ga0068867_100350436 3300005459 Bacteria 1232
79 Ga0068867_100553248 3300005459 Bacteria 997
80 Ga0070707_100520016 3300005468 Bacteria 1152
81 Ga0070679_100287197 3300005530 Bacteria 1597
82 Ga0070684_100132806 3300005535 Bacteria 2246
83 Ga0070684_100168800 3300005535 Bacteria 1987
84 Ga0068853_100002556 3300005539 Bacteria 13665
85 Ga0068853_100035121 3300005539 Bacteria 4257
86 Ga0068853_100044654 3300005539 Bacteria 3794
87 Ga0068853_100057145 3300005539 Bacteria 3366
88 Ga0068853_100088307 3300005539 Bacteria 2721
89 Ga0070672_100194202 3300005543 Bacteria 1696
90 Ga0070695_100286739 3300005545 Bacteria 1212
91 Ga0070696_100160901 3300005546 Bacteria 1654
92 Ga0070696_100168693 3300005546 Bacteria 1617
93 Ga0070693_100014699 3300005547 Bacteria 4017
94 Ga0070693_100042263 3300005547 Bacteria 2568
95 Ga0070693_100053888 3300005547 Bacteria 2311
96 Ga0070693_100081803 3300005547 Bacteria 1927
97 Ga0070665_100008352 3300005548 Bacteria 10476
98 Ga0070665_100024712 3300005548 Bacteria 6053
99 Ga0070665_100052946 3300005548 Bacteria 4071
100 Ga0070665_100122005 3300005548 Bacteria 2608
101 Ga0070665_100218674 3300005548 Bacteria 1905
102 Ga0070665_100329810 3300005548 Bacteria 1530
103 Ga0070704_100162187 3300005549 Bacteria 1769
104 Ga0070704_100513108 3300005549 Bacteria 1042
105 Ga0068855_100023493 3300005563 Bacteria 7383
106 Ga0068855_100026787 3300005563 Bacteria 6897
107 Ga0068855_100050085 3300005563 Bacteria 4923
108 Ga0068855_100189138 3300005563 Bacteria 2323
109 Ga0068857_100111694 3300005577 Bacteria 2457
110 Ga0068857_100398225 3300005577 Bacteria 1281
111 Ga0068854_100025642 3300005578 Bacteria 4046
112 Ga0068854_100062852 3300005578 Bacteria 2694
113 Ga0068856_100027551 3300005614 Bacteria 5542
114 Ga0068856_100109651 3300005614 Bacteria 2757
115 Ga0068856_100445861 3300005614 Bacteria 1315
116 Ga0068852_100028067 3300005616 Bacteria 4600
117 Ga0068852_100028444 3300005616 Bacteria 4576
118 Ga0068852_100106305 3300005616 Bacteria 2544
119 Ga0068852_100243827 3300005616 Bacteria 1719
120 Ga0068852_100297989 3300005616 Bacteria 1560
121 Ga0068852_100493277 3300005616 Bacteria 1219
122 Ga0068859_100008242 3300005617 Bacteria 10570
123 Ga0068859_100285598 3300005617 Bacteria 1743
124 Ga0068859_100747029 3300005617 Bacteria 1067
125 Ga0068864_100897479 3300005618 Bacteria 875
126 Ga0068866_10000607 3300005718 Bacteria 16367
127 Ga0068861_100282702 3300005719 Bacteria 1429
128 Ga0068851_10001171 3300005834 Bacteria 11377
129 Ga0068870_10263246 3300005840 Bacteria 1074
130 Ga0068863_100001454 3300005841 Bacteria 23498
131 Ga0068863_100027859 3300005841 Bacteria 5393
132 Ga0068863_100094369 3300005841 Bacteria 2839
133 Ga0068858_100000536 3300005842 Bacteria 39539
134 Ga0068858_100026329 3300005842 Bacteria 5405
135 Ga0068860_100101399 3300005843 Bacteria 2746
136 Ga0068862_100224242 3300005844 Bacteria 1703
137 Ga0068862_100638289 3300005844 Bacteria 1026
138 Ga0081540_1047353 3300005983 Bacteria 2163
139 Ga0075364_10001177 3300006051 Bacteria 14015
140 Ga0075364_10327832 3300006051 Bacteria 1043
141 Ga0075369_10025543 3300006186 Bacteria 2457
142 Ga0097621_100005955 3300006237 Bacteria 8621
143 Ga0097621_100008756 3300006237 Bacteria 7310
144 Ga0097621_100186509 3300006237 Bacteria 1794
145 Ga0097621_100676139 3300006237 Unclassified 949
146 Ga0075370_10109882 3300006353 Bacteria 1600
147 Ga0068871_100056678 3300006358 Bacteria 3186
148 Ga0068871_100253128 3300006358 Bacteria 1534
149 Ga0068871_100822044 3300006358 Bacteria 857
150 Ga0075428_100395255 3300006844 Bacteria 1482
151 Ga0075428_101169852 3300006844 Bacteria 811
152 Ga0068865_100003919 3300006881 Bacteria 8931
153 Ga0075436_100114536 3300006914 Bacteria 1883
154 Ga0097620_100008242 3300006931 Bacteria 10570
155 Ga0097620_100285595 3300006931 Bacteria 1743
156 Ga0097620_100746999 3300006931 Bacteria 1067
157 Ga0105251_10000108 3300009011 Bacteria 81679
158 Ga0105251_10006958 3300009011 Bacteria 7082
159 Ga0105244_10034596 3300009036 Bacteria 2658
160 Ga0105240_10019161 3300009093 Bacteria 9149
161 Ga0105240_10021493 3300009093 Bacteria 8580
162 Ga0105240_10207087 3300009093 Bacteria 2295
163 Ga0105240_10301577 3300009093 Bacteria 1833
164 Ga0105240_11297319 3300009093 Bacteria 768
165 Ga0111539_10137303 3300009094 Bacteria 2863
166 Ga0111539_10139798 3300009094 Bacteria 2835
167 Ga0105245_10129285 3300009098 Bacteria 2367
168 Ga0105245_10257448 3300009098 Bacteria 1697
169 Ga0105247_10083347 3300009101 Bacteria 2019
170 Ga0105243_10003658 3300009148 Bacteria 12371
171 Ga0105243_10099579 3300009148 Bacteria 2409
172 Ga0105241_10108872 3300009174 Bacteria 2215
173 Ga0105241_10123844 3300009174 Bacteria 2085
174 Ga0105241_10185844 3300009174 Bacteria 1727
175 Ga0105241_10193083 3300009174 Bacteria 1696
176 Ga0105241_10486851 3300009174 Bacteria 1097
177 Ga0105242_10060546 3300009176 Bacteria 3111
178 Ga0105242_10375978 3300009176 Bacteria 1319
179 Ga0105242_10392253 3300009176 Bacteria 1293
180 Ga0105248_10038118 3300009177 Bacteria 5378
181 Ga0105248_10039461 3300009177 Bacteria 5288
182 Ga0105248_10132191 3300009177 Bacteria 2816
183 Ga0105237_10089736 3300009545 Bacteria 3063
184 Ga0105237_10737769 3300009545 Bacteria 991
185 Ga0105238_10006153 3300009551 Bacteria 11913
186 Ga0105238_10132174 3300009551 Unclassified 2474
187 Ga0105238_10326143 3300009551 Bacteria 1522
188 Ga0105238_11103891 3300009551 Bacteria 816
189 Ga0105249_10035359 3300009553 Bacteria 4531
190 Ga0105249_10040632 3300009553 Bacteria 4225
191 Ga0105249_10160398 3300009553 Bacteria 2173
192 Ga0105249_11013869 3300009553 Bacteria 899
193 Ga0105239_10005877 3300010375 Bacteria 14301
194 Ga0105239_10073434 3300010375 Bacteria 3761
195 Ga0105239_10104064 3300010375 Bacteria 3143
196 Ga0105239_10178608 3300010375 Bacteria 2375
197 Ga0105239_10205582 3300010375 Bacteria 2206
198 Ga0105239_10275318 3300010375 Bacteria 1894
199 Ga0105246_10004572 3300011119 Bacteria 8423
200 Ga0157324_1006905 3300012506 Bacteria 870
201 Ga0157373_10709621 3300013100 Bacteria 737
202 Ga0157371_10003647 3300013102 Bacteria 13861
203 Ga0157371_10014602 3300013102 Bacteria 5920
204 Ga0157370_10015715 3300013104 Bacteria 7686
205 Ga0157370_10124688 3300013104 Bacteria 2405
206 Ga0157370_10301153 3300013104 Bacteria 1480
207 Ga0157370_10530528 3300013104 Bacteria 1080
208 Ga0157369_10187283 3300013105 Bacteria 2176
209 Ga0157369_10195896 3300013105 Bacteria 2122
210 Ga0157369_10685206 3300013105 Bacteria 1056
211 Ga0157374_10042784 3300013296 Bacteria 4180
212 Ga0157378_10084089 3300013297 Bacteria 2881
213 Ga0157378_10959925 3300013297 Bacteria 888
214 Ga0163162_10549912 3300013306 Bacteria 1283
215 Ga0163162_10570994 3300013306 Bacteria 1258
216 Ga0157372_10070485 3300013307 Bacteria 3933
217 Ga0157372_10205339 3300013307 Bacteria 2283
218 Ga0157372_10340649 3300013307 Bacteria 1746
219 Ga0157372_10741110 3300013307 Bacteria 1143
220 Ga0157375_10080866 3300013308 Bacteria 3288
221 Ga0157375_10143675 3300013308 Bacteria 2515
222 Ga0157375_11226699 3300013308 Bacteria 880
223 Ga0163163_10002084 3300014325 Bacteria 16888
224 Ga0163163_10695035 3300014325 Bacteria 1081
225 Ga0157380_10008451 3300014326 Bacteria 7353
226 Ga0157380_10379597 3300014326 Bacteria 1333
227 Ga0182008_10001765 3300014497 Bacteria 14173
228 Ga0182008_10002596 3300014497 Bacteria 11222
229 Ga0182008_10011603 3300014497 Bacteria 4679
230 Ga0157377_10024904 3300014745 Bacteria 3185
231 Ga0157379_10057159 3300014968 Bacteria 3486
232 Ga0157376_10000734 3300014969 Bacteria 21294
233 Ga0157376_10006463 3300014969 Bacteria 8281
234 Ga0182006_1023402 3300015261 Bacteria 2559
235 Ga0182006_1040986 3300015261 Bacteria 1820
236 Ga0182007_10000353 3300015262 Bacteria 29023
237 Ga0182005_1000344 3300015265 Bacteria 26562
238 Ga0182005_1008509 3300015265 Bacteria 3022
239 Ga0183360_10001 3300015689 Bacteria 3943671
240 Ga0163161_10002464 3300017792 Bacteria 13212
241 Ga0163161_10173715 3300017792 Bacteria 1649
242 Ga0163161_10516927 3300017792 Bacteria 974
243 Ga0206350_10119238 3300020080 Bacteria 1247
244 Ga0224712_10059437 3300022467 Bacteria 1518
245 Ga0207425_1000078 3300025245 Bacteria 104429
246 Ga0207425_1013633 3300025245 Bacteria 1871
247 Ga0209129_1000157 3300025258 Bacteria 105043
248 Ga0209565_1000001 3300025263 Bacteria 2950419
249 Ga0209565_1000022 3300025263 Bacteria 390888
250 Ga0209673_1000001 3300025273 Bacteria 3176258
251 Ga0209673_1000087 3300025273 Bacteria 205213
252 Ga0209673_1050296 3300025273 Bacteria 1108
253 Ga0209130_1008523 3300025284 Bacteria 3019
254 Ga0209130_1016302 3300025284 Bacteria 1802
255 Ga0209675_1000001 3300025291 Bacteria 2950293
256 Ga0209675_1000060 3300025291 Bacteria 184316
257 Ga0209675_1012289 3300025291 Bacteria 2771
258 Ga0209676_1000011 3300025292 Bacteria 860463
259 Ga0209676_1000114 3300025292 Bacteria 207416
260 Ga0209676_1000976 3300025292 Bacteria 34430
261 Ga0209676_1005140 3300025292 Bacteria 6962
262 Ga0209676_1007576 3300025292 Bacteria 5053
