F476906

General Info

Members Datasets Scaffolds Average Seq Length
713 281 701 234

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0013009|Ga0495668_0013009_671_1486
Length 271
Sequence MEKIAIDQIRIAHFSVRNWLDNGLTMRKVRRHEQGQTMIEAEWWDYDSPSEMAEAVAGDVGFIIESALDARGEALLALPGGTTAGPIYEKLAKTKLNWKRVTIIPTDDRLVPVSDPRSNIAMIARHFIPLGTRVVPIVSESAADYRAAGNAANGRLDDMKWPPDLVWLSIGIDGHVASLFPGPDLNDAIEAPASRRAIGVLPDPMPEDAAVARVSLTRSAMLSARTLIIVGSGDSKREVLETALEEGKRSTSPIGRVLADCELPVDIHWLS

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
3 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
6 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
7 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
8 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
9 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
10 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
11 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
267 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
268 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
275 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 5.05
Rhizosphere 88.36
Stem 0
Stem Tuber 0.14
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001406 3300001904 Bacteria 4404
2 JGI24741J21665_1003224 3300001915 Bacteria 3966
3 JGI24752J21851_1000080 3300001976 Bacteria 12759
4 JGI24752J21851_1000160 3300001976 Bacteria 9211
5 JGI24746J21847_1000985 3300001977 Bacteria 4477
6 JGI24740J21852_10005926 3300001979 Bacteria 5120
7 JGI24739J22299_10007504 3300001989 Bacteria 4088
8 JGI24739J22299_10033310 3300001989 Bacteria 1764
9 JGI24739J22299_10037287 3300001989 Bacteria 1638
10 JGI24737J22298_10000929 3300001990 Bacteria 10391
11 JGI24737J22298_10007765 3300001990 Bacteria 3616
12 JGI24750J21931_1001069 3300002070 Bacteria 3571
13 JGI24748J21848_1000013 3300002074 Bacteria 149648
14 JGI24738J21930_10001426 3300002075 Bacteria 6629
15 JGI24738J21930_10004835 3300002075 Bacteria 3271
16 JGI24749J21850_1000099 3300002076 Bacteria 14965
17 JGI24749J21850_1003838 3300002076 Bacteria 2098
18 JGI24749J21850_1005832 3300002076 Bacteria 1718
19 JGI24033J26618_1007065 3300002155 Bacteria 1269
20 JGI24034J26672_10000011 3300002239 Bacteria 148169
21 JGI24034J26672_10010937 3300002239 Bacteria 1354
22 JGI24742J22300_10005410 3300002244 Bacteria 2099
23 JGI24751J29686_10000542 3300002459 Bacteria 10514
24 JGI24751J29686_10022337 3300002459 Bacteria 1313
25 rootH1_10352848 3300003323 Bacteria 2306
26 Ga0065704_10077371 3300005289 Bacteria 4759
27 Ga0065715_10000860 3300005293 Bacteria 10507
28 Ga0065715_10422059 3300005293 Bacteria 855
29 Ga0065707_10000450 3300005295 Bacteria 70667
30 Ga0065707_10105218 3300005295 Bacteria 2655
31 Ga0070658_10003485 3300005327 Bacteria 12923
32 Ga0070658_10041850 3300005327 Bacteria 3696
33 Ga0070658_10051923 3300005327 Bacteria 3324
34 Ga0070658_10101506 3300005327 Bacteria 2378
35 Ga0070676_10024298 3300005328 Bacteria 3413
36 Ga0070683_100004273 3300005329 Bacteria 11728
37 Ga0070690_100000003 3300005330 Bacteria 144748
38 Ga0070690_100003881 3300005330 Bacteria 8242
39 Ga0070670_100000014 3300005331 Bacteria 234648
40 Ga0070670_100000047 3300005331 Bacteria 136625
41 Ga0070670_100001686 3300005331 Bacteria 17947
42 Ga0070670_100003161 3300005331 Bacteria 13616
43 Ga0070670_100021229 3300005331 Bacteria 5587
44 Ga0070670_100046115 3300005331 Bacteria 3748
45 Ga0070670_100141122 3300005331 Bacteria 2083
46 Ga0070677_10002154 3300005333 Bacteria 6292
47 Ga0070666_10000176 3300005335 Bacteria 43811
48 Ga0070666_10008520 3300005335 Bacteria 6370
49 Ga0068868_100023218 3300005338 Bacteria 4692
50 Ga0068868_100459188 3300005338 Bacteria 1109
51 Ga0070660_100017906 3300005339 Bacteria 5168
52 Ga0070660_100027908 3300005339 Bacteria 4218
53 Ga0070660_100038152 3300005339 Bacteria 3645
54 Ga0070660_100067331 3300005339 Bacteria 2790
55 Ga0070660_100100055 3300005339 Bacteria 2296
56 Ga0070689_100198125 3300005340 Bacteria 1638
57 Ga0070661_100015664 3300005344 Bacteria 5351
58 Ga0070661_100056713 3300005344 Bacteria 2870
59 Ga0070661_100123275 3300005344 Bacteria 1942
60 Ga0070661_100211894 3300005344 Bacteria 1483
61 Ga0070668_100000001 3300005347 Bacteria 275905
62 Ga0070668_100001607 3300005347 Bacteria 16353
63 Ga0070668_100005405 3300005347 Bacteria 9482
64 Ga0070668_100238676 3300005347 Bacteria 1505
65 Ga0070669_100000014 3300005353 Bacteria 206875
66 Ga0070669_100000072 3300005353 Bacteria 99184
67 Ga0070669_100001322 3300005353 Bacteria 17877
68 Ga0070669_100023481 3300005353 Bacteria 4415
69 Ga0070669_100327200 3300005353 Bacteria 1239
70 Ga0070675_100001353 3300005354 Bacteria 17951
71 Ga0070675_100959047 3300005354 Bacteria 785
72 Ga0070671_100000106 3300005355 Bacteria 53385
73 Ga0070671_100011279 3300005355 Bacteria 7180
74 Ga0070671_100012896 3300005355 Bacteria 6738
75 Ga0070671_100015271 3300005355 Bacteria 6201
76 Ga0070671_100016773 3300005355 Bacteria 5923
77 Ga0070671_100062948 3300005355 Bacteria 3089
78 Ga0070674_100027724 3300005356 Bacteria 3714
79 Ga0070674_100172317 3300005356 Bacteria 1651
80 Ga0070674_100313601 3300005356 Bacteria 1255
81 Ga0070673_100001125 3300005364 Bacteria 15355
82 Ga0070673_100006322 3300005364 Bacteria 7693
83 Ga0070673_100162680 3300005364 Bacteria 1899
84 Ga0070688_100000740 3300005365 Bacteria 16080
85 Ga0070659_100038333 3300005366 Bacteria 3738
86 Ga0070659_100049850 3300005366 Bacteria 3293
87 Ga0070659_100125598 3300005366 Bacteria 2081
88 Ga0070659_100191885 3300005366 Bacteria 1679
89 Ga0070659_100941139 3300005366 Bacteria 756
90 Ga0070667_100000006 3300005367 Bacteria 336732
91 Ga0070667_100000144 3300005367 Bacteria 89681
92 Ga0070667_100005432 3300005367 Bacteria 10645
93 Ga0070667_100010339 3300005367 Bacteria 7707
94 Ga0070667_100011171 3300005367 Bacteria 7429
95 Ga0070667_100012958 3300005367 Bacteria 6894
96 Ga0070714_100156476 3300005435 Bacteria 2058
97 Ga0070713_100129476 3300005436 Bacteria 2224
98 Ga0070713_100210091 3300005436 Bacteria 1762
99 Ga0070663_100010813 3300005455 Bacteria 5701