263 Ga0209676_1016951 3300025292 Bacteria 2601
264 Ga0209025_1000005 3300025294 Bacteria 1272149
265 Ga0209025_1000034 3300025294 Bacteria 413205
266 Ga0209025_1000054 3300025294 Bacteria 317002
267 Ga0209025_1005818 3300025294 Bacteria 9879
268 Ga0209025_1017520 3300025294 Bacteria 4126
269 Ga0209025_1035642 3300025294 Bacteria 2244
270 Ga0209564_1000001 3300025295 Bacteria 3176258
271 Ga0209564_1000302 3300025295 Bacteria 97770
272 Ga0209564_1012031 3300025295 Bacteria 3813
273 Ga0209758_1000062 3300025297 Bacteria 317002
274 Ga0209758_1014433 3300025297 Bacteria 4202
275 Ga0209758_1036125 3300025297 Bacteria 1935
276 Ga0209758_1037028 3300025297 Bacteria 1893
277 Ga0209050_1001760 3300025298 Bacteria 21464
278 Ga0209050_1002154 3300025298 Bacteria 17919
279 Ga0209050_1009716 3300025298 Bacteria 4873
280 Ga0209256_1000002 3300025299 Bacteria 1906740
281 Ga0209256_1001644 3300025299 Bacteria 21742
282 Ga0209256_1003341 3300025299 Bacteria 11380
283 Ga0209256_1017426 3300025299 Bacteria 2384
284 Ga0209051_1000606 3300025303 Bacteria 41704
285 Ga0209051_1015286 3300025303 Bacteria 3538
286 Ga0209051_1015560 3300025303 Bacteria 3492
287 Ga0209257_1000014 3300025304 Bacteria 946850
288 Ga0209257_1000080 3300025304 Bacteria 312038
289 Ga0209257_1000369 3300025304 Bacteria 90982
290 Ga0209257_1002588 3300025304 Bacteria 17583
291 Ga0209257_1006360 3300025304 Bacteria 7662
292 Ga0209257_1009732 3300025304 Bacteria 5052
293 Ga0209257_1052746 3300025304 Bacteria 1141
294 Ga0207656_10003911 3300025321 Bacteria 5161
295 Ga0207656_10269159 3300025321 Bacteria 838
296 Ga0207713_1000507 3300025735 Bacteria 39676
297 Ga0207713_1007579 3300025735 Bacteria 6371
298 Ga0207710_10030140 3300025900 Bacteria 2365
299 Ga0207680_10014375 3300025903 Bacteria 4093
300 Ga0207680_10057263 3300025903 Bacteria 2358
301 Ga0207647_10000091 3300025904 Bacteria 68421
302 Ga0207699_10313383 3300025906 Bacteria 1099
303 Ga0207645_10038396 3300025907 Bacteria 3070
304 Ga0207705_10043453 3300025909 Bacteria 3229
305 Ga0207654_10152279 3300025911 Bacteria 1485
306 Ga0207654_10160426 3300025911 Bacteria 1452
307 Ga0207707_10000948 3300025912 Bacteria 27952
308 Ga0207695_10036911 3300025913 Bacteria 5277
309 Ga0207695_10046068 3300025913 Bacteria 4624
310 Ga0207695_10106215 3300025913 Bacteria 2794
311 Ga0207695_10115289 3300025913 Bacteria 2661
312 Ga0207695_10599837 3300025913 Bacteria 982
313 Ga0207671_10016712 3300025914 Bacteria 5695
314 Ga0207671_10049438 3300025914 Bacteria 3113
315 Ga0207671_10132651 3300025914 Bacteria 1913
316 Ga0207671_10175045 3300025914 Bacteria 1668
317 Ga0207671_10187152 3300025914 Bacteria 1613
318 Ga0207663_10112070 3300025916 Bacteria 1852
319 Ga0207663_10364568 3300025916 Bacteria 1097
320 Ga0207660_10017505 3300025917 Bacteria 4762
321 Ga0207649_10014919 3300025920 Bacteria 4359
322 Ga0207649_10319698 3300025920 Bacteria 1140
323 Ga0207681_10735096 3300025923 Bacteria 822
324 Ga0207694_10005892 3300025924 Bacteria 9394
325 Ga0207694_10014435 3300025924 Bacteria 5955
326 Ga0207694_10244093 3300025924 Bacteria 1468
327 Ga0207650_10005976 3300025925 Bacteria 8307
328 Ga0207650_10044411 3300025925 Bacteria 3266
329 Ga0207650_10240986 3300025925 Bacteria 1461
330 Ga0207644_10190828 3300025931 Bacteria 1611
331 Ga0207706_10005093 3300025933 Bacteria 12271
332 Ga0207686_10065515 3300025934 Bacteria 2317
333 Ga0207686_10332711 3300025934 Bacteria 1138
334 Ga0207709_10004718 3300025935 Bacteria 7831
335 Ga0207709_10004839 3300025935 Bacteria 7716
336 Ga0207670_10149810 3300025936 Bacteria 1730
337 Ga0207704_10040853 3300025938 Bacteria 2715
338 Ga0207691_10013867 3300025940 Bacteria 7692
339 Ga0207691_10023402 3300025940 Bacteria 5814
340 Ga0207691_10032680 3300025940 Bacteria 4850
341 Ga0207691_10066248 3300025940 Bacteria 3268
342 Ga0207711_10348087 3300025941 Bacteria 1372
343 Ga0207689_10007328 3300025942 Bacteria 9677
344 Ga0207689_10255683 3300025942 Bacteria 1449
345 Ga0207661_10029832 3300025944 Bacteria 4193
346 Ga0207661_10146624 3300025944 Bacteria 2037
347 Ga0207661_10405971 3300025944 Bacteria 1236
348 Ga0207667_10001306 3300025949 Bacteria 31238
349 Ga0207667_10002925 3300025949 Bacteria 21206
350 Ga0207667_10017552 3300025949 Bacteria 8050
351 Ga0207667_10139507 3300025949 Bacteria 2496
352 Ga0207667_10179655 3300025949 Bacteria 2173
353 Ga0207667_10413324 3300025949 Bacteria 1373
354 Ga0207651_10154167 3300025960 Bacteria 1793
355 Ga0207712_10000254 3300025961 Bacteria 51558
356 Ga0207712_10016600 3300025961 Bacteria 4772
357 Ga0207668_10014664 3300025972 Bacteria 4854
358 Ga0207668_10020502 3300025972 Bacteria 4201
359 Ga0207668_10169891 3300025972 Bacteria 1709
360 Ga0207640_10017834 3300025981 Bacteria 4160
361 Ga0207640_10045968 3300025981 Bacteria 2806
362 Ga0207640_11038987 3300025981 Bacteria 722
363 Ga0207658_10078539 3300025986 Bacteria 2522
364 Ga0207658_10183606 3300025986 Bacteria 1733
365 Ga0207703_10000925 3300026035 Bacteria 28593
366 Ga0207703_10018256 3300026035 Bacteria 5477
367 Ga0207703_10041366 3300026035 Bacteria 3692
368 Ga0207703_10688500 3300026035 Bacteria 972
369 Ga0207639_10000234 3300026041 Bacteria 41445
370 Ga0207639_10000772 3300026041 Bacteria 21837
371 Ga0207639_10016173 3300026041 Bacteria 5271
372 Ga0207639_10040551 3300026041 Bacteria 3476
373 Ga0207678_10020429 3300026067 Bacteria 5807
374 Ga0207678_10068183 3300026067 Bacteria 3053
375 Ga0207678_10237318 3300026067 Bacteria 1561
376 Ga0207678_10250041 3300026067 Bacteria 1518
377 Ga0207702_10015023 3300026078 Bacteria 6420
378 Ga0207702_10109566 3300026078 Bacteria 2452
379 Ga0207702_10138612 3300026078 Bacteria 2198
380 Ga0207702_10252260 3300026078 Bacteria 1657
381 Ga0207702_10502343 3300026078 Bacteria 1182
382 Ga0207641_10021908 3300026088 Bacteria 5253
383 Ga0207641_10049896 3300026088 Bacteria 3538
384 Ga0207641_10658556 3300026088 Bacteria 1029
385 Ga0207641_10898435 3300026088 Bacteria 879
386 Ga0207648_10019234 3300026089 Bacteria 6164
387 Ga0207648_10087675 3300026089 Bacteria 2716
388 Ga0207676_10192170 3300026095 Bacteria 1797
389 Ga0207674_10422446 3300026116 Bacteria 1288
390 Ga0207675_100006718 3300026118 Bacteria 10877
391 Ga0207675_100073715 3300026118 Bacteria 3194
392 Ga0207683_10003087 3300026121 Bacteria 14551
393 Ga0207683_10030154 3300026121 Bacteria 4698
394 Ga0207683_10178672 3300026121 Bacteria 1924
395 Ga0207683_10202414 3300026121 Bacteria 1805
396 Ga0207683_10282421 3300026121 Bacteria 1517
397 Ga0207698_10069321 3300026142 Bacteria 2788
398 Ga0207698_10098523 3300026142 Bacteria 2416
399 Ga0207698_10116399 3300026142 Bacteria 2253
400 Ga0207698_10863400 3300026142 Bacteria 910
401 Ga0209371_1000007 3300027312 Bacteria 1050654
402 Ga0209371_1000059 3300027312 Bacteria 237154
403 Ga0268266_10000006 3300028379 Bacteria 1410021
404 Ga0268266_10021365 3300028379 Bacteria 5514
405 Ga0268266_10294979 3300028379 Bacteria 1511
406 Ga0268265_10002801 3300028380 Bacteria 12848
407 Ga0268265_10263336 3300028380 Bacteria 1534
408 Ga0268264_10009178 3300028381 Bacteria 8194
409 Ga0268264_10133032 3300028381 Bacteria 2208
410 Ga0268264_10157462 3300028381 Bacteria 2043
411 Ga0268256_1000008 3300030500 Bacteria 1050654
412 Ga0268256_1000055 3300030500 Bacteria 237299
413 Ga0307511_10000003 3300030521 Bacteria 193269
414 Ga0316176_1153914 3300030732 Bacteria 1789
415 Ga0314311_1040974 3300030733 Bacteria 4728
416 Ga0316183_1068246 3300030742 Bacteria 2858
417 Ga0316181_1203139 3300030744 Bacteria 842
418 Ga0265339_10104538 3300031249 Bacteria 1471
419 Ga0265316_10499455 3300031344 Unclassified 869
420 Ga0307509_10277799 3300031507 Bacteria 1438
421 Ga0307408_100002840 3300031548 Bacteria 12016
422 Ga0307408_100254352 3300031548 Bacteria 1450
423 Ga0265314_10018124 3300031711 Bacteria 5501
424 Ga0316576_10042200 3300031727 Bacteria 3287
425 Ga0316578_10098995 3300031728 Bacteria 1747
426 Ga0316577_10053334 3300031733 Bacteria 2257
427 Ga0307413_10122562 3300031824 Bacteria 1764
428 Ga0307413_10264385 3300031824 Bacteria 1284
429 Ga0307410_10279501 3300031852 Bacteria 1309
430 Ga0307406_10090306 3300031901 Bacteria 2061
431 Ga0307406_10232961 3300031901 Bacteria 1376
432 Ga0307407_10152782 3300031903 Bacteria 1502
433 Ga0307407_10218511 3300031903 Bacteria 1287
434 Ga0307412_10209788 3300031911 Bacteria 1485
435 Ga0307412_10617837 3300031911 Bacteria 920
436 Ga0307409_100903467 3300031995 Bacteria 897
437 Ga0307416_100529727 3300032002 Bacteria 1248
438 Ga0307414_10163842 3300032004 Bacteria 1769
439 Ga0307414_10280672 3300032004 Bacteria 1399
440 Ga0307411_10037108 3300032005 Bacteria 3060
441 Ga0307411_10125552 3300032005 Bacteria 1865
442 Ga0307411_10155936 3300032005 Bacteria 1703
443 Ga0307411_10254234 3300032005 Bacteria 1383
444 Ga0307415_100812735 3300032126 Bacteria 854
445 Ga0316585_10031830 3300032137 Bacteria 1660
446 Ga0307507_10135851 3300033179 Bacteria 1905
447 Ga0307507_10183106 3300033179 Bacteria 1492
448 Ga0307507_10238405 3300033179 Bacteria 1194
449 Ga0373931_0088187 3300035691 Bacteria 1724
450 Ga0373937_0341636 3300036401 Bacteria 1418
451 Ga0316582_0001391 3300036647 Bacteria 10547
452 Ga0316582_0307274 3300036647 Bacteria 1090
453 Ga0316584_0001928 3300036712 Bacteria 12921
454 Ga0395899_0021657 3300037312 Bacteria 4874
455 Ga0395900_0016564 3300037418 Bacteria 7520
456 Ga0395898_0108711 3300037466 Bacteria 2659
457 Ga0395905_0000577 3300037471 Bacteria 49489
458 Ga0395905_0155418 3300037471 Bacteria 2151
459 Ga0395905_0185824 3300037471 Bacteria 1950
460 Ga0316581_0000607 3300037588 Bacteria 7100
461 Ga0436364_0752000 3300037853 Bacteria 7022
462 Ga0237819_00252 3300038705 Bacteria 19595
463 Ga0237819_04805 3300038705 Bacteria 2178
464 Ga0237819_08451 3300038705 Bacteria 1424
465 Ga0439436_0009189 3300041404 Bacteria 3032
466 Ga0439436_0009600 3300041404 Bacteria 2968
467 Ga0439439_0086282 3300041406 Bacteria 853
468 Ga0439447_001882 3300041407 Bacteria 7675
469 Ga0439465_0009303 3300041413 Bacteria 3095
470 Ga0451800_0056998 3300041459 Bacteria 1435
471 Ga0451806_353890 3300041462 Bacteria 796
472 Ga0451807_0568998 3300041486 Bacteria 2052
473 Ga0451807_2639821 3300041486 Bacteria 2105
474 Ga0451837_1006580 3300041494 Bacteria 3664
475 Ga0451837_1499872 3300041494 Bacteria 1544
476 Ga0451843_1634350 3300041509 Bacteria 3214
477 Ga0451853_3632959 3300041512 Bacteria 1600
478 Ga0451853_3672467 3300041512 Bacteria 766
479 Ga0439433_0038905 3300041999 Bacteria 1104
480 Ga0439432_004313 3300042006 Bacteria 5201
481 Ga0439432_030073 3300042006 Bacteria 1763
482 Ga0439449_0004776 3300042007 Bacteria 5230
483 Ga0439449_0013127 3300042007 Bacteria 3116
484 Ga0439449_0015192 3300042007 Bacteria 2892
485 Ga0439449_0119892 3300042007 Bacteria 976
486 Ga0439462_0010907 3300042015 Bacteria 2308
487 Ga0439434_0052358 3300042435 Bacteria 1267
488 Ga0451577_0002034 3300042876 Bacteria 25030
489 Ga0451577_0008871 3300042876 Bacteria 9733
490 Ga0451577_0030380 3300042876 Bacteria 4883
491 Ga0466969_0035455 3300044656 Bacteria 2523
492 Ga0466972_0016307 3300044658 Bacteria 3713
493 Ga0466977_0005295 3300044666 Bacteria 6687
494 Ga0453683_0450766 3300044673 Bacteria 832
495 Ga0466970_0007619 3300044765 Bacteria 5427
496 Ga0451576_0166976 3300045051 Bacteria 2297
497 Ga0495603_0023973 3300046455 Bacteria 3691
498 Ga0495638_0010655 3300046460 Bacteria 6367
499 Ga0495638_0104326 3300046460 Bacteria 1691
500 Ga0495618_0384332 3300046514 Bacteria 861
501 Ga0495643_0003481 3300046522 Bacteria 11485
502 Ga0495643_0063033 3300046522 Bacteria 1961
503 Ga0495644_0034682 3300046523 Bacteria 1905
504 Ga0495621_0007405 3300046539 Bacteria 3249
505 Ga0495633_0022960 3300046558 Bacteria 3094
506 Ga0495656_0003220 3300046615 Bacteria 5505
507 Ga0495656_0029624 3300046615 Bacteria 2205
508 Ga0495656_0120780 3300046615 Bacteria 1236
509 Ga0495668_0001767 3300046616 Bacteria 19788
510 Ga0495625_0095761 3300046660 Bacteria 2045
511 Ga0495659_0053577 3300046664 Bacteria 1474
512 Ga0495657_0440063 3300046675 Bacteria 764
513 Ga0495670_0146339 3300046691 Bacteria 1238
514 Ga0495649_0185215 3300046694 Bacteria 1085
515 Ga0495636_0000522 3300047318 Bacteria 14147
516 Ga0495636_0026155 3300047318 Bacteria 2372
517 Ga0495672_0000455 3300047320 Bacteria 48439
518 Ga0495672_0193773 3300047320 Bacteria 1020
519 Ga0495686_0034339 3300047472 Bacteria 3267
520 Ga0495602_0227825 3300048088 Bacteria 1402
521 Ga0496100_0220480 3300048903 Bacteria 1392
522 Ga0496104_0283679 3300048907 Bacteria 1569
523 Ga0496105_0139808 3300048908 Bacteria 1993
524 Ga0496108_0084460 3300048911 Bacteria 2694
525 Ga0496116_0088184 3300048919 Bacteria 1896
526 Ga0496117_0005879 3300048920 Bacteria 12682
527 Ga0496117_0006203 3300048920 Bacteria 12192
528 Ga0496117_0009735 3300048920 Bacteria 8868
529 Ga0496117_0186420 3300048920 Bacteria 1186
530 Ga0496118_0000362 3300048921 Bacteria 76786
531 Ga0496118_0001608 3300048921 Bacteria 33395
532 Ga0496118_0006389 3300048921 Bacteria 12979
533 Ga0496118_0109391 3300048921 Bacteria 1839
534 Ga0496119_0000851 3300048922 Bacteria 40261
535 Ga0496119_0006339 3300048922 Bacteria 11010
536 Ga0496119_0038877 3300048922 Bacteria 3066
537 Ga0496120_0001387 3300048923 Bacteria 29403
538 Ga0496120_0002462 3300048923 Bacteria 18657
539 Ga0496120_0062248 3300048923 Bacteria 2079
540 Ga0496121_0000755 3300048924 Bacteria 59452
541 Ga0496121_0054362 3300048924 Bacteria 3346
542 Ga0496122_0003014 3300048925 Bacteria 22846
543 Ga0496122_0003143 3300048925 Bacteria 22097
544 Ga0496122_0027624 3300048925 Bacteria 4843
545 Ga0496122_0035854 3300048925 Bacteria 4025
546 Ga0496122_0093335 3300048925 Bacteria 2042
547 Ga0496123_0000619 3300048926 Bacteria 59624
548 Ga0496123_0000624 3300048926 Bacteria 59382
549 Ga0496123_0050826 3300048926 Bacteria 2766
550 Ga0496123_0092211 3300048926 Bacteria 1793
551 Ga0496124_0008706 3300048927 Bacteria 10546
552 Ga0496124_0009017 3300048927 Bacteria 10320
553 Ga0496124_0015807 3300048927 Bacteria 7211
554 Ga0496124_0030624 3300048927 Bacteria 4773
555 Ga0496124_0058441 3300048927 Bacteria 3243
556 Ga0496124_0264456 3300048927 Bacteria 1263
557 Ga0496124_0306334 3300048927 Bacteria 1144
558 Ga0496124_0307127 3300048927 Bacteria 1143
559 Ga0496125_0008250 3300048928 Bacteria 10940
560 Ga0496125_0059747 3300048928 Bacteria 3068
561 Ga0496125_0065237 3300048928 Bacteria 2886
562 Ga0496125_0102563 3300048928 Bacteria 2102
563 Ga0496125_0105881 3300048928 Bacteria 2054
564 Ga0496125_0233973 3300048928 Bacteria 1172
565 Ga0496126_0023054 3300048929 Bacteria 6035
566 Ga0496126_0110602 3300048929 Bacteria 2393
567 Ga0496126_0197160 3300048929 Bacteria 1702
568 Ga0501031_0005651 3300049568 Bacteria 8147
569 Ga0501031_0055663 3300049568 Bacteria 2577
570 Ga0501032_0002312 3300049569 Bacteria 14953
571 Ga0501032_0160109 3300049569 Bacteria 1478
572 Ga0501033_0005030 3300049570 Bacteria 10525
573 Ga0501033_0079198 3300049570 Bacteria 2411
574 Ga0501034_0008806 3300049571 Bacteria 10620
575 Ga0501034_0018896 3300049571 Bacteria 7060
576 Ga0501034_0136878 3300049571 Bacteria 2430
577 Ga0501034_0184183 3300049571 Bacteria 2052
578 Ga0501036_0091661 3300049572 Bacteria 2567
579 Ga0501037_0001246 3300049573 Bacteria 18764
580 Ga0501037_0545376 3300049573 Bacteria 783
581 Ga0501038_0001377 3300049574 Bacteria 22209
582 Ga0501038_0013359 3300049574 Bacteria 7487
583 Ga0501038_0159496 3300049574 Bacteria 1834
584 Ga0501038_0531520 3300049574 Bacteria 896
585 Ga0501039_0003424 3300049575 Bacteria 11840
586 Ga0501039_0012931 3300049575 Bacteria 6382
587 Ga0501040_0005666 3300049576 Bacteria 8072
588 Ga0501042_0038328 3300049578 Bacteria 3405
589 Ga0501042_0428833 3300049578 Bacteria 958
590 Ga0501043_0005996 3300049579 Bacteria 9768
591 Ga0501043_0157290 3300049579 Bacteria 1777
592 Ga0501046_0006111 3300049580 Bacteria 10705
593 Ga0501046_0026272 3300049580 Bacteria 4755
594 Ga0501046_0038896 3300049580 Bacteria 3815
595 Ga0501047_0009516 3300049581 Bacteria 9183
596 Ga0501047_0121320 3300049581 Bacteria 2496
597 Ga0501047_0136853 3300049581 Bacteria 2330
598 Ga0501047_0167768 3300049581 Bacteria 2065
599 Ga0501048_0054480 3300049582 Bacteria 2841
600 Ga0501067_0162401 3300049583 Bacteria 1244
601 Ga0501068_0069669 3300049584 Bacteria 2145
602 Ga0501070_0153088 3300049586 Bacteria 1902
603 Ga0501071_0005629 3300049587 Bacteria 8076
604 Ga0501071_0125343 3300049587 Bacteria 1906
605 Ga0501072_0010759 3300049588 Bacteria 6972
606 Ga0501073_0024001 3300049589 Bacteria 4379
607 Ga0501073_0126285 3300049589 Bacteria 1773
608 Ga0501073_0272644 3300049589 Bacteria 1167
609 Ga0501073_0299458 3300049589 Bacteria 1109
610 Ga0501075_0000416 3300049591 Bacteria 24892
611 Ga0501076_0003140 3300049592 Bacteria 11517
612 Ga0501077_0024700 3300049593 Bacteria 3816
613 Ga0501202_038795 3300049652 Bacteria 1022
614 Ga0501207_032009 3300049654 Bacteria 887
615 Ga0501209_000193 3300049656 Bacteria 7067
616 Ga0501223_048880 3300049663 Bacteria 821
617 Ga0501250_002719 3300049680 Bacteria 1627
618 Ga0501250_011568 3300049680 Bacteria 1030
619 Ga0501257_030626 3300049686 Bacteria 1296
620 Ga0501079_0015199 3300049741 Bacteria 5870
621 Ga0501079_0441093 3300049741 Bacteria 1022
622 Ga0501079_0528987 3300049741 Bacteria 927
623 Ga0501080_0066584 3300049742 Bacteria 3350
624 Ga0501080_0080105 3300049742 Bacteria 3036
625 Ga0501080_0108531 3300049742 Bacteria 2572
626 Ga0501081_0001594 3300049743 Bacteria 13990
627 Ga0501083_0176445 3300049744 Bacteria 1396
628 Ga0501270_037842 3300049767 Bacteria 827
629 Ga0501035_0005822 3300049822 Bacteria 11622
630 Ga0501035_0147024 3300049822 Bacteria 2046
631 Ga0501035_0377702 3300049822 Bacteria 1182
632 Ga0501044_0008551 3300049823 Bacteria 11218
633 Ga0501044_0011072 3300049823 Bacteria 9782
634 Ga0501044_0108969 3300049823 Bacteria 2779
635 Ga0501044_0272421 3300049823 Bacteria 1628
636 Ga0501044_0402384 3300049823 Bacteria 1281
637 Ga0501045_0000120 3300049824 Bacteria 40494
638 nmdc:mga0k408_83794_c1 3300050493 Bacteria 1870