100 Ga0070663_100074477 3300005455 Bacteria 2479
101 Ga0070663_100122143 3300005455 Bacteria 1969
102 Ga0070678_100028839 3300005456 Bacteria 3791
103 Ga0070678_100046580 3300005456 Bacteria 3110
104 Ga0070662_100000741 3300005457 Bacteria 19985
105 Ga0070662_100002121 3300005457 Bacteria 12156
106 Ga0070662_100136878 3300005457 Bacteria 1894
107 Ga0070662_100139437 3300005457 Bacteria 1877
108 Ga0070662_100237280 3300005457 Bacteria 1461
109 Ga0068867_100050084 3300005459 Bacteria 3077
110 Ga0070685_10000034 3300005466 Bacteria 81799
111 Ga0070679_100459015 3300005530 Bacteria 1218
112 Ga0070684_100000841 3300005535 Bacteria 21613
113 Ga0070684_100204313 3300005535 Bacteria 1800
114 Ga0070684_100333746 3300005535 Bacteria 1394
115 Ga0068853_100024201 3300005539 Bacteria 5090
116 Ga0068853_100072666 3300005539 Bacteria 2998
117 Ga0068853_100115983 3300005539 Bacteria 2384
118 Ga0068853_100379080 3300005539 Bacteria 1320
119 Ga0068853_100568877 3300005539 Unclassified 1075
120 Ga0070672_100008666 3300005543 Bacteria 6972
121 Ga0070672_100231577 3300005543 Unclassified 1552
122 Ga0070686_100000023 3300005544 Bacteria 130174
123 Ga0070686_100016476 3300005544 Bacteria 4300
124 Ga0070665_100000019 3300005548 Bacteria 413972
125 Ga0070665_100097517 3300005548 Bacteria 2944
126 Ga0070665_100445744 3300005548 Bacteria 1304
127 Ga0068855_100472023 3300005563 Bacteria 1366
128 Ga0070664_100055951 3300005564 Bacteria 3351
129 Ga0070664_100447642 3300005564 Bacteria 1185
130 Ga0068857_100059516 3300005577 Bacteria 3393
131 Ga0068857_100083933 3300005577 Bacteria 2846
132 Ga0068857_100104890 3300005577 Bacteria 2538
133 Ga0068857_100499871 3300005577 Bacteria 1141
134 Ga0068854_100031128 3300005578 Bacteria 3706
135 Ga0068854_100037269 3300005578 Bacteria 3412
136 Ga0068854_100303659 3300005578 Bacteria 1292
137 Ga0068856_100131804 3300005614 Bacteria 2504
138 Ga0068856_100167170 3300005614 Bacteria 2211
139 Ga0070702_100243359 3300005615 Bacteria 1215
140 Ga0068852_100011677 3300005616 Bacteria 6624
141 Ga0068852_100014143 3300005616 Bacteria 6129
142 Ga0068852_100038258 3300005616 Bacteria 4030
143 Ga0068852_100143339 3300005616 Bacteria 2213
144 Ga0068859_100004899 3300005617 Bacteria 13638
145 Ga0068859_100012629 3300005617 Bacteria 8491
146 Ga0068859_100018286 3300005617 Bacteria 7047
147 Ga0068859_100047437 3300005617 Bacteria 4316
148 Ga0068859_100060005 3300005617 Bacteria 3833
149 Ga0068859_100186610 3300005617 Bacteria 2157
150 Ga0068864_100000021 3300005618 Bacteria 262378
151 Ga0068864_100000051 3300005618 Bacteria 136621
152 Ga0068864_100000306 3300005618 Bacteria 43501
153 Ga0068864_100001847 3300005618 Bacteria 17419
154 Ga0068864_100002997 3300005618 Bacteria 13957
155 Ga0068864_100038921 3300005618 Bacteria 4063
156 Ga0068864_100864567 3300005618 Bacteria 892
157 Ga0068866_10027614 3300005718 Bacteria 2695
158 Ga0068866_10292850 3300005718 Bacteria 1013
159 Ga0068861_100003101 3300005719 Bacteria 10987
160 Ga0068861_100111784 3300005719 Bacteria 2190
161 Ga0068851_10012912 3300005834 Bacteria 3945
162 Ga0068863_100000009 3300005841 Bacteria 250538
163 Ga0068863_100000044 3300005841 Bacteria 149959
164 Ga0068863_100001228 3300005841 Bacteria 25562
165 Ga0068863_100029535 3300005841 Bacteria 5233
166 Ga0068863_100141123 3300005841 Bacteria 2302
167 Ga0068858_100000555 3300005842 Bacteria 38954
168 Ga0068858_100012260 3300005842 Bacteria 8082
169 Ga0068858_100094471 3300005842 Unclassified 2785
170 Ga0068860_100000074 3300005843 Bacteria 173022
171 Ga0068860_100000601 3300005843 Bacteria 42993
172 Ga0068860_100091147 3300005843 Bacteria 2904
173 Ga0068860_100236451 3300005843 Bacteria 1776
174 Ga0068862_100000017 3300005844 Bacteria 247616
175 Ga0068862_100000036 3300005844 Bacteria 173453
176 Ga0068862_100000700 3300005844 Bacteria 34279
177 Ga0068862_100001801 3300005844 Bacteria 19394
178 Ga0068862_100004294 3300005844 Bacteria 12057
179 Ga0068862_100030889 3300005844 Bacteria 4517
180 Ga0068862_100126154 3300005844 Bacteria 2260
181 Ga0081455_10000244 3300005937 Bacteria 70746
182 Ga0070717_10498722 3300006028 Bacteria 1100
183 Ga0097621_100008240 3300006237 Bacteria 7496
184 Ga0068871_100225210 3300006358 Bacteria 1626
185 Ga0068865_100009906 3300006881 Bacteria 5922
186 Ga0068865_100076748 3300006881 Bacteria 2386
187 Ga0097620_100004899 3300006931 Bacteria 13638
188 Ga0097620_100012629 3300006931 Bacteria 8491
189 Ga0097620_100018286 3300006931 Bacteria 7047
190 Ga0097620_100038608 3300006931 Bacteria 4790
191 Ga0097620_100047436 3300006931 Bacteria 4316
192 Ga0097620_100060006 3300006931 Bacteria 3833
193 Ga0097620_100186601 3300006931 Bacteria 2157
194 Ga0105251_10000507 3300009011 Bacteria 36839
195 Ga0111539_10357984 3300009094 Bacteria 1698
196 Ga0105245_10021056 3300009098 Bacteria 5720
197 Ga0105247_10084611 3300009101 Bacteria 2004
198 Ga0105247_10128225 3300009101 Bacteria 1651
199 Ga0105243_10053958 3300009148 Bacteria 3189
200 Ga0105243_10085310 3300009148 Bacteria 2588
201 Ga0105241_10035270 3300009174 Bacteria 3762
202 Ga0105242_10122298 3300009176 Bacteria 2236
203 Ga0105248_10000030 3300009177 Bacteria 206609
204 Ga0105248_10000662 3300009177 Bacteria 39143
205 Ga0105248_10027779 3300009177 Bacteria 6301
206 Ga0105248_10043610 3300009177 Bacteria 5030
207 Ga0105248_10143208 3300009177 Bacteria 2697
208 Ga0105248_10283132 3300009177 Bacteria 1866
209 Ga0105248_10320155 3300009177 Bacteria 1747
210 Ga0105248_10371965 3300009177 Bacteria 1609
211 Ga0105248_10707411 3300009177 Bacteria 1137
212 Ga0105237_10006580 3300009545 Bacteria 12855
213 Ga0105237_10067830 3300009545 Bacteria 3561
214 Ga0105238_10006524 3300009551 Bacteria 11613
215 Ga0105238_10053669 3300009551 Bacteria 4050
216 Ga0105238_10138388 3300009551 Bacteria 2412
217 Ga0105238_10957705 3300009551 Bacteria 876
218 Ga0105238_10957706 3300009551 Bacteria 876
219 Ga0105249_10000137 3300009553 Bacteria 95985
220 Ga0105249_10000390 3300009553 Bacteria 42999
221 Ga0105249_10007780 3300009553 Bacteria 9339
222 Ga0105249_10183293 3300009553 Bacteria 2038