639 nmdc:mga04h51_59713_c1 3300050495 Bacteria 1304
640 nmdc:mga07m45_102654_c1 3300050496 Bacteria 1643
641 nmdc:mga0qj67_64880_c1 3300050509 Bacteria 2906
642 nmdc:mga0sz30_50814_c1 3300050516 Bacteria 1758
643 Ga0500644_0082120 3300053088 Bacteria 1187
644 Ga0500646_0001514 3300053090 Bacteria 6121
645 Ga0500651_0006850 3300053093 Bacteria 6604
646 Ga0500594_0058209 3300053118 Bacteria 1107
647 Ga0500559_0146526 3300053136 Bacteria 1107
648 Ga0500604_0016262 3300053151 Bacteria 2047
649 Ga0500616_0147228 3300053153 Bacteria 1094
650 Ga0500634_0000095 3300053161 Bacteria 34310
651 Ga0500638_121744 3300053162 Bacteria 1193
652 Ga0501084_0000861 3300054114 Bacteria 23412
653 Ga0501084_0087040 3300054114 Bacteria 2623
654 Ga0501084_0335618 3300054114 Bacteria 1277
655 Ga0501084_0675220 3300054114 Bacteria 872
656 Ga0501082_0000082 3300060353 Bacteria 71065
657 Ga0501082_0020433 3300060353 Bacteria 5709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100189138 Ga0068855_1001891383 194
2 3300025924 Ga0207694_10244093 Ga0207694_102440933 194
3 3300025944 Ga0207661_10405971 Ga0207661_104059712 194
4 3300025949 Ga0207667_10179655 Ga0207667_101796552 194
5 3300005719 Ga0068861_100282702 Ga0068861_1002827022 199
6 3300026118 Ga0207675_100073715 Ga0207675_1000737152 199
7 3300026142 Ga0207698_10098523 Ga0207698_100985232 199
8 3300005329 Ga0070683_100046821 Ga0070683_1000468212 200
9 3300005339 Ga0070660_100013111 Ga0070660_1000131112 200
10 3300005344 Ga0070661_100004441 Ga0070661_1000044419 200
11 3300005366 Ga0070659_100092088 Ga0070659_1000920882 200
12 3300005535 Ga0070684_100132806 Ga0070684_1001328062 200
13 3300005539 Ga0068853_100044654 Ga0068853_1000446543 200
14 3300005547 Ga0070693_100042263 Ga0070693_1000422632 200
15 3300005578 Ga0068854_100062852 Ga0068854_1000628523 200
16 3300005614 Ga0068856_100027551 Ga0068856_1000275512 200
17 3300005616 Ga0068852_100028444 Ga0068852_1000284445 200
18 3300013307 Ga0157372_10340649 Ga0157372_103406493 200
19 3300025909 Ga0207705_10043453 Ga0207705_100434532 200
20 3300025920 Ga0207649_10014919 Ga0207649_100149193 200
21 3300025944 Ga0207661_10029832 Ga0207661_100298324 200
22 3300025981 Ga0207640_10045968 Ga0207640_100459683 200
23 3300026078 Ga0207702_10015023 Ga0207702_100150233 200
24 3300031727 Ga0316576_10042200 Ga0316576_100422002 200
25 3300036647 Ga0316582_0307274 Ga0316582_0307274_379_984 200
26 3300049571 Ga0501034_0184183 Ga0501034_0184183_1032_1688 200
27 3300049573 Ga0501037_0545376 Ga0501037_0545376_34_690 200
28 3300049579 Ga0501043_0157290 Ga0501043_0157290_545_1201 200
29 3300049580 Ga0501046_0026272 Ga0501046_0026272_571_1227 200
30 3300049581 Ga0501047_0167768 Ga0501047_0167768_92_748 200
31 3300049586 Ga0501070_0153088 Ga0501070_0153088_640_1296 200
32 3300049589 Ga0501073_0272644 Ga0501073_0272644_165_821 200
33 3300049741 Ga0501079_0528987 Ga0501079_0528987_236_892 200
34 3300049742 Ga0501080_0108531 Ga0501080_0108531_367_1023 200
35 3300049744 Ga0501083_0176445 Ga0501083_0176445_420_1076 200
36 3300049822 Ga0501035_0147024 Ga0501035_0147024_596_1252 200
37 3300049823 Ga0501044_0402384 Ga0501044_0402384_320_976 200
38 3300054114 Ga0501084_0087040 Ga0501084_0087040_417_1073 200
39 3300060353 Ga0501082_0000082 Ga0501082_0000082_31573_32229 200
40 3300005330 Ga0070690_100359015 Ga0070690_1003590151 202
41 3300005455 Ga0070663_100033313 Ga0070663_1000333133 202
42 3300025940 Ga0207691_10023402 Ga0207691_100234022 202
43 3300026035 Ga0207703_10018256 Ga0207703_100182562 202
44 3300026067 Ga0207678_10068183 Ga0207678_100681833 202
45 3300026142 Ga0207698_10116399 Ga0207698_101163992 202
46 3300049574 Ga0501038_0159496 Ga0501038_0159496_473_1129 202
47 3300049578 Ga0501042_0428833 Ga0501042_0428833_73_681 202
48 3300049742 Ga0501080_0066584 Ga0501080_0066584_789_1445 202
49 3300049823 Ga0501044_0272421 Ga0501044_0272421_777_1433 202
50 3300005329 Ga0070683_100286536 Ga0070683_1002865363 204
51 3300005338 Ga0068868_100199320 Ga0068868_1001993201 204
52 3300005366 Ga0070659_100085406 Ga0070659_1000854062 204
53 3300005459 Ga0068867_100350436 Ga0068867_1003504361 204
54 3300005535 Ga0070684_100168800 Ga0070684_1001688002 204
55 3300005549 Ga0070704_100162187 Ga0070704_1001621872 204
56 3300005840 Ga0068870_10263246 Ga0068870_102632462 204
57 3300006881 Ga0068865_100003919 Ga0068865_1000039192 204
58 3300009098 Ga0105245_10129285 Ga0105245_101292853 204
59 3300009148 Ga0105243_10003658 Ga0105243_100036586 204
60 3300009177 Ga0105248_10132191 Ga0105248_101321914 204
61 3300009551 Ga0105238_11103891 Ga0105238_111038911 204
62 3300011119 Ga0105246_10004572 Ga0105246_100045724 204
63 3300013297 Ga0157378_10959925 Ga0157378_109599251 204
64 3300013306 Ga0163162_10549912 Ga0163162_105499122 204
65 3300014325 Ga0163163_10695035 Ga0163163_106950352 204
66 3300014326 Ga0157380_10008451 Ga0157380_100084517 204
67 3300014745 Ga0157377_10024904 Ga0157377_100249044 204
68 3300025940 Ga0207691_10066248 Ga0207691_100662483 204
69 3300026121 Ga0207683_10030154 Ga0207683_100301545 204
70 3300046455 Ga0495603_0023973 Ga0495603_0023973_2929_3543 204
71 3300046523 Ga0495644_0034682 Ga0495644_0034682_678_1292 204
72 3300046615 Ga0495656_0029624 Ga0495656_0029624_257_871 204
73 3300048903 Ga0496100_0220480 Ga0496100_0220480_288_902 204
74 3300048907 Ga0496104_0283679 Ga0496104_0283679_344_958 204
75 3300048911 Ga0496108_0084460 Ga0496108_0084460_667_1281 204
76 iso_pu_bacteria 2738541276 2738716239 204
77 3300005543 Ga0070672_100194202 Ga0070672_1001942021 207
78 3300005983 Ga0081540_1047353 Ga0081540_10473532 207
79 3300025916 Ga0207663_10364568 Ga0207663_103645682 207
80 3300026035 Ga0207703_10688500 Ga0207703_106885002 207
81 3300035691 Ga0373931_0088187 Ga0373931_0088187_604_1227 207
82 3300031548 Ga0307408_100002840 Ga0307408_1000028404 208
83 3300031711 Ga0265314_10018124 Ga0265314_100181243 208
84 3300031728 Ga0316578_10098995 Ga0316578_100989951 208
85 3300031733 Ga0316577_10053334 Ga0316577_100533341 208
86 3300031901 Ga0307406_10090306 Ga0307406_100903062 208
87 3300032137 Ga0316585_10031830 Ga0316585_100318302 208
88 3300036647 Ga0316582_0001391 Ga0316582_0001391_2406_3035 208
89 3300036712 Ga0316584_0001928 Ga0316584_0001928_11758_12387 208
90 3300037588 Ga0316581_0000607 Ga0316581_0000607_3825_4454 208
91 3300025294 Ga0209025_1035642 Ga0209025_10356422 209
92 3300005329 Ga0070683_100304324 Ga0070683_1003043242 210
93 3300005329 Ga0070683_100838805 Ga0070683_1008388051 210
94 3300005336 Ga0070680_100001505 Ga0070680_1000015055 210
95 3300005345 Ga0070692_10079260 Ga0070692_100792601 210
96 3300005577 Ga0068857_100111694 Ga0068857_1001116942 210
97 3300009174 Ga0105241_10108872 Ga0105241_101088723 210
98 3300009551 Ga0105238_10132174 Ga0105238_101321742 210
99 3300010375 Ga0105239_10178608 Ga0105239_101786083 210
100 3300013104 Ga0157370_10530528 Ga0157370_105305281 210
101 3300013105 Ga0157369_10187283 Ga0157369_101872832 210
102 3300013105 Ga0157369_10685206 Ga0157369_106852061 210
103 3300013307 Ga0157372_10741110 Ga0157372_107411101 210
104 3300020080 Ga0206350_10119238 Ga0206350_101192382 210
105 3300022467 Ga0224712_10059437 Ga0224712_100594374 210
106 3300025913 Ga0207695_10115289 Ga0207695_101152893 210
107 3300025914 Ga0207671_10187152 Ga0207671_101871522 210
108 3300025917 Ga0207660_10017505 Ga0207660_100175054 210
109 3300025944 Ga0207661_10146624 Ga0207661_101466243 210
110 3300026078 Ga0207702_10109566 Ga0207702_101095662 210
111 3300031249 Ga0265339_10104538 Ga0265339_101045382 210
112 3300031344 Ga0265316_10499455 Ga0265316_104994552 210
113 3300033179 Ga0307507_10238405 Ga0307507_102384052 210
114 3300041512 Ga0451853_3672467 Ga0451853_3672467_48_704 210
115 3300042876 Ga0451577_0008871 Ga0451577_0008871_4263_4895 210
116 3300045051 Ga0451576_0166976 Ga0451576_0166976_609_1241 210
117 3300049571 Ga0501034_0018896 Ga0501034_0018896_2280_2927 210
118 iso_pu_bacteria 2524614729 2525556785 212
119 iso_pu_bacteria 2627854209 2630648381 212
120 iso_pu_bacteria 2891633521 2891635053 212
121 iso_pu_bacteria 2919534386 2919537733 212
122 3300005331 Ga0070670_100257850 Ga0070670_1002578502 213
123 3300005434 Ga0070709_10061270 Ga0070709_100612702 213
124 3300005434 Ga0070709_10202746 Ga0070709_102027462 213
125 3300005439 Ga0070711_100097760 Ga0070711_1000977601 213
126 3300005459 Ga0068867_100133985 Ga0068867_1001339852 213
127 3300005545 Ga0070695_100286739 Ga0070695_1002867392 213
128 3300005546 Ga0070696_100160901 Ga0070696_1001609013 213
129 3300005547 Ga0070693_100014699 Ga0070693_1000146993 213
130 3300005547 Ga0070693_100053888 Ga0070693_1000538882 213
131 3300005548 Ga0070665_100329810 Ga0070665_1003298102 213
132 3300005563 Ga0068855_100026787 Ga0068855_1000267872 213
133 3300005614 Ga0068856_100445861 Ga0068856_1004458612 213
134 3300009093 Ga0105240_10207087 Ga0105240_102070872 213
135 3300009094 Ga0111539_10139798 Ga0111539_101397983 213
136 3300009174 Ga0105241_10193083 Ga0105241_101930832 213
137 3300009545 Ga0105237_10737769 Ga0105237_107377691 213
138 3300009553 Ga0105249_11013869 Ga0105249_110138692 213
139 3300013308 Ga0157375_10143675 Ga0157375_101436752 213
140 3300025906 Ga0207699_10313383 Ga0207699_103133832 213
141 3300025907 Ga0207645_10038396 Ga0207645_100383962 213
142 3300025911 Ga0207654_10160426 Ga0207654_101604262 213
143 3300025913 Ga0207695_10599837 Ga0207695_105998372 213
144 3300025914 Ga0207671_10175045 Ga0207671_101750452 213
145 3300025916 Ga0207663_10112070 Ga0207663_101120702 213
146 3300025923 Ga0207681_10735096 Ga0207681_107350962 213
147 3300025940 Ga0207691_10032680 Ga0207691_100326805 213
148 3300025949 Ga0207667_10002925 Ga0207667_100029256 213
149 3300025972 Ga0207668_10169891 Ga0207668_101698912 213
150 3300025986 Ga0207658_10183606 Ga0207658_101836062 213
151 3300026067 Ga0207678_10237318 Ga0207678_102373182 213
152 3300026088 Ga0207641_10658556 Ga0207641_106585562 213
153 3300026089 Ga0207648_10087675 Ga0207648_100876753 213
154 3300028379 Ga0268266_10294979 Ga0268266_102949792 213
155 3300033179 Ga0307507_10135851 Ga0307507_101358512 213
156 3300037471 Ga0395905_0185824 Ga0395905_0185824_624_1265 213
157 3300046514 Ga0495618_0384332 Ga0495618_0384332_103_759 213
158 3300046675 Ga0495657_0440063 Ga0495657_0440063_60_716 213
159 3300049587 Ga0501071_0125343 Ga0501071_0125343_190_837 213
160 3300049589 Ga0501073_0126285 Ga0501073_0126285_380_1027 213
161 3300049823 Ga0501044_0108969 Ga0501044_0108969_737_1384 213
162 3300053136 Ga0500559_0146526 Ga0500559_0146526_178_834 213
163 iso_pu_bacteria 2571042365 2572255015 213
164 iso_pu_bacteria 2643221695 2644529425 213
165 3300005330 Ga0070690_100020353 Ga0070690_1000203533 214
166 3300005347 Ga0070668_100036424 Ga0070668_1000364242 214
167 3300005548 Ga0070665_100218674 Ga0070665_1002186742 214
168 3300005563 Ga0068855_100050085 Ga0068855_1000500853 214
169 3300005841 Ga0068863_100027859 Ga0068863_1000278594 214
170 3300005842 Ga0068858_100026329 Ga0068858_1000263294 214
171 3300006237 Ga0097621_100676139 Ga0097621_1006761392 214
172 3300009093 Ga0105240_10019161 Ga0105240_100191615 214
173 3300009093 Ga0105240_10021493 Ga0105240_100214933 214
174 3300009174 Ga0105241_10185844 Ga0105241_101858442 214
175 3300009176 Ga0105242_10392253 Ga0105242_103922532 214
176 3300009177 Ga0105248_10039461 Ga0105248_100394615 214
177 3300010375 Ga0105239_10073434 Ga0105239_100734342 214
178 3300013104 Ga0157370_10015715 Ga0157370_100157156 214
179 3300014325 Ga0163163_10002084 Ga0163163_100020844 214
180 3300014968 Ga0157379_10057159 Ga0157379_100571593 214
181 3300025913 Ga0207695_10036911 Ga0207695_100369113 214
182 3300025913 Ga0207695_10106215 Ga0207695_101062153 214
183 3300025949 Ga0207667_10017552 Ga0207667_100175529 214
184 3300025972 Ga0207668_10020502 Ga0207668_100205024 214
185 3300026035 Ga0207703_10041366 Ga0207703_100413665 214
186 3300026078 Ga0207702_10252260 Ga0207702_102522601 214
187 3300026088 Ga0207641_10898435 Ga0207641_108984352 214
188 3300028381 Ga0268264_10133032 Ga0268264_101330322 214
189 3300046522 Ga0495643_0063033 Ga0495643_0063033_290_934 214
190 3300046694 Ga0495649_0185215 Ga0495649_0185215_355_1026 214
191 3300048088 Ga0495602_0227825 Ga0495602_0227825_581_1228 214
192 3300048929 Ga0496126_0110602 Ga0496126_0110602_203_856 215
193 3300049656 Ga0501209_000193 Ga0501209_000193_4067_4720 215
194 iso_pu_bacteria 2576861471 2578457872 215
195 iso_pu_bacteria 2643221559 2643817690 215
196 iso_pu_bacteria 2643221573 2643878914 215
197 iso_pu_bacteria 2643221586 2643940401 215
198 iso_pu_bacteria 2643221612 2644079475 215
199 iso_pu_bacteria 2643221720 2644660230 215
200 iso_pu_bacteria 2643221727 2644694917 215
201 iso_pu_bacteria 2643221728 2644697532 215
202 iso_pu_bacteria 2747842428 2747948027 215
203 iso_pu_bacteria 2765235840 2765579622 215
204 iso_pu_bacteria 2816332141 2816517702 215
205 iso_pu_bacteria 2842391507 2842391884 215
206 iso_pu_bacteria 2842757796 2842760162 215
207 iso_pu_bacteria 2852649853 2852650309 215
208 iso_pu_bacteria 2857442823 2857446787 215
209 iso_pu_bacteria 2874220319 2874222318 215
210 iso_pu_bacteria 2919089067 2919091093 215
211 iso_pu_bacteria 2919134579 2919135424 215
212 iso_pu_bacteria 2928496128 2928497643 215
213 iso_pu_bacteria 2931380184 2931384228 215
214 iso_pu_bacteria 2937610967 2937613287 215
215 iso_pu_bacteria 2939589442 2939592931 215
216 iso_pu_bacteria 2939622612 2939625671 215
217 iso_pu_bacteria 2939626828 2939628957 215
218 iso_pu_bacteria 2941475908 2941476385 215
219 iso_pu_bacteria 2961047084 2961049083 215
220 iso_pu_bacteria 2961064222 2961066221 215
221 iso_pu_bacteria 2974307012 2974308472 215
222 iso_pu_bacteria 2977247770 2977249226 215
223 iso_pu_bacteria 2984514374 2984516317 215
224 iso_pu_bacteria 2987605356 2987607265 215
225 iso_pu_bacteria 2995948881 2995951559 215
226 3300005293 Ga0065715_10018126 Ga0065715_100181262 216
227 3300005468 Ga0070707_100520016 Ga0070707_1005200162 216
228 3300005539 Ga0068853_100088307 Ga0068853_1000883072 216
229 3300005547 Ga0070693_100081803 Ga0070693_1000818031 216
230 3300005549 Ga0070704_100513108 Ga0070704_1005131082 216
231 3300005616 Ga0068852_100106305 Ga0068852_1001063052 216
232 3300005617 Ga0068859_100008242 Ga0068859_1000082424 216
233 3300005618 Ga0068864_100897479 Ga0068864_1008974791 216
234 3300005844 Ga0068862_100638289 Ga0068862_1006382892 216
235 3300006237 Ga0097621_100186509 Ga0097621_1001865092 216
236 3300006358 Ga0068871_100253128 Ga0068871_1002531282 216
237 3300006358 Ga0068871_100822044 Ga0068871_1008220442 216
238 3300006931 Ga0097620_100008242 Ga0097620_1000082424 216
239 3300009094 Ga0111539_10137303 Ga0111539_101373034 216
240 3300009551 Ga0105238_10326143 Ga0105238_103261432 216
241 3300013297 Ga0157378_10084089 Ga0157378_100840891 216
242 3300013308 Ga0157375_11226699 Ga0157375_112266992 216
243 3300014969 Ga0157376_10006463 Ga0157376_100064639 216
244 3300025321 Ga0207656_10269159 Ga0207656_102691591 216
245 3300025924 Ga0207694_10014435 Ga0207694_100144355 216
246 3300026095 Ga0207676_10192170 Ga0207676_101921702 216
247 3300026142 Ga0207698_10069321 Ga0207698_100693213 216
248 3300031824 Ga0307413_10122562 Ga0307413_101225621 216
249 3300032005 Ga0307411_10155936 Ga0307411_101559362 216
250 3300047320 Ga0495672_0193773 Ga0495672_0193773_160_813 216
251 iso_pu_bacteria 2747842501 2748015773 216
252 iso_pu_bacteria 2818991457 2819663040 216
253 iso_pu_bacteria 2852684882 2852685967 216
254 iso_pu_bacteria 2919130084 2919133505 216
255 iso_pu_bacteria 2929195423 2929197441 216
256 iso_pu_bacteria 8021622325 8021624225 216
257 iso_pu_bacteria 8021626552 8021628271 216
258 iso_pu_bacteria 8021648035 8021652030 216
259 3300005344 Ga0070661_100034944 Ga0070661_1000349442 217
260 3300005434 Ga0070709_10613153 Ga0070709_106131531 217
261 3300005458 Ga0070681_10000012 Ga0070681_1000001299 217
262 3300005459 Ga0068867_100553248 Ga0068867_1005532482 217
263 3300005614 Ga0068856_100109651 Ga0068856_1001096512 217
264 3300005616 Ga0068852_100493277 Ga0068852_1004932772 217
265 3300005843 Ga0068860_100101399 Ga0068860_1001013992 217
266 3300006844 Ga0075428_101169852 Ga0075428_1011698521 217
267 3300009101 Ga0105247_10083347 Ga0105247_100833472 217
268 3300010375 Ga0105239_10104064 Ga0105239_101040643 217
269 3300012506 Ga0157324_1006905 Ga0157324_10069052 217
270 3300025303 Ga0209051_1015286 Ga0209051_10152863 217
271 3300025900 Ga0207710_10030140 Ga0207710_100301402 217
272 3300025912 Ga0207707_10000948 Ga0207707_1000094815 217
273 3300026041 Ga0207639_10016173 Ga0207639_100161733 217
274 3300026078 Ga0207702_10502343 Ga0207702_105023432 217
275 3300026142 Ga0207698_10863400 Ga0207698_108634002 217
276 3300028380 Ga0268265_10002801 Ga0268265_100028018 217
277 3300028381 Ga0268264_10009178 Ga0268264_100091784 217
278 3300031548 Ga0307408_100254352 Ga0307408_1002543523 217
279 3300031824 Ga0307413_10264385 Ga0307413_102643852 217
280 3300031852 Ga0307410_10279501 Ga0307410_102795012 217
281 3300031901 Ga0307406_10232961 Ga0307406_102329612 217
282 3300031903 Ga0307407_10152782 Ga0307407_101527822 217
283 3300031911 Ga0307412_10209788 Ga0307412_102097883 217
284 3300031911 Ga0307412_10617837 Ga0307412_106178372 217
285 3300031995 Ga0307409_100903467 Ga0307409_1009034671 217
286 3300032002 Ga0307416_100529727 Ga0307416_1005297272 217
287 3300032005 Ga0307411_10037108 Ga0307411_100371082 217
288 3300032005 Ga0307411_10125552 Ga0307411_101255522 217
289 3300032005 Ga0307411_10254234 Ga0307411_102542343 217
290 3300032126 Ga0307415_100812735 Ga0307415_1008127352 217
291 3300041404 Ga0439436_0009189 Ga0439436_0009189_1418_2092 217
292 3300041404 Ga0439436_0009600 Ga0439436_0009600_1907_2572 217
293 3300041406 Ga0439439_0086282 Ga0439439_0086282_77_751 217
294 3300041494 Ga0451837_1006580 Ga0451837_1006580_2551_3204 217
295 3300041509 Ga0451843_1634350 Ga0451843_1634350_1836_2489 217
296 3300041999 Ga0439433_0038905 Ga0439433_0038905_250_915 217