223 Ga0105239_10012441 3300010375 Bacteria 9479
224 Ga0105239_10322877 3300010375 Unclassified 1741
225 Ga0157373_10083231 3300013100 Bacteria 2255
226 Ga0157373_10342795 3300013100 Bacteria 1065
227 Ga0157371_10010300 3300013102 Bacteria 7294
228 Ga0157371_10063063 3300013102 Bacteria 2627
229 Ga0157370_10060985 3300013104 Bacteria 3579
230 Ga0157370_10213666 3300013104 Bacteria 1787
231 Ga0157370_10342038 3300013104 Bacteria 1379
232 Ga0157370_10346591 3300013104 Bacteria 1369
233 Ga0157370_10353480 3300013104 Bacteria 1354
234 Ga0157369_10053489 3300013105 Bacteria 4364
235 Ga0157369_10060021 3300013105 Bacteria 4102
236 Ga0157369_10087703 3300013105 Bacteria 3322
237 Ga0157369_10631466 3300013105 Bacteria 1105
238 Ga0157369_10908389 3300013105 Bacteria 903
239 Ga0157378_10018423 3300013297 Bacteria 6131
240 Ga0157378_10545740 3300013297 Bacteria 1164
241 Ga0163162_10047411 3300013306 Bacteria 4306
242 Ga0163162_10085773 3300013306 Bacteria 3226
243 Ga0163162_10153079 3300013306 Bacteria 2424
244 Ga0163162_10179430 3300013306 Bacteria 2243
245 Ga0163162_10208314 3300013306 Bacteria 2084
246 Ga0163162_10496668 3300013306 Bacteria 1351
247 Ga0157372_10025303 3300013307 Bacteria 6451
248 Ga0157372_10212139 3300013307 Bacteria 2244
249 Ga0157375_10039075 3300013308 Bacteria 4563
250 Ga0157375_10221373 3300013308 Bacteria 2051
251 Ga0163163_10048624 3300014325 Bacteria 4171
252 Ga0163163_10049520 3300014325 Bacteria 4136
253 Ga0157380_10000130 3300014326 Bacteria 41786
254 Ga0157380_10000276 3300014326 Bacteria 30816
255 Ga0157380_10001012 3300014326 Bacteria 17871
256 Ga0157380_10004675 3300014326 Bacteria 9531
257 Ga0157380_10023921 3300014326 Bacteria 4616
258 Ga0157377_10041819 3300014745 Bacteria 2544
259 Ga0157379_10007527 3300014968 Bacteria 9426
260 Ga0157379_10048531 3300014968 Bacteria 3789
261 Ga0157376_10008531 3300014969 Bacteria 7401
262 Ga0163161_10000718 3300017792 Bacteria 26157
263 Ga0163161_10000723 3300017792 Bacteria 25974
264 Ga0163161_10031070 3300017792 Bacteria 3803
265 Ga0163161_10215557 3300017792 Bacteria 1484
266 Ga0213874_10013842 3300021377 Bacteria 2099
267 Ga0207672_1000583 3300025223 Bacteria 4435
268 Ga0207697_10000595 3300025315 Bacteria 20569
269 Ga0207697_10025200 3300025315 Bacteria 2432
270 Ga0207697_10027436 3300025315 Bacteria 2327
271 Ga0207656_10004664 3300025321 Bacteria 4802
272 Ga0207656_10029168 3300025321 Bacteria 2270
273 Ga0207713_1030856 3300025735 Bacteria 2380
274 Ga0207682_10001140 3300025893 Bacteria 12312
275 Ga0207710_10029782 3300025900 Bacteria 2378
276 Ga0207710_10105106 3300025900 Bacteria 1336
277 Ga0207688_10210920 3300025901 Bacteria 1167
278 Ga0207680_10000081 3300025903 Bacteria 43007
279 Ga0207680_10018306 3300025903 Bacteria 3721
280 Ga0207647_10033782 3300025904 Bacteria 3271
281 Ga0207647_10065007 3300025904 Bacteria 2215
282 Ga0207645_10027573 3300025907 Bacteria 3667
283 Ga0207705_10002277 3300025909 Bacteria 14851
284 Ga0207705_10015211 3300025909 Bacteria 5528
285 Ga0207705_10017957 3300025909 Bacteria 5059
286 Ga0207705_10021128 3300025909 Bacteria 4643
287 Ga0207705_10033698 3300025909 Bacteria 3659
288 Ga0207705_10127862 3300025909 Bacteria 1889
289 Ga0207654_10001441 3300025911 Bacteria 12612
290 Ga0207654_10018673 3300025911 Bacteria 3643
291 Ga0207707_10168717 3300025912 Bacteria 1913
292 Ga0207695_10070959 3300025913 Bacteria 3559
293 Ga0207695_10146879 3300025913 Bacteria 2301
294 Ga0207671_10008068 3300025914 Bacteria 8996
295 Ga0207671_10019862 3300025914 Bacteria 5128
296 Ga0207671_10180695 3300025914 Bacteria 1642
297 Ga0207657_10003139 3300025919 Bacteria 17676
298 Ga0207657_10038683 3300025919 Bacteria 4244
299 Ga0207657_10056177 3300025919 Bacteria 3397
300 Ga0207657_10088189 3300025919 Bacteria 2594
301 Ga0207657_10142302 3300025919 Unclassified 1959
302 Ga0207649_10052336 3300025920 Bacteria 2533
303 Ga0207649_10150387 3300025920 Bacteria 1603
304 Ga0207649_10447580 3300025920 Bacteria 974
305 Ga0207652_10250991 3300025921 Bacteria 1595
306 Ga0207681_10000061 3300025923 Bacteria 102257
307 Ga0207681_10000082 3300025923 Bacteria 84963
308 Ga0207681_10001281 3300025923 Bacteria 16234
309 Ga0207681_10108942 3300025923 Bacteria 2011
310 Ga0207681_10305920 3300025923 Bacteria 1259
311 Ga0207694_10006657 3300025924 Bacteria 8777
312 Ga0207694_10008012 3300025924 Bacteria 7989
313 Ga0207694_10025521 3300025924 Bacteria 4492
314 Ga0207694_10254608 3300025924 Bacteria 1437
315 Ga0207650_10000038 3300025925 Bacteria 206081
316 Ga0207650_10000095 3300025925 Bacteria 116052
317 Ga0207650_10000861 3300025925 Bacteria 23057
318 Ga0207650_10000897 3300025925 Bacteria 22469
319 Ga0207650_10082005 3300025925 Bacteria 2447
320 Ga0207659_10004033 3300025926 Bacteria 8862
321 Ga0207700_10206411 3300025928 Bacteria 1658
322 Ga0207664_10328413 3300025929 Bacteria 1350
323 Ga0207644_10000047 3300025931 Bacteria 103158
324 Ga0207644_10001654 3300025931 Bacteria 14363
325 Ga0207644_10002074 3300025931 Bacteria 12971
326 Ga0207644_10002206 3300025931 Bacteria 12638
327 Ga0207644_10003796 3300025931 Bacteria 9786
328 Ga0207644_10028465 3300025931 Bacteria 3869
329 Ga0207644_10042019 3300025931 Bacteria 3237
330 Ga0207644_10215617 3300025931 Bacteria 1519
331 Ga0207690_10060516 3300025932 Bacteria 2570
332 Ga0207690_10067986 3300025932 Bacteria 2446
333 Ga0207690_10072123 3300025932 Bacteria 2384
334 Ga0207690_10135103 3300025932 Bacteria 1810
335 Ga0207690_10175858 3300025932 Bacteria 1607
336 Ga0207690_10529168 3300025932 Bacteria 956
337 Ga0207706_10001065 3300025933 Bacteria 27880
338 Ga0207706_10002092 3300025933 Bacteria 19526
339 Ga0207706_10006146 3300025933 Bacteria 11151
340 Ga0207706_10049700 3300025933 Bacteria 3705
341 Ga0207706_10068243 3300025933 Bacteria 3129
342 Ga0207686_10049887 3300025934 Bacteria 2600
343 Ga0207709_10019687 3300025935 Bacteria 3799
344 Ga0207670_10322390 3300025936 Bacteria 1216
345 Ga0207669_10094646 3300025937 Bacteria 1955
346 Ga0207669_10259693 3300025937 Bacteria 1298
347 Ga0207665_10012224 3300025939 Bacteria 5638