297 3300042006 Ga0439432_004313 Ga0439432_004313_4069_4731 217
298 3300042006 Ga0439432_030073 Ga0439432_030073_452_1117 217
299 3300042007 Ga0439449_0013127 Ga0439449_0013127_2318_2983 217
300 3300042007 Ga0439449_0015192 Ga0439449_0015192_424_1089 217
301 3300042007 Ga0439449_0119892 Ga0439449_0119892_231_896 217
302 3300042015 Ga0439462_0010907 Ga0439462_0010907_607_1272 217
303 3300042435 Ga0439434_0052358 Ga0439434_0052358_248_922 217
304 3300042876 Ga0451577_0002034 Ga0451577_0002034_20693_21355 217
305 3300042876 Ga0451577_0030380 Ga0451577_0030380_772_1425 217
306 3300046539 Ga0495621_0007405 Ga0495621_0007405_1082_1747 217
307 3300046615 Ga0495656_0120780 Ga0495656_0120780_389_1054 217
308 3300046664 Ga0495659_0053577 Ga0495659_0053577_142_804 217
309 3300047318 Ga0495636_0000522 Ga0495636_0000522_7195_7860 217
310 3300049568 Ga0501031_0005651 Ga0501031_0005651_892_1545 217
311 3300049569 Ga0501032_0002312 Ga0501032_0002312_8174_8827 217
312 3300049570 Ga0501033_0005030 Ga0501033_0005030_8173_8826 217
313 3300049571 Ga0501034_0008806 Ga0501034_0008806_1598_2251 217
314 3300049572 Ga0501036_0091661 Ga0501036_0091661_1699_2352 217
315 3300049573 Ga0501037_0001246 Ga0501037_0001246_5900_6553 217
316 3300049574 Ga0501038_0001377 Ga0501038_0001377_8174_8827 217
317 3300049575 Ga0501039_0012931 Ga0501039_0012931_1744_2397 217
318 3300049580 Ga0501046_0006111 Ga0501046_0006111_6924_7577 217
319 3300049581 Ga0501047_0009516 Ga0501047_0009516_6181_6834 217
320 3300049583 Ga0501067_0162401 Ga0501067_0162401_211_864 217
321 3300049589 Ga0501073_0024001 Ga0501073_0024001_2052_2705 217
322 3300049652 Ga0501202_038795 Ga0501202_038795_166_837 217
323 3300049654 Ga0501207_032009 Ga0501207_032009_131_802 217
324 3300049663 Ga0501223_048880 Ga0501223_048880_19_690 217
325 3300049680 Ga0501250_002719 Ga0501250_002719_267_938 217
326 3300049680 Ga0501250_011568 Ga0501250_011568_306_971 217
327 3300049742 Ga0501080_0080105 Ga0501080_0080105_159_812 217
328 3300049767 Ga0501270_037842 Ga0501270_037842_19_690 217
329 3300049822 Ga0501035_0005822 Ga0501035_0005822_2796_3449 217
330 3300049823 Ga0501044_0011072 Ga0501044_0011072_7217_7870 217
331 3300054114 Ga0501084_0335618 Ga0501084_0335618_607_1260 217
332 iso_pu_bacteria 2895498888 2895500654 217
333 iso_pu_bacteria 2895511927 2895516476 217
334 iso_pu_bacteria 2895522137 2895523604 217
335 iso_pu_bacteria 2895525241 2895526814 217
336 iso_pu_bacteria 639633007 639789144 217
337 iso_pu_bacteria 8003014200 8003016092 217
338 3300003187 JGI25151J46595_10006340 JGI25151J46595_100063402 218
339 3300005334 Ga0068869_100395013 Ga0068869_1003950131 218
340 3300005355 Ga0070671_100441589 Ga0070671_1004415892 218
341 3300005456 Ga0070678_100012656 Ga0070678_1000126562 218
342 3300005530 Ga0070679_100287197 Ga0070679_1002871972 218
343 3300005841 Ga0068863_100094369 Ga0068863_1000943693 218
344 3300006237 Ga0097621_100005955 Ga0097621_1000059556 218
345 3300006358 Ga0068871_100056678 Ga0068871_1000566782 218
346 3300009177 Ga0105248_10038118 Ga0105248_100381182 218
347 3300010375 Ga0105239_10205582 Ga0105239_102055824 218
348 3300013308 Ga0157375_10080866 Ga0157375_100808664 218
349 3300014969 Ga0157376_10000734 Ga0157376_1000073415 218
350 3300017792 Ga0163161_10516927 Ga0163161_105169272 218
351 3300025294 Ga0209025_1000034 Ga0209025_100003469 218
352 3300025920 Ga0207649_10319698 Ga0207649_103196981 218
353 3300025925 Ga0207650_10240986 Ga0207650_102409862 218
354 3300025931 Ga0207644_10190828 Ga0207644_101908281 218
355 3300025936 Ga0207670_10149810 Ga0207670_101498102 218
356 3300025940 Ga0207691_10013867 Ga0207691_100138674 218
357 3300025941 Ga0207711_10348087 Ga0207711_103480871 218
358 3300025942 Ga0207689_10255683 Ga0207689_102556832 218
359 3300025949 Ga0207667_10413324 Ga0207667_104133242 218
360 3300025972 Ga0207668_10014664 Ga0207668_100146642 218
361 3300026088 Ga0207641_10021908 Ga0207641_100219084 218
362 3300026089 Ga0207648_10019234 Ga0207648_100192346 218
363 3300026121 Ga0207683_10003087 Ga0207683_1000308710 218
364 3300026121 Ga0207683_10202414 Ga0207683_102024142 218
365 3300028381 Ga0268264_10157462 Ga0268264_101574622 218
366 3300031507 Ga0307509_10277799 Ga0307509_102777992 218
367 3300031903 Ga0307407_10218511 Ga0307407_102185112 218
368 3300033179 Ga0307507_10183106 Ga0307507_101831061 218
369 3300036401 Ga0373937_0341636 Ga0373937_0341636_607_1263 218
370 3300044656 Ga0466969_0035455 Ga0466969_0035455_1406_2086 218
371 3300044666 Ga0466977_0005295 Ga0466977_0005295_3879_4559 218
372 3300046616 Ga0495668_0001767 Ga0495668_0001767_16312_17040 218
373 3300050509 nmdc:mga0qj67_64880_c1 nmdc:mga0qj67_64880_c1_148_804 218
374 3300003323 rootH1_10150984 rootH1_101509842 219
375 3300003771 Ga0055526_1000006 Ga0055526_100000612 219
376 3300003771 Ga0055526_1000413 Ga0055526_100041325 219
377 3300003773 Ga0055537_1000018 Ga0055537_100001812 219
378 3300003773 Ga0055537_1000349 Ga0055537_100034919 219
379 3300003775 Ga0055524_1000009 Ga0055524_1000009215 219
380 3300003775 Ga0055524_1018136 Ga0055524_10181363 219
381 3300003781 Ga0055536_1002383 Ga0055536_10023832 219
382 3300003781 Ga0055536_1003808 Ga0055536_10038085 219
383 3300003781 Ga0055536_1052554 Ga0055536_10525541 219
384 3300003784 Ga0055534_1000004 Ga0055534_1000004215 219
385 3300003784 Ga0055534_1000073 Ga0055534_100007335 219
386 3300003790 Ga0055528_1000003 Ga0055528_1000003248 219
387 3300003790 Ga0055528_1000080 Ga0055528_100008030 219
388 3300003791 Ga0055530_10001767 Ga0055530_1000176712 219
389 3300003791 Ga0055530_10001774 Ga0055530_1000177410 219
390 3300003792 Ga0055540_1026811 Ga0055540_10268112 219
391 3300003794 Ga0055531_10010111 Ga0055531_100101114 219
392 3300003794 Ga0055531_10021508 Ga0055531_100215083 219
393 3300003794 Ga0055531_10024202 Ga0055531_100242024 219
394 3300005262 Ga0065165_1028945 Ga0065165_10289452 219
395 3300005289 Ga0065704_10092418 Ga0065704_100924182 219
396 3300005289 Ga0065704_10189581 Ga0065704_101895812 219
397 3300005334 Ga0068869_100098086 Ga0068869_1000980862 219
398 3300005353 Ga0070669_100034776 Ga0070669_1000347764 219
399 3300005456 Ga0070678_100065671 Ga0070678_1000656713 219
400 3300005539 Ga0068853_100002556 Ga0068853_1000025566 219
401 3300005546 Ga0070696_100168693 Ga0070696_1001686932 219
402 3300005548 Ga0070665_100008352 Ga0070665_10000835211 219
403 3300005548 Ga0070665_100052946 Ga0070665_1000529463 219
404 3300005548 Ga0070665_100122005 Ga0070665_1001220052 219
405 3300005563 Ga0068855_100023493 Ga0068855_1000234937 219
406 3300005577 Ga0068857_100398225 Ga0068857_1003982252 219
407 3300005616 Ga0068852_100297989 Ga0068852_1002979892 219
408 3300005617 Ga0068859_100285598 Ga0068859_1002855982 219
409 3300005718 Ga0068866_10000607 Ga0068866_1000060716 219
410 3300005841 Ga0068863_100001454 Ga0068863_1000014546 219
411 3300005844 Ga0068862_100224242 Ga0068862_1002242422 219
412 3300006051 Ga0075364_10327832 Ga0075364_103278322 219
413 3300006237 Ga0097621_100008756 Ga0097621_1000087561 219
414 3300006844 Ga0075428_100395255 Ga0075428_1003952552 219
415 3300006914 Ga0075436_100114536 Ga0075436_1001145362 219
416 3300006931 Ga0097620_100285595 Ga0097620_1002855952 219
417 3300009011 Ga0105251_10006958 Ga0105251_100069587 219
418 3300009036 Ga0105244_10034596 Ga0105244_100345964 219
419 3300009098 Ga0105245_10257448 Ga0105245_102574481 219
420 3300009174 Ga0105241_10486851 Ga0105241_104868512 219
421 3300009176 Ga0105242_10060546 Ga0105242_100605462 219
422 3300009545 Ga0105237_10089736 Ga0105237_100897363 219
423 3300009553 Ga0105249_10040632 Ga0105249_100406323 219
424 3300009553 Ga0105249_10160398 Ga0105249_101603982 219
425 3300010375 Ga0105239_10005877 Ga0105239_100058776 219
426 3300013100 Ga0157373_10709621 Ga0157373_107096211 219
427 3300013102 Ga0157371_10003647 Ga0157371_100036475 219
428 3300013102 Ga0157371_10014602 Ga0157371_100146025 219
429 3300013104 Ga0157370_10124688 Ga0157370_101246882 219
430 3300013104 Ga0157370_10301153 Ga0157370_103011531 219
431 3300014326 Ga0157380_10379597 Ga0157380_103795972 219
432 3300014497 Ga0182008_10001765 Ga0182008_100017655 219
433 3300014497 Ga0182008_10002596 Ga0182008_1000259610 219
434 3300015261 Ga0182006_1023402 Ga0182006_10234024 219
435 3300015261 Ga0182006_1040986 Ga0182006_10409863 219
436 3300015262 Ga0182007_10000353 Ga0182007_1000035319 219
437 3300015265 Ga0182005_1000344 Ga0182005_100034420 219
438 3300015689 Ga0183360_10001 Ga0183360_100011635 219
439 3300017792 Ga0163161_10002464 Ga0163161_100024645 219
440 3300017792 Ga0163161_10173715 Ga0163161_101737153 219
441 3300025263 Ga0209565_1000001 Ga0209565_10000012179 219
442 3300025263 Ga0209565_1000022 Ga0209565_100002255 219
443 3300025273 Ga0209673_1000001 Ga0209673_10000012179 219
444 3300025273 Ga0209673_1000087 Ga0209673_1000087174 219
445 3300025273 Ga0209673_1050296 Ga0209673_10502962 219
446 3300025284 Ga0209130_1016302 Ga0209130_10163022 219