348 Ga0207691_10002271 3300025940 Bacteria 18831
349 Ga0207691_10004006 3300025940 Bacteria 14287
350 Ga0207691_10389506 3300025940 Unclassified 1189
351 Ga0207711_10000029 3300025941 Bacteria 206826
352 Ga0207711_10000254 3300025941 Bacteria 57648
353 Ga0207711_10004526 3300025941 Bacteria 11836
354 Ga0207711_10046418 3300025941 Bacteria 3711
355 Ga0207711_10157542 3300025941 Bacteria 2053
356 Ga0207661_10008596 3300025944 Bacteria 7297
357 Ga0207661_10196889 3300025944 Bacteria 1769
358 Ga0207679_10073625 3300025945 Bacteria 2585
359 Ga0207679_10099501 3300025945 Bacteria 2271
360 Ga0207679_10176992 3300025945 Bacteria 1762
361 Ga0207679_10515156 3300025945 Bacteria 1069
362 Ga0207667_10004100 3300025949 Bacteria 17907
363 Ga0207667_10141917 3300025949 Bacteria 2473
364 Ga0207667_10175962 3300025949 Bacteria 2198
365 Ga0207651_10000766 3300025960 Bacteria 13825
366 Ga0207651_10001642 3300025960 Bacteria 10273
367 Ga0207651_10006978 3300025960 Bacteria 5979
368 Ga0207651_10059332 3300025960 Bacteria 2650
369 Ga0207712_10000335 3300025961 Bacteria 43007
370 Ga0207712_10000734 3300025961 Bacteria 24952
371 Ga0207712_10008869 3300025961 Bacteria 6357
372 Ga0207712_10065333 3300025961 Bacteria 2596
373 Ga0207668_10000009 3300025972 Bacteria 188071
374 Ga0207668_10000651 3300025972 Bacteria 21279
375 Ga0207668_10004813 3300025972 Bacteria 7945
376 Ga0207668_10034946 3300025972 Bacteria 3342
377 Ga0207668_10217044 3300025972 Bacteria 1533
378 Ga0207668_10672098 3300025972 Bacteria 908
379 Ga0207640_10009909 3300025981 Bacteria 5350
380 Ga0207640_10030017 3300025981 Bacteria 3345
381 Ga0207640_10033724 3300025981 Bacteria 3188
382 Ga0207640_10334792 3300025981 Bacteria 1210
383 Ga0207658_10000010 3300025986 Bacteria 240224
384 Ga0207658_10000728 3300025986 Bacteria 28460
385 Ga0207658_10001866 3300025986 Bacteria 15789
386 Ga0207658_10004027 3300025986 Bacteria 10284
387 Ga0207658_10018853 3300025986 Bacteria 4772
388 Ga0207658_10067794 3300025986 Bacteria 2689
389 Ga0207677_10021253 3300026023 Bacteria 3961
390 Ga0207677_10234867 3300026023 Bacteria 1479
391 Ga0207703_10000368 3300026035 Bacteria 48197
392 Ga0207703_10000822 3300026035 Bacteria 30583
393 Ga0207703_10002210 3300026035 Bacteria 17083
394 Ga0207703_10013306 3300026035 Bacteria 6410
395 Ga0207703_10015512 3300026035 Bacteria 5940
396 Ga0207639_10000136 3300026041 Bacteria 54387
397 Ga0207639_10025845 3300026041 Bacteria 4260
398 Ga0207639_10109442 3300026041 Bacteria 2248
399 Ga0207639_10231045 3300026041 Bacteria 1603
400 Ga0207678_10021656 3300026067 Bacteria 5637
401 Ga0207678_10226565 3300026067 Bacteria 1600
402 Ga0207708_10122700 3300026075 Bacteria 2025
403 Ga0207702_10008931 3300026078 Bacteria 8451
404 Ga0207702_10105164 3300026078 Bacteria 2500
405 Ga0207702_10120149 3300026078 Bacteria 2350
406 Ga0207702_10244348 3300026078 Bacteria 1683
407 Ga0207702_10260779 3300026078 Bacteria 1632
408 Ga0207702_10291475 3300026078 Bacteria 1546
409 Ga0207702_10704662 3300026078 Bacteria 995
410 Ga0207641_10000017 3300026088 Bacteria 299119
411 Ga0207641_10000073 3300026088 Bacteria 149989
412 Ga0207641_10000914 3300026088 Bacteria 30517
413 Ga0207641_10010624 3300026088 Bacteria 7556
414 Ga0207641_10133438 3300026088 Bacteria 2232
415 Ga0207648_10004534 3300026089 Bacteria 14239
416 Ga0207648_10043202 3300026089 Bacteria 3957
417 Ga0207676_10000034 3300026095 Bacteria 206058
418 Ga0207676_10000037 3300026095 Bacteria 180826
419 Ga0207676_10000193 3300026095 Bacteria 53147
420 Ga0207676_10000781 3300026095 Bacteria 24823
421 Ga0207676_10000956 3300026095 Bacteria 22336
422 Ga0207676_10008378 3300026095 Bacteria 7348
423 Ga0207676_10023450 3300026095 Bacteria 4553
424 Ga0207676_10196790 3300026095 Bacteria 1778
425 Ga0207676_10251517 3300026095 Bacteria 1591
426 Ga0207674_10007312 3300026116 Bacteria 12867
427 Ga0207674_10012221 3300026116 Bacteria 9604
428 Ga0207674_10659374 3300026116 Bacteria 1010
429 Ga0207675_100001462 3300026118 Bacteria 23681
430 Ga0207675_100040755 3300026118 Bacteria 4337
431 Ga0207675_100042095 3300026118 Bacteria 4263
432 Ga0207683_10001298 3300026121 Bacteria 22583
433 Ga0207683_10002767 3300026121 Bacteria 15321
434 Ga0207698_10006770 3300026142 Bacteria 7163
435 Ga0207698_10020877 3300026142 Bacteria 4518
436 Ga0207698_10030281 3300026142 Bacteria 3889
437 Ga0207698_10123678 3300026142 Bacteria 2195
438 Ga0207698_10342017 3300026142 Bacteria 1410
439 Ga0207698_10578732 3300026142 Bacteria 1104
440 Ga0207698_10785461 3300026142 Bacteria 953
441 Ga0207428_10217731 3300027907 Bacteria 1432
442 Ga0268266_10000025 3300028379 Bacteria 477143
443 Ga0268265_10000025 3300028380 Bacteria 250207
444 Ga0268265_10000052 3300028380 Bacteria 174254
445 Ga0268265_10000143 3300028380 Bacteria 90469
446 Ga0268265_10000530 3300028380 Bacteria 38976
447 Ga0268265_10006096 3300028380 Bacteria 8185
448 Ga0268265_10064835 3300028380 Bacteria 2816
449 Ga0268265_10099046 3300028380 Bacteria 2349
450 Ga0268264_10000070 3300028381 Bacteria 268524
451 Ga0268264_10000608 3300028381 Bacteria 43007
452 Ga0268264_10025525 3300028381 Bacteria 4829
453 Ga0268264_10208074 3300028381 Bacteria 1794
454 Ga0268264_10797412 3300028381 Bacteria 943
455 Ga0307408_100005910 3300031548 Bacteria 8150
456 Ga0307408_100035719 3300031548 Bacteria 3489
457 Ga0307408_100123881 3300031548 Bacteria 2006
458 Ga0307408_100333102 3300031548 Bacteria 1282
459 Ga0307408_100399680 3300031548 Bacteria 1179
460 Ga0307405_10005862 3300031731 Bacteria 5983
461 Ga0307405_10045552 3300031731 Bacteria 2689
462 Ga0307405_10088678 3300031731 Bacteria 2041
463 Ga0307405_10231098 3300031731 Bacteria 1363
464 Ga0307405_10302276 3300031731 Bacteria 1214
465 Ga0307405_10624558 3300031731 Bacteria 882
466 Ga0307413_10015901 3300031824 Bacteria 3869
467 Ga0307413_10018567 3300031824 Bacteria 3653
468 Ga0307413_10044759 3300031824 Bacteria 2618
469 Ga0307413_10068419 3300031824 Bacteria 2224
470 Ga0307413_10235140 3300031824 Bacteria 1348
471 Ga0307410_10022719 3300031852 Bacteria 3883
472 Ga0307410_10110224 3300031852 Bacteria 1990
473 Ga0307410_10141406 3300031852 Bacteria 1781
474 Ga0307410_10147280 3300031852 Bacteria 1748
475 Ga0307410_10255843 3300031852 Bacteria 1363
476 Ga0307410_10727496 3300031852 Bacteria 838
477 Ga0307406_10007016 3300031901 Bacteria 6235
478 Ga0307406_10026461 3300031901 Bacteria 3485
479 Ga0307406_10164763 3300031901 Bacteria 1598
480 Ga0307407_10021209 3300031903 Bacteria 3345
481 Ga0307407_10099103 3300031903 Bacteria 1804
482 Ga0307407_10150550 3300031903 Bacteria 1511
483 Ga0307407_10297281 3300031903 Bacteria 1124
484 Ga0307407_10466523 3300031903 Bacteria 919
485 Ga0307412_10004180 3300031911 Bacteria 8048
486 Ga0307412_10017153 3300031911 Bacteria 4330
487 Ga0307412_10039927 3300031911 Bacteria 3033
488 Ga0307412_10151739 3300031911 Bacteria 1710
489 Ga0307412_10156546 3300031911 Bacteria 1687
490 Ga0307412_10260062 3300031911 Bacteria 1352
491 Ga0307412_10403495 3300031911 Bacteria 1113
492 Ga0307409_100001964 3300031995 Bacteria 10525
493 Ga0307409_100033815 3300031995 Bacteria 3725
494 Ga0307409_100046932 3300031995 Bacteria 3273
495 Ga0307409_100233680 3300031995 Bacteria 1668
496 Ga0307409_100274774 3300031995 Bacteria 1554
497 Ga0307409_100501188 3300031995 Bacteria 1182
498 Ga0307416_100002735 3300032002 Bacteria 10227
499 Ga0307416_100031232 3300032002 Bacteria 4006
500 Ga0307416_100180619 3300032002 Bacteria 1977
501 Ga0307416_100441486 3300032002 Bacteria 1351
502 Ga0307416_100947592 3300032002 Bacteria 962
503 Ga0307414_10005925 3300032004 Bacteria 6768
504 Ga0307414_10014456 3300032004 Bacteria 4733
505 Ga0307414_10036275 3300032004 Bacteria 3290
506 Ga0307414_10044582 3300032004 Bacteria 3030
507 Ga0307414_10093402 3300032004 Bacteria 2242
508 Ga0307414_10096252 3300032004 Bacteria 2214
509 Ga0307414_10146174 3300032004 Bacteria 1858
510 Ga0307414_10334283 3300032004 Bacteria 1294
511 Ga0307411_10026749 3300032005 Bacteria 3477
512 Ga0307411_10074928 3300032005 Bacteria 2308
513 Ga0307411_10078996 3300032005 Bacteria 2257
514 Ga0307411_10092391 3300032005 Bacteria 2116
515 Ga0307411_10120924 3300032005 Bacteria 1894
516 Ga0307411_10144163 3300032005 Bacteria 1760
517 Ga0307411_10162531 3300032005 Bacteria 1674
518 Ga0307411_10178897 3300032005 Bacteria 1607
519 Ga0307411_10236189 3300032005 Bacteria 1428
520 Ga0307411_10566448 3300032005 Bacteria 971
521 Ga0307415_100024549 3300032126 Bacteria 3765
522 Ga0307415_100127980 3300032126 Bacteria 1917
523 Ga0307415_100973542 3300032126 Bacteria 787
524 Ga0307510_10026690 3300033180 Bacteria 6633
525 Ga0373943_0006799 3300035170 Bacteria 5132
526 Ga0373955_0115154 3300035172 Bacteria 1558
527 Ga0373935_0016502 3300035692 Bacteria 4468
528 Ga0373927_0150149 3300035695 Unclassified 1526
529 Ga0373937_0775769 3300036401 Bacteria 906
530 Ga0373925_0052685 3300037068 Bacteria 3041
531 Ga0395899_0009253 3300037312 Bacteria 7563
532 Ga0395899_0042702 3300037312 Bacteria 3383
533 Ga0395899_0046034 3300037312 Bacteria 3249
534 Ga0395899_0068898 3300037312 Bacteria 2593
535 Ga0395899_0248469 3300037312 Bacteria 1221
536 Ga0395900_0000964 3300037418 Bacteria 37445
537 Ga0395900_0013554 3300037418 Bacteria 8326
538 Ga0395900_0027700 3300037418 Bacteria 5804
539 Ga0395900_0199697 3300037418 Bacteria 2024
540 Ga0395900_0217095 3300037418 Bacteria 1929
541 Ga0395900_0313031 3300037418 Bacteria 1553
542 Ga0395900_0517077 3300037418 Bacteria 1142
543 Ga0395898_0022701 3300037466 Bacteria 6351
544 Ga0395898_0124698 3300037466 Bacteria 2467
545 Ga0395898_0194760 3300037466 Bacteria 1936
546 Ga0395898_0252930 3300037466 Bacteria 1680
547 Ga0395898_0292276 3300037466 Bacteria 1554
548 Ga0395898_0982602 3300037466 Bacteria 780
549 Ga0395905_0058159 3300037471 Bacteria 3616
550 Ga0395905_0067234 3300037471 Bacteria 3357
551 Ga0395905_0098859 3300037471 Bacteria 2740
552 Ga0395905_0111624 3300037471 Bacteria 2567
553 Ga0395905_0117965 3300037471 Bacteria 2494
554 Ga0395905_0136652 3300037471 Bacteria 2306
555 Ga0395905_0152137 3300037471 Bacteria 2176
556 Ga0395905_0198861 3300037471 Bacteria 1879
557 Ga0395905_0547021 3300037471 Bacteria 1059
558 Ga0395905_0585715 3300037471 Unclassified 1017
559 Ga0436364_0443678 3300037853 Bacteria 1304
560 Ga0395901_0001061 3300038443 Bacteria 29546
561 Ga0395901_0015808 3300038443 Bacteria 7690
562 Ga0395901_0034086 3300038443 Bacteria 5257
563 Ga0395901_0216806 3300038443 Bacteria 2001
564 Ga0395901_0273210 3300038443 Bacteria 1757
565 Ga0395901_0385091 3300038443 Bacteria 1443
566 Ga0436363_0896344 3300039450 Bacteria 3063
567 Ga0436363_1706034 3300039450 Bacteria 985
568 Ga0451577_0128518 3300042876 Bacteria 2272
569 Ga0451577_0207959 3300042876 Unclassified 1767
570 Ga0466961_0078360 3300044693 Bacteria 2093
571 Ga0466963_0012713 3300044694 Bacteria 5156
572 Ga0466963_0042034 3300044694 Bacteria 3000
573 Ga0466963_0084850 3300044694 Bacteria 2149
574 Ga0466959_0254148 3300045049 Bacteria 1212
575 Ga0466959_0295538 3300045049 Bacteria 1110
576 Ga0451576_0022614 3300045051 Bacteria 6815
577 Ga0451576_0184087 3300045051 Bacteria 2181
578 Ga0466958_0326382 3300045836 Bacteria 987
579 Ga0466967_0027105 3300045976 Bacteria 4761
580 Ga0466967_0101872 3300045976 Bacteria 2625
581 Ga0466967_0147945 3300045976 Bacteria 2192
582 Ga0495583_0099442 3300046506 Bacteria 1243
583 Ga0495606_0001464 3300046507 Bacteria 31526
584 Ga0495637_0056169 3300046520 Bacteria 1630
585 Ga0495643_0048100 3300046522 Bacteria 2307
586 Ga0495643_0072685 3300046522 Bacteria 1803
587 Ga0495648_0075240 3300046524 Bacteria 1943
588 Ga0495648_0110136 3300046524 Bacteria 1500
589 Ga0495663_0026908 3300046525 Bacteria 1685
590 Ga0495663_0027919 3300046525 Bacteria 1659
591 Ga0495654_0005164 3300046530 Bacteria 7616
592 Ga0495598_0007650 3300046537 Bacteria 2486
593 Ga0495621_0000770 3300046539 Bacteria 8118
594 Ga0495621_0123445 3300046539 Bacteria 1002
595 Ga0495597_0061300 3300046542 Bacteria 1639
596 Ga0495633_0019904 3300046558 Bacteria 3386
597 Ga0495668_0007229 3300046616 Bacteria 7125
598 Ga0495668_0013009 3300046616 Bacteria 4924