447 3300025291 Ga0209675_1000001 Ga0209675_1000001353 219
448 3300025291 Ga0209675_1000060 Ga0209675_100006013 219
449 3300025291 Ga0209675_1012289 Ga0209675_10122893 219
450 3300025292 Ga0209676_1000011 Ga0209676_10000118 219
451 3300025292 Ga0209676_1000114 Ga0209676_100011438 219
452 3300025292 Ga0209676_1000976 Ga0209676_100097636 219
453 3300025292 Ga0209676_1005140 Ga0209676_10051404 219
454 3300025292 Ga0209676_1007576 Ga0209676_10075765 219
455 3300025292 Ga0209676_1016951 Ga0209676_10169513 219
456 3300025294 Ga0209025_1017520 Ga0209025_10175204 219
457 3300025295 Ga0209564_1000001 Ga0209564_1000001515 219
458 3300025295 Ga0209564_1000302 Ga0209564_100030248 219
459 3300025297 Ga0209758_1037028 Ga0209758_10370282 219
460 3300025298 Ga0209050_1001760 Ga0209050_100176014 219
461 3300025298 Ga0209050_1002154 Ga0209050_10021547 219
462 3300025298 Ga0209050_1009716 Ga0209050_10097164 219
463 3300025299 Ga0209256_1000002 Ga0209256_10000021037 219
464 3300025299 Ga0209256_1001644 Ga0209256_10016447 219
465 3300025299 Ga0209256_1003341 Ga0209256_10033419 219
466 3300025299 Ga0209256_1017426 Ga0209256_10174262 219
467 3300025303 Ga0209051_1000606 Ga0209051_10006067 219
468 3300025304 Ga0209257_1000014 Ga0209257_100001467 219
469 3300025304 Ga0209257_1000080 Ga0209257_1000080119 219
470 3300025304 Ga0209257_1006360 Ga0209257_10063608 219
471 3300025304 Ga0209257_1009732 Ga0209257_10097324 219
472 3300025735 Ga0207713_1007579 Ga0207713_10075792 219
473 3300025903 Ga0207680_10057263 Ga0207680_100572632 219
474 3300025911 Ga0207654_10152279 Ga0207654_101522792 219
475 3300025914 Ga0207671_10049438 Ga0207671_100494382 219
476 3300025934 Ga0207686_10065515 Ga0207686_100655152 219
477 3300025935 Ga0207709_10004839 Ga0207709_100048391 219
478 3300025942 Ga0207689_10007328 Ga0207689_100073283 219
479 3300025949 Ga0207667_10001306 Ga0207667_1000130630 219
480 3300025961 Ga0207712_10016600 Ga0207712_100166004 219
481 3300025981 Ga0207640_11038987 Ga0207640_110389871 219
482 3300025986 Ga0207658_10078539 Ga0207658_100785392 219
483 3300026041 Ga0207639_10000772 Ga0207639_100007726 219
484 3300026041 Ga0207639_10040551 Ga0207639_100405512 219
485 3300026067 Ga0207678_10250041 Ga0207678_102500412 219
486 3300026088 Ga0207641_10049896 Ga0207641_100498965 219
487 3300026116 Ga0207674_10422446 Ga0207674_104224462 219
488 3300026118 Ga0207675_100006718 Ga0207675_10000671812 219
489 3300026121 Ga0207683_10178672 Ga0207683_101786723 219
490 3300027312 Ga0209371_1000007 Ga0209371_1000007169 219
491 3300028379 Ga0268266_10021365 Ga0268266_100213655 219
492 3300028380 Ga0268265_10263336 Ga0268265_102633362 219
493 3300030500 Ga0268256_1000008 Ga0268256_1000008781 219
494 3300030732 Ga0316176_1153914 Ga0316176_11539142 219
495 3300030742 Ga0316183_1068246 Ga0316183_10682465 219
496 3300030744 Ga0316181_1203139 Ga0316181_12031391 219
497 3300032004 Ga0307414_10163842 Ga0307414_101638422 219
498 3300032004 Ga0307414_10280672 Ga0307414_102806722 219
499 3300037312 Ga0395899_0021657 Ga0395899_0021657_262_930 219
500 3300037418 Ga0395900_0016564 Ga0395900_0016564_542_1210 219
501 3300037466 Ga0395898_0108711 Ga0395898_0108711_971_1639 219
502 3300037471 Ga0395905_0000577 Ga0395905_0000577_2309_2977 219
503 3300037471 Ga0395905_0155418 Ga0395905_0155418_497_1165 219
504 3300037853 Ga0436364_0752000 Ga0436364_0752000_5152_5844 219
505 3300038705 Ga0237819_08451 Ga0237819_08451_577_1239 219
506 3300041413 Ga0439465_0009303 Ga0439465_0009303_243_914 219
507 3300041486 Ga0451807_0568998 Ga0451807_0568998_439_1098 219
508 3300041512 Ga0451853_3632959 Ga0451853_3632959_121_780 219
509 3300042007 Ga0439449_0004776 Ga0439449_0004776_1793_2464 219
510 3300044658 Ga0466972_0016307 Ga0466972_0016307_1335_2030 219
511 3300044765 Ga0466970_0007619 Ga0466970_0007619_1297_1992 219
512 3300046460 Ga0495638_0010655 Ga0495638_0010655_3966_4628 219
513 3300046460 Ga0495638_0104326 Ga0495638_0104326_328_999 219
514 3300046522 Ga0495643_0003481 Ga0495643_0003481_9092_9754 219
515 3300046558 Ga0495633_0022960 Ga0495633_0022960_1186_1848 219
516 3300046615 Ga0495656_0003220 Ga0495656_0003220_4792_5463 219
517 3300046660 Ga0495625_0095761 Ga0495625_0095761_712_1374 219
518 3300046691 Ga0495670_0146339 Ga0495670_0146339_432_1103 219
519 3300047318 Ga0495636_0026155 Ga0495636_0026155_469_1140 219
520 3300047320 Ga0495672_0000455 Ga0495672_0000455_1897_2559 219
521 3300048908 Ga0496105_0139808 Ga0496105_0139808_961_1623 219
522 3300048919 Ga0496116_0088184 Ga0496116_0088184_374_1036 219
523 3300048920 Ga0496117_0005879 Ga0496117_0005879_2063_2725 219
524 3300048920 Ga0496117_0006203 Ga0496117_0006203_1885_2547 219
525 3300048920 Ga0496117_0186420 Ga0496117_0186420_154_816 219
526 3300048921 Ga0496118_0000362 Ga0496118_0000362_9869_10531 219
527 3300048921 Ga0496118_0001608 Ga0496118_0001608_3823_4521 219
528 3300048921 Ga0496118_0006389 Ga0496118_0006389_1346_2008 219
529 3300048922 Ga0496119_0000851 Ga0496119_0000851_28159_28821 219
530 3300048922 Ga0496119_0038877 Ga0496119_0038877_391_1053 219
531 3300048923 Ga0496120_0001387 Ga0496120_0001387_17292_17954 219
532 3300048923 Ga0496120_0062248 Ga0496120_0062248_993_1655 219
533 3300048924 Ga0496121_0000755 Ga0496121_0000755_10135_10800 219
534 3300048924 Ga0496121_0054362 Ga0496121_0054362_1662_2324 219
535 3300048925 Ga0496122_0003143 Ga0496122_0003143_11944_12606 219
536 3300048925 Ga0496122_0027624 Ga0496122_0027624_2516_3178 219
537 3300048925 Ga0496122_0035854 Ga0496122_0035854_1637_2299 219
538 3300048925 Ga0496122_0093335 Ga0496122_0093335_1008_1670 219
539 3300048926 Ga0496123_0000624 Ga0496123_0000624_9688_10350 219
540 3300048926 Ga0496123_0050826 Ga0496123_0050826_1072_1734 219
541 3300048926 Ga0496123_0092211 Ga0496123_0092211_751_1413 219
542 3300048927 Ga0496124_0009017 Ga0496124_0009017_1599_2261 219
543 3300048927 Ga0496124_0015807 Ga0496124_0015807_1372_2034 219
544 3300048927 Ga0496124_0030624 Ga0496124_0030624_2812_3474 219
545 3300048927 Ga0496124_0058441 Ga0496124_0058441_1857_2519 219
546 3300048927 Ga0496124_0264456 Ga0496124_0264456_556_1218 219
547 3300048927 Ga0496124_0306334 Ga0496124_0306334_434_1096 219
548 3300048927 Ga0496124_0307127 Ga0496124_0307127_122_784 219
549 3300048928 Ga0496125_0008250 Ga0496125_0008250_9521_10183 219
550 3300048928 Ga0496125_0059747 Ga0496125_0059747_378_1040 219
551 3300048928 Ga0496125_0065237 Ga0496125_0065237_757_1419 219
552 3300048928 Ga0496125_0102563 Ga0496125_0102563_127_789 219
553 3300048928 Ga0496125_0105881 Ga0496125_0105881_792_1454 219
554 3300048928 Ga0496125_0233973 Ga0496125_0233973_323_985 219
555 3300048929 Ga0496126_0197160 Ga0496126_0197160_179_841 219
556 3300049570 Ga0501033_0079198 Ga0501033_0079198_912_1577 219
557 3300049571 Ga0501034_0136878 Ga0501034_0136878_1518_2180 219
558 3300049574 Ga0501038_0531520 Ga0501038_0531520_90_755 219
559 3300049575 Ga0501039_0003424 Ga0501039_0003424_9635_10300 219
560 3300049576 Ga0501040_0005666 Ga0501040_0005666_4479_5144 219
561 3300049578 Ga0501042_0038328 Ga0501042_0038328_2611_3276 219
562 3300049580 Ga0501046_0038896 Ga0501046_0038896_1542_2207 219
563 3300049582 Ga0501048_0054480 Ga0501048_0054480_2121_2786 219
564 3300049587 Ga0501071_0005629 Ga0501071_0005629_4149_4814 219
565 3300049588 Ga0501072_0010759 Ga0501072_0010759_1716_2381 219
566 3300049591 Ga0501075_0000416 Ga0501075_0000416_19259_19924 219
567 3300049592 Ga0501076_0003140 Ga0501076_0003140_1942_2607 219
568 3300049593 Ga0501077_0024700 Ga0501077_0024700_353_1018 219
569 3300049741 Ga0501079_0015199 Ga0501079_0015199_3491_4156 219
570 3300049743 Ga0501081_0001594 Ga0501081_0001594_9114_9779 219
571 3300049822 Ga0501035_0377702 Ga0501035_0377702_419_1084 219
572 3300049824 Ga0501045_0000120 Ga0501045_0000120_23646_24311 219
573 3300054114 Ga0501084_0000861 Ga0501084_0000861_16251_16916 219
574 3300054114 Ga0501084_0675220 Ga0501084_0675220_23_685 219
575 3300060353 Ga0501082_0020433 Ga0501082_0020433_268_933 219
576 3300002773 JGI25152J39213_1000032 JGI25152J39213_100003254 220
577 3300002774 JGI25150J39212_1000179 JGI25150J39212_10001796 220
578 3300003187 JGI25151J46595_10000138 JGI25151J46595_1000013854 220
579 3300003215 JGI25153J46596_10000102 JGI25153J46596_1000010254 220
580 3300003856 Ga0058692_1000023 Ga0058692_1000023155 220
581 3300005289 Ga0065704_10075451 Ga0065704_100754512 220
582 3300005331 Ga0070670_100005062 Ga0070670_10000506210 220
583 3300005331 Ga0070670_100006427 Ga0070670_1000064277 220
584 3300005335 Ga0070666_10045825 Ga0070666_100458251 220
585 3300005338 Ga0068868_100069326 Ga0068868_1000693262 220
586 3300005344 Ga0070661_100169457 Ga0070661_1001694572 220
587 3300005364 Ga0070673_100346063 Ga0070673_1003460632 220
588 3300005367 Ga0070667_100307439 Ga0070667_1003074391 220
589 3300005445 Ga0070708_100504604 Ga0070708_1005046042 220
590 3300005455 Ga0070663_100021396 Ga0070663_1000213963 220
591 3300005456 Ga0070678_100120486 Ga0070678_1001204862 220