599 Ga0495668_0027327 3300046616 Bacteria 3233
600 Ga0495625_0042424 3300046660 Bacteria 3306
601 Ga0495625_0098269 3300046660 Bacteria 2014
602 Ga0495659_0091401 3300046664 Bacteria 1169
603 Ga0495659_0285464 3300046664 Bacteria 694
604 Ga0495669_0032654 3300046684 Bacteria 2289
605 Ga0495669_0034603 3300046684 Bacteria 2227
606 Ga0495670_0000004 3300046691 Bacteria 310086
607 Ga0495670_0002921 3300046691 Bacteria 8421
608 Ga0495670_0024619 3300046691 Bacteria 2976
609 Ga0495677_0034076 3300047445 Bacteria 1857
610 Ga0495677_0133135 3300047445 Bacteria 952
611 Ga0495677_0171494 3300047445 Bacteria 839
612 Ga0495686_0001258 3300047472 Bacteria 28752
613 Ga0495686_0001855 3300047472 Bacteria 21198
614 Ga0495686_0005308 3300047472 Bacteria 10212
615 Ga0496100_0429979 3300048903 Unclassified 1009
616 Ga0496101_0003944 3300048904 Bacteria 9275
617 Ga0496101_0165854 3300048904 Bacteria 1696
618 Ga0496101_0389750 3300048904 Bacteria 1096
619 Ga0496102_0000010 3300048905 Bacteria 324617
620 Ga0496102_0042162 3300048905 Bacteria 4135
621 Ga0496102_0077914 3300048905 Bacteria 3051
622 Ga0496103_0000029 3300048906 Bacteria 213326
623 Ga0496103_0001613 3300048906 Bacteria 14821
624 Ga0496103_0382378 3300048906 Unclassified 904
625 Ga0496104_0050732 3300048907 Bacteria 3915
626 Ga0496104_0448340 3300048907 Bacteria 1202
627 Ga0496105_0048846 3300048908 Bacteria 3493
628 Ga0496105_0054789 3300048908 Bacteria 3292
629 Ga0496105_0184534 3300048908 Bacteria 1707
630 Ga0496106_0067686 3300048909 Bacteria 2723
631 Ga0496107_0005406 3300048910 Bacteria 8741
632 Ga0496107_0027803 3300048910 Bacteria 4018
633 Ga0496108_0024681 3300048911 Bacteria 4951
634 Ga0496108_0223420 3300048911 Bacteria 1636
635 Ga0496109_0011644 3300048912 Bacteria 7563
636 Ga0496109_0353468 3300048912 Bacteria 1388
637 Ga0496109_0386608 3300048912 Bacteria 1322
638 Ga0496109_0960554 3300048912 Bacteria 792
639 Ga0496110_0015422 3300048913 Bacteria 6358
640 Ga0496110_0029095 3300048913 Bacteria 4750
641 Ga0496110_0155580 3300048913 Bacteria 2071
642 Ga0496110_0201160 3300048913 Bacteria 1810
643 Ga0496111_0013508 3300048914 Bacteria 5560
644 Ga0496111_0046130 3300048914 Bacteria 3137
645 Ga0496112_0022111 3300048915 Bacteria 6057
646 Ga0496112_0036134 3300048915 Bacteria 4817
647 Ga0496113_0010700 3300048916 Bacteria 6077
648 Ga0496113_0029704 3300048916 Bacteria 3951
649 Ga0496114_0260145 3300048917 Bacteria 1528
650 Ga0496116_0003035 3300048919 Bacteria 16987
651 Ga0496117_0000037 3300048920 Bacteria 324960
652 Ga0496117_0005000 3300048920 Bacteria 14220
653 Ga0496118_0000034 3300048921 Bacteria 322764
654 Ga0496118_0000216 3300048921 Bacteria 100502
655 Ga0496119_0030248 3300048922 Bacteria 3656
656 Ga0496120_0132918 3300048923 Bacteria 1272
657 Ga0496121_0018311 3300048924 Bacteria 7072
658 Ga0496122_0305577 3300048925 Bacteria 855
659 Ga0496123_0025909 3300048926 Bacteria 4407
660 Ga0496124_0000033 3300048927 Bacteria 330586
661 Ga0496124_0001292 3300048927 Bacteria 38002
662 Ga0496124_0002507 3300048927 Bacteria 23886
663 Ga0496124_0009995 3300048927 Bacteria 9688
664 Ga0496126_0255449 3300048929 Bacteria 1459
665 Ga0501032_0045189 3300049569 Bacteria 2980
666 Ga0501036_0265314 3300049572 Bacteria 1438
667 Ga0501043_0562122 3300049579 Bacteria 846
668 Ga0501046_0261935 3300049580 Bacteria 1270
669 Ga0501048_0112062 3300049582 Bacteria 1926
670 Ga0501067_0071112 3300049583 Bacteria 1927
671 Ga0501074_0195265 3300049590 Bacteria 1443
672 Ga0501076_0102453 3300049592 Bacteria 2308
673 Ga0501223_017236 3300049663 Bacteria 1425
674 Ga0501080_0470016 3300049742 Bacteria 1126
675 Ga0501270_006060 3300049767 Bacteria 1434
676 Ga0501035_0294604 3300049822 Bacteria 1369
677 Ga0501044_0044786 3300049823 Bacteria 4589
678 nmdc:mga08y16_302064_c1 3300050511 Bacteria 1650
679 Ga0495655_0000236 3300053083 Bacteria 10313
680 Ga0500643_000478 3300053087 Bacteria 29274
681 Ga0500643_018106 3300053087 Bacteria 2345
682 Ga0500643_024690 3300053087 Bacteria 1904
683 Ga0500651_0006612 3300053093 Bacteria 6701
684 Ga0500562_043538 3300053108 Bacteria 1195
685 Ga0500592_015980 3300053116 Bacteria 1205
686 Ga0500642_0000714 3300053130 Bacteria 9811
687 Ga0500655_000061 3300053133 Bacteria 29562
688 Ga0500559_0010319 3300053136 Bacteria 4015
689 Ga0500559_0068844 3300053136 Bacteria 1591
690 Ga0500559_0149949 3300053136 Bacteria 1094
691 Ga0500573_0000061 3300053140 Bacteria 67535
692 Ga0500590_002284 3300053148 Bacteria 8422
693 Ga0500616_0075480 3300053153 Bacteria 1706
694 Ga0500622_0040895 3300053156 Bacteria 2413
695 Ga0500627_0004783 3300053158 Bacteria 4404
696 Ga0500639_032266 3300053163 Bacteria 2770
697 Ga0500636_0240556 3300053177 Bacteria 930
698 Ga0500570_001475 3300053724 Bacteria 10892
699 Ga0501082_0526142 3300060353 Unclassified 1034
700 Ga0466962_0124079 3300061719 Bacteria 1247
701 Ga0530510_0063971 3300061734 Bacteria 2664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10003139 Ga0207657_1000313912 214
2 3300005457 Ga0070662_100237280 Ga0070662_1002372802 215
3 3300005539 Ga0068853_100379080 Ga0068853_1003790802 215
4 3300013104 Ga0157370_10353480 Ga0157370_103534802 215
5 3300025949 Ga0207667_10141917 Ga0207667_101419173 215
6 3300045049 Ga0466959_0254148 Ga0466959_0254148_343_1044 215
7 3300005355 Ga0070671_100062948 Ga0070671_1000629483 217
8 3300005535 Ga0070684_100333746 Ga0070684_1003337462 217
9 3300005564 Ga0070664_100447642 Ga0070664_1004476421 217
10 3300025932 Ga0207690_10529168 Ga0207690_105291682 217
11 3300025944 Ga0207661_10008596 Ga0207661_100085965 217
12 3300025945 Ga0207679_10073625 Ga0207679_100736252 217
13 3300026116 Ga0207674_10012221 Ga0207674_100122217 217
14 3300031995 Ga0307409_100274774 Ga0307409_1002747741 217
15 3300032126 Ga0307415_100127980 Ga0307415_1001279802 217
16 3300046664 Ga0495659_0285464 Ga0495659_0285464_25_684 219
17 3300046524 Ga0495648_0110136 Ga0495648_0110136_807_1472 220
18 3300049579 Ga0501043_0562122 Ga0501043_0562122_31_693 220
19 3300025315 Ga0207697_10025200 Ga0207697_100252002 222
20 3300005293 Ga0065715_10422059 Ga0065715_104220591 224
21 iso_pu_bacteria 2885427238 2885428873 229
22 3300025937 Ga0207669_10094646 Ga0207669_100946463 230
23 iso_pu_bacteria 2830075706 2830076759 230
24 iso_pu_bacteria 2990265787 2990267758 230
25 iso_pu_bacteria 2993693658 2993695001 230
26 iso_pu_bacteria 2599185359 2600226396 231
27 iso_pu_bacteria 2818991466 2819712622 231
28 iso_pu_bacteria 2879163058 2879164575 231
29 iso_pu_bacteria 2928027323 2928027759 231
30 iso_pu_bacteria 2928526807 2928527217 231
31 iso_pu_bacteria 2928968154 2928969297 231
32 iso_pu_bacteria 2984564862 2984567686 231
33 iso_pu_bacteria 8057101203 8057103705 231
34 3300005843 Ga0068860_100236451 Ga0068860_1002364512 232
35 3300006931 Ga0097620_100038608 Ga0097620_1000386085 232
36 3300009101 Ga0105247_10128225 Ga0105247_101282252 232
37 3300009177 Ga0105248_10043610 Ga0105248_100436102 232
38 3300025900 Ga0207710_10029782 Ga0207710_100297822 232
39 3300028381 Ga0268264_10797412 Ga0268264_107974122 232
40 3300001977 JGI24746J21847_1000985 JGI24746J21847_10009854 233
41 3300001989 JGI24739J22299_10007504 JGI24739J22299_100075045 233
42 3300001989 JGI24739J22299_10037287 JGI24739J22299_100372871 233
43 3300001990 JGI24737J22298_10000929 JGI24737J22298_100009292 233
44 3300002076 JGI24749J21850_1003838 JGI24749J21850_10038382 233
45 3300002155 JGI24033J26618_1007065 JGI24033J26618_10070652 233
46 3300002239 JGI24034J26672_10010937 JGI24034J26672_100109372 233
47 3300005293 Ga0065715_10000860 Ga0065715_1000086011 233
48 3300005327 Ga0070658_10041850 Ga0070658_100418504 233
49 3300005328 Ga0070676_10024298 Ga0070676_100242983 233
50 3300005330 Ga0070690_100003881 Ga0070690_1000038812 233
51 3300005331 Ga0070670_100001686 Ga0070670_10000168613 233
52 3300005331 Ga0070670_100021229 Ga0070670_1000212296 233
53 3300005333 Ga0070677_10002154 Ga0070677_100021542 233
54 3300005338 Ga0068868_100023218 Ga0068868_1000232182 233
55 3300005339 Ga0070660_100017906 Ga0070660_1000179065 233
56 3300005339 Ga0070660_100027908 Ga0070660_1000279084 233
57 3300005339 Ga0070660_100038152 Ga0070660_1000381522 233
58 3300005339 Ga0070660_100067331 Ga0070660_1000673314 233
59 3300005344 Ga0070661_100015664 Ga0070661_1000156644 233
60 3300005347 Ga0070668_100001607 Ga0070668_10000160711 233
61 3300005353 Ga0070669_100001322 Ga0070669_1000013228 233
62 3300005353 Ga0070669_100327200 Ga0070669_1003272002 233
63 3300005354 Ga0070675_100001353 Ga0070675_10000135312 233
64 3300005354 Ga0070675_100959047 Ga0070675_1009590471 233
65 3300005355 Ga0070671_100011279 Ga0070671_1000112795 233
66 3300005355 Ga0070671_100012896 Ga0070671_1000128962 233
67 3300005355 Ga0070671_100015271 Ga0070671_1000152712 233
68 3300005356 Ga0070674_100027724 Ga0070674_1000277244 233
69 3300005356 Ga0070674_100172317 Ga0070674_1001723172 233
70 3300005364 Ga0070673_100001125 Ga0070673_1000011256 233
71 3300005364 Ga0070673_100006322 Ga0070673_1000063225 233
72 3300005366 Ga0070659_100049850 Ga0070659_1000498502 233
73 3300005366 Ga0070659_100125598 Ga0070659_1001255982 233
74 3300005366 Ga0070659_100941139 Ga0070659_1009411391 233
75 3300005367 Ga0070667_100005432 Ga0070667_1000054324 233
76 3300005367 Ga0070667_100011171 Ga0070667_1000111713 233
77 3300005435 Ga0070714_100156476 Ga0070714_1001564762 233
78 3300005436 Ga0070713_100129476 Ga0070713_1001294762 233
79 3300005436 Ga0070713_100210091 Ga0070713_1002100912 233
80 3300005455 Ga0070663_100010813 Ga0070663_1000108132 233
81 3300005455 Ga0070663_100122143 Ga0070663_1001221432 233
82 3300005456 Ga0070678_100028839 Ga0070678_1000288392 233
83 3300005456 Ga0070678_100046580 Ga0070678_1000465802 233
84 3300005457 Ga0070662_100000741 Ga0070662_10000074111 233
85 3300005457 Ga0070662_100002121 Ga0070662_1000021214 233
86 3300005457 Ga0070662_100139437 Ga0070662_1001394372 233
87 3300005459 Ga0068867_100050084 Ga0068867_1000500842 233
88 3300005539 Ga0068853_100072666 Ga0068853_1000726661 233
89 3300005539 Ga0068853_100568877 Ga0068853_1005688772 233
90 3300005543 Ga0070672_100008666 Ga0070672_1000086662 233
91 3300005544 Ga0070686_100016476 Ga0070686_1000164764 233
92 3300005548 Ga0070665_100097517 Ga0070665_1000975174 233
93 3300005564 Ga0070664_100055951 Ga0070664_1000559513 233
94 3300005577 Ga0068857_100083933 Ga0068857_1000839332 233
95 3300005578 Ga0068854_100037269 Ga0068854_1000372694 233
96 3300005614 Ga0068856_100131804 Ga0068856_1001318042 233
97 3300005614 Ga0068856_100167170 Ga0068856_1001671703 233
98 3300005615 Ga0070702_100243359 Ga0070702_1002433592 233
99 3300005616 Ga0068852_100038258 Ga0068852_1000382585 233
100 3300005617 Ga0068859_100004899 Ga0068859_1000048998 233
101 3300005617 Ga0068859_100047437 Ga0068859_1000474373 233
102 3300005618 Ga0068864_100038921 Ga0068864_1000389212 233
103 3300005618 Ga0068864_100864567 Ga0068864_1008645671 233
104 3300005718 Ga0068866_10027614 Ga0068866_100276142 233
105 3300005718 Ga0068866_10292850 Ga0068866_102928502 233
106 3300005834 Ga0068851_10012912 Ga0068851_100129123 233
107 3300005841 Ga0068863_100029535 Ga0068863_1000295356 233
108 3300005842 Ga0068858_100094471 Ga0068858_1000944712 233
109 3300005843 Ga0068860_100091147 Ga0068860_1000911472 233
110 3300005844 Ga0068862_100004294 Ga0068862_1000042948 233
111 3300005844 Ga0068862_100030889 Ga0068862_1000308894 233
112 3300005844 Ga0068862_100126154 Ga0068862_1001261543 233
113 3300006028 Ga0070717_10498722 Ga0070717_104987221 233
114 3300006237 Ga0097621_100008240 Ga0097621_1000082407 233
115 3300006881 Ga0068865_100009906 Ga0068865_1000099066 233
116 3300006881 Ga0068865_100076748 Ga0068865_1000767482 233
117 3300006931 Ga0097620_100004899 Ga0097620_1000048998 233
118 3300006931 Ga0097620_100047436 Ga0097620_1000474363 233
119 3300009094 Ga0111539_10357984 Ga0111539_103579842 233
120 3300009098 Ga0105245_10021056 Ga0105245_100210564 233
121 3300009148 Ga0105243_10053958 Ga0105243_100539583 233
122 3300009148 Ga0105243_10085310 Ga0105243_100853102 233
123 3300009176 Ga0105242_10122298 Ga0105242_101222982 233
124 3300009177 Ga0105248_10027779 Ga0105248_100277796 233