592 3300005457 Ga0070662_100028679 Ga0070662_1000286794 220
593 3300005539 Ga0068853_100035121 Ga0068853_1000351214 220
594 3300005539 Ga0068853_100057145 Ga0068853_1000571453 220
595 3300005548 Ga0070665_100024712 Ga0070665_1000247124 220
596 3300005578 Ga0068854_100025642 Ga0068854_1000256423 220
597 3300005616 Ga0068852_100028067 Ga0068852_1000280673 220
598 3300005616 Ga0068852_100243827 Ga0068852_1002438273 220
599 3300005617 Ga0068859_100747029 Ga0068859_1007470292 220
600 3300005834 Ga0068851_10001171 Ga0068851_1000117111 220
601 3300005842 Ga0068858_100000536 Ga0068858_1000005365 220
602 3300006186 Ga0075369_10025543 Ga0075369_100255432 220
603 3300006353 Ga0075370_10109882 Ga0075370_101098823 220
604 3300006931 Ga0097620_100746999 Ga0097620_1007469992 220
605 3300009011 Ga0105251_10000108 Ga0105251_1000010851 220
606 3300009093 Ga0105240_10301577 Ga0105240_103015772 220
607 3300009093 Ga0105240_11297319 Ga0105240_112973191 220
608 3300009148 Ga0105243_10099579 Ga0105243_100995793 220
609 3300009174 Ga0105241_10123844 Ga0105241_101238442 220
610 3300009176 Ga0105242_10375978 Ga0105242_103759781 220
611 3300009551 Ga0105238_10006153 Ga0105238_100061538 220
612 3300009553 Ga0105249_10035359 Ga0105249_100353595 220
613 3300010375 Ga0105239_10275318 Ga0105239_102753182 220
614 3300013105 Ga0157369_10195896 Ga0157369_101958962 220
615 3300013296 Ga0157374_10042784 Ga0157374_100427842 220
616 3300013306 Ga0163162_10570994 Ga0163162_105709942 220
617 3300013307 Ga0157372_10070485 Ga0157372_100704854 220
618 3300013307 Ga0157372_10205339 Ga0157372_102053392 220
619 3300015265 Ga0182005_1008509 Ga0182005_10085096 220
620 3300025245 Ga0207425_1000078 Ga0207425_100007854 220
621 3300025258 Ga0209129_1000157 Ga0209129_100015739 220
622 3300025294 Ga0209025_1000054 Ga0209025_1000054221 220
623 3300025297 Ga0209758_1000062 Ga0209758_1000062221 220
624 3300025321 Ga0207656_10003911 Ga0207656_100039113 220
625 3300025735 Ga0207713_1000507 Ga0207713_100050714 220
626 3300025903 Ga0207680_10014375 Ga0207680_100143753 220
627 3300025904 Ga0207647_10000091 Ga0207647_100000912 220
628 3300025913 Ga0207695_10046068 Ga0207695_100460682 220
629 3300025914 Ga0207671_10016712 Ga0207671_100167125 220
630 3300025924 Ga0207694_10005892 Ga0207694_1000589210 220
631 3300025925 Ga0207650_10005976 Ga0207650_100059767 220
632 3300025925 Ga0207650_10044411 Ga0207650_100444113 220
633 3300025933 Ga0207706_10005093 Ga0207706_100050935 220
634 3300025934 Ga0207686_10332711 Ga0207686_103327112 220
635 3300025935 Ga0207709_10004718 Ga0207709_100047188 220
636 3300025938 Ga0207704_10040853 Ga0207704_100408532 220
637 3300025949 Ga0207667_10139507 Ga0207667_101395074 220
638 3300025960 Ga0207651_10154167 Ga0207651_101541672 220
639 3300025961 Ga0207712_10000254 Ga0207712_1000025444 220
640 3300025981 Ga0207640_10017834 Ga0207640_100178343 220
641 3300026035 Ga0207703_10000925 Ga0207703_1000092520 220
642 3300026041 Ga0207639_10000234 Ga0207639_100002345 220
643 3300026067 Ga0207678_10020429 Ga0207678_100204293 220
644 3300026078 Ga0207702_10138612 Ga0207702_101386122 220
645 3300026121 Ga0207683_10282421 Ga0207683_102824212 220
646 3300027312 Ga0209371_1000059 Ga0209371_1000059154 220
647 3300028379 Ga0268266_10000006 Ga0268266_10000006361 220
648 3300030500 Ga0268256_1000055 Ga0268256_100005545 220
649 3300030521 Ga0307511_10000003 Ga0307511_10000003115 220
650 3300041459 Ga0451800_0056998 Ga0451800_0056998_681_1343 220
651 3300041462 Ga0451806_353890 Ga0451806_353890_101_763 220
652 3300041486 Ga0451807_2639821 Ga0451807_2639821_594_1256 220
653 3300041494 Ga0451837_1499872 Ga0451837_1499872_808_1470 220
654 3300048929 Ga0496126_0023054 Ga0496126_0023054_3283_3945 220
655 3300049568 Ga0501031_0055663 Ga0501031_0055663_264_926 220
656 3300049569 Ga0501032_0160109 Ga0501032_0160109_597_1259 220
657 3300049574 Ga0501038_0013359 Ga0501038_0013359_493_1155 220
658 3300049581 Ga0501047_0121320 Ga0501047_0121320_307_969 220
659 3300049581 Ga0501047_0136853 Ga0501047_0136853_605_1267 220
660 3300049584 Ga0501068_0069669 Ga0501068_0069669_199_861 220
661 3300049589 Ga0501073_0299458 Ga0501073_0299458_199_861 220
662 3300049686 Ga0501257_030626 Ga0501257_030626_510_1172 220
663 3300049741 Ga0501079_0441093 Ga0501079_0441093_81_743 220
664 3300049823 Ga0501044_0008551 Ga0501044_0008551_8454_9116 220
665 3300050493 nmdc:mga0k408_83794_c1 nmdc:mga0k408_83794_c1_741_1418 220
666 3300050495 nmdc:mga04h51_59713_c1 nmdc:mga04h51_59713_c1_58_735 220
667 3300050496 nmdc:mga07m45_102654_c1 nmdc:mga07m45_102654_c1_473_1150 220
668 3300050516 nmdc:mga0sz30_50814_c1 nmdc:mga0sz30_50814_c1_137_802 220
669 3300053088 Ga0500644_0082120 Ga0500644_0082120_316_981 220
670 3300053090 Ga0500646_0001514 Ga0500646_0001514_908_1573 220
671 3300053093 Ga0500651_0006850 Ga0500651_0006850_2532_3197 220
672 3300053118 Ga0500594_0058209 Ga0500594_0058209_404_1069 220
673 3300053151 Ga0500604_0016262 Ga0500604_0016262_1345_2010 220
674 3300053153 Ga0500616_0147228 Ga0500616_0147228_178_843 220
675 3300053161 Ga0500634_0000095 Ga0500634_0000095_7401_8063 220
676 3300053162 Ga0500638_121744 Ga0500638_121744_293_982 220
677 3300006051 Ga0075364_10001177 Ga0075364_100011776 221
678 3300044673 Ga0453683_0450766 Ga0453683_0450766_31_708 221
679 3300003187 JGI25151J46595_10000148 JGI25151J46595_100001484 222
680 3300003187 JGI25151J46595_10063635 JGI25151J46595_100636351 222
681 3300003771 Ga0055526_1009856 Ga0055526_10098565 222
682 3300003775 Ga0055524_1010630 Ga0055524_10106302 222
683 3300003856 Ga0058692_1000012 Ga0058692_1000012222 222
684 3300014497 Ga0182008_10011603 Ga0182008_100116032 222
685 3300025245 Ga0207425_1013633 Ga0207425_10136332 222
686 3300025284 Ga0209130_1008523 Ga0209130_10085233 222
687 3300025294 Ga0209025_1000005 Ga0209025_1000005648 222
688 3300025294 Ga0209025_1005818 Ga0209025_10058189 222
689 3300025295 Ga0209564_1012031 Ga0209564_10120312 222
690 3300025297 Ga0209758_1014433 Ga0209758_10144336 222
691 3300025297 Ga0209758_1036125 Ga0209758_10361252 222
692 3300025303 Ga0209051_1015560 Ga0209051_10155602 222
693 3300025304 Ga0209257_1000369 Ga0209257_100036913 222
694 3300025304 Ga0209257_1002588 Ga0209257_100258816 222
695 3300025304 Ga0209257_1052746 Ga0209257_10527462 222
696 3300038705 Ga0237819_04805 Ga0237819_04805_1049_1777 222
697 3300041407 Ga0439447_001882 Ga0439447_001882_4416_5144 222
698 3300049579 Ga0501043_0005996 Ga0501043_0005996_5760_6446 222
699 iso_pu_bacteria 2643221593 2643976710 222
700 iso_pu_bacteria 2941489479 2941490473 222
701 2162886007 SwRhRL2b_contig_361393 SwRhRL2b_0571.00007880 223
702 3300025914 Ga0207671_10132651 Ga0207671_101326512 223
703 3300030733 Ga0314311_1040974 Ga0314311_10409744 223
704 3300038705 Ga0237819_00252 Ga0237819_00252_9269_9940 223
705 3300047472 Ga0495686_0034339 Ga0495686_0034339_927_1598 223
706 3300048920 Ga0496117_0009735 Ga0496117_0009735_1387_2058 223
707 3300048921 Ga0496118_0109391 Ga0496118_0109391_796_1467 223
708 3300048922 Ga0496119_0006339 Ga0496119_0006339_2598_3269 223
709 3300048923 Ga0496120_0002462 Ga0496120_0002462_15472_16143 223
710 3300048925 Ga0496122_0003014 Ga0496122_0003014_15484_16155 223
711 3300048926 Ga0496123_0000619 Ga0496123_0000619_56750_57421 223
712 3300048927 Ga0496124_0008706 Ga0496124_0008706_2118_2789 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

68

220

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wak-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a 0.9664 37 219
4wam-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a/p48s/a49p 0.9654 37 221
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.965 36 221
4wak-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a 0.9627 38 217
3qy1-assembly1.cif.gz_B 1.54a resolution crystal structure of a beta-carbonic anhydrase from salmonella enterica subsp. enterica serovar typhimurium str. lt2 0.9619 5 217
ID Description Score Start End Superfamily
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9567 37 223 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9541 4 219 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9495 36 223 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9411 37 223 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.925 4 219 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A354YFJ4-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9996 101 223 GO:0004089
GO:0008270
GO:0015976
AF-A0A354YFJ4-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9915 101 223 GO:0004089
GO:0008270
GO:0015976
AF-A0A080M7H3-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9884 50 218 GO:0004089
GO:0008270
GO:0015976
AF-A0A3L7X137-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9881 92 214 GO:0004089
GO:0008270
GO:0015976
AF-A0A7V7ZFG5-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9873 22 217 GO:0004089
GO:0008270
GO:0015976

Feature Viewer

pLDDT pTM Quality
94.57 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map