125 3300009177 Ga0105248_10320155 Ga0105248_103201552 233
126 3300009177 Ga0105248_10707411 Ga0105248_107074111 233
127 3300009551 Ga0105238_10053669 Ga0105238_100536694 233
128 3300009553 Ga0105249_10007780 Ga0105249_100077808 233
129 3300010375 Ga0105239_10322877 Ga0105239_103228772 233
130 3300013100 Ga0157373_10083231 Ga0157373_100832312 233
131 3300013105 Ga0157369_10053489 Ga0157369_100534894 233
132 3300013105 Ga0157369_10631466 Ga0157369_106314662 233
133 3300013297 Ga0157378_10545740 Ga0157378_105457402 233
134 3300013306 Ga0163162_10047411 Ga0163162_100474113 233
135 3300013306 Ga0163162_10208314 Ga0163162_102083142 233
136 3300013308 Ga0157375_10039075 Ga0157375_100390756 233
137 3300013308 Ga0157375_10221373 Ga0157375_102213733 233
138 3300014326 Ga0157380_10001012 Ga0157380_1000101213 233
139 3300014326 Ga0157380_10004675 Ga0157380_100046758 233
140 3300014745 Ga0157377_10041819 Ga0157377_100418193 233
141 3300014968 Ga0157379_10048531 Ga0157379_100485313 233
142 3300014969 Ga0157376_10008531 Ga0157376_100085316 233
143 3300017792 Ga0163161_10031070 Ga0163161_100310702 233
144 3300017792 Ga0163161_10215557 Ga0163161_102155572 233
145 3300025315 Ga0207697_10000595 Ga0207697_1000059513 233
146 3300025321 Ga0207656_10029168 Ga0207656_100291682 233
147 3300025893 Ga0207682_10001140 Ga0207682_100011406 233
148 3300025901 Ga0207688_10210920 Ga0207688_102109201 233
149 3300025904 Ga0207647_10065007 Ga0207647_100650072 233
150 3300025907 Ga0207645_10027573 Ga0207645_100275732 233
151 3300025909 Ga0207705_10002277 Ga0207705_1000227715 233
152 3300025909 Ga0207705_10017957 Ga0207705_100179572 233
153 3300025909 Ga0207705_10033698 Ga0207705_100336983 233
154 3300025909 Ga0207705_10127862 Ga0207705_101278622 233
155 3300025919 Ga0207657_10038683 Ga0207657_100386834 233
156 3300025919 Ga0207657_10056177 Ga0207657_100561772 233
157 3300025919 Ga0207657_10142302 Ga0207657_101423022 233
158 3300025920 Ga0207649_10052336 Ga0207649_100523362 233
159 3300025920 Ga0207649_10447580 Ga0207649_104475801 233
160 3300025923 Ga0207681_10001281 Ga0207681_1000128111 233
161 3300025923 Ga0207681_10305920 Ga0207681_103059202 233
162 3300025925 Ga0207650_10000897 Ga0207650_1000089712 233
163 3300025925 Ga0207650_10082005 Ga0207650_100820053 233
164 3300025926 Ga0207659_10004033 Ga0207659_100040336 233
165 3300025928 Ga0207700_10206411 Ga0207700_102064112 233
166 3300025929 Ga0207664_10328413 Ga0207664_103284132 233
167 3300025931 Ga0207644_10001654 Ga0207644_100016544 233
168 3300025931 Ga0207644_10002074 Ga0207644_100020749 233
169 3300025931 Ga0207644_10042019 Ga0207644_100420193 233
170 3300025931 Ga0207644_10215617 Ga0207644_102156172 233
171 3300025932 Ga0207690_10067986 Ga0207690_100679861 233
172 3300025932 Ga0207690_10135103 Ga0207690_101351032 233
173 3300025933 Ga0207706_10001065 Ga0207706_100010659 233
174 3300025933 Ga0207706_10002092 Ga0207706_100020926 233
175 3300025933 Ga0207706_10006146 Ga0207706_100061466 233
176 3300025934 Ga0207686_10049887 Ga0207686_100498873 233
177 3300025937 Ga0207669_10259693 Ga0207669_102596932 233
178 3300025939 Ga0207665_10012224 Ga0207665_100122245 233
179 3300025940 Ga0207691_10002271 Ga0207691_100022717 233
180 3300025940 Ga0207691_10004006 Ga0207691_1000400614 233
181 3300025941 Ga0207711_10004526 Ga0207711_100045264 233
182 3300025941 Ga0207711_10046418 Ga0207711_100464182 233
183 3300025945 Ga0207679_10176992 Ga0207679_101769921 233
184 3300025945 Ga0207679_10515156 Ga0207679_105151562 233
185 3300025960 Ga0207651_10000766 Ga0207651_100007664 233
186 3300025960 Ga0207651_10001642 Ga0207651_1000164210 233
187 3300025960 Ga0207651_10006978 Ga0207651_100069782 233
188 3300025961 Ga0207712_10008869 Ga0207712_100088695 233
189 3300025972 Ga0207668_10000651 Ga0207668_1000065115 233
190 3300025972 Ga0207668_10034946 Ga0207668_100349464 233
191 3300025972 Ga0207668_10672098 Ga0207668_106720981 233
192 3300025981 Ga0207640_10030017 Ga0207640_100300171 233
193 3300025986 Ga0207658_10018853 Ga0207658_100188535 233
194 3300025986 Ga0207658_10067794 Ga0207658_100677943 233
195 3300026023 Ga0207677_10021253 Ga0207677_100212533 233
196 3300026023 Ga0207677_10234867 Ga0207677_102348671 233
197 3300026035 Ga0207703_10013306 Ga0207703_100133063 233
198 3300026035 Ga0207703_10015512 Ga0207703_100155123 233
199 3300026041 Ga0207639_10109442 Ga0207639_101094422 233
200 3300026067 Ga0207678_10226565 Ga0207678_102265652 233
201 3300026075 Ga0207708_10122700 Ga0207708_101227002 233
202 3300026078 Ga0207702_10120149 Ga0207702_101201493 233
203 3300026078 Ga0207702_10244348 Ga0207702_102443482 233
204 3300026078 Ga0207702_10260779 Ga0207702_102607792 233
205 3300026078 Ga0207702_10291475 Ga0207702_102914751 233
206 3300026089 Ga0207648_10004534 Ga0207648_100045347 233
207 3300026089 Ga0207648_10043202 Ga0207648_100432024 233
208 3300026095 Ga0207676_10008378 Ga0207676_100083785 233
209 3300026095 Ga0207676_10196790 Ga0207676_101967902 233
210 3300026095 Ga0207676_10251517 Ga0207676_102515172 233
211 3300026118 Ga0207675_100040755 Ga0207675_1000407553 233
212 3300026121 Ga0207683_10001298 Ga0207683_1000129814 233
213 3300026121 Ga0207683_10002767 Ga0207683_100027675 233
214 3300026142 Ga0207698_10030281 Ga0207698_100302813 233
215 3300026142 Ga0207698_10578732 Ga0207698_105787321 233
216 3300027907 Ga0207428_10217731 Ga0207428_102177312 233
217 3300028380 Ga0268265_10006096 Ga0268265_100060967 233
218 3300028380 Ga0268265_10064835 Ga0268265_100648353 233
219 3300028380 Ga0268265_10099046 Ga0268265_100990461 233
220 3300028381 Ga0268264_10025525 Ga0268264_100255252 233
221 3300028381 Ga0268264_10208074 Ga0268264_102080742 233
222 3300031548 Ga0307408_100005910 Ga0307408_1000059103 233
223 3300031548 Ga0307408_100123881 Ga0307408_1001238812 233
224 3300031548 Ga0307408_100333102 Ga0307408_1003331021 233
225 3300031548 Ga0307408_100399680 Ga0307408_1003996802 233
226 3300031731 Ga0307405_10005862 Ga0307405_100058622 233
227 3300031731 Ga0307405_10045552 Ga0307405_100455522 233
228 3300031731 Ga0307405_10088678 Ga0307405_100886782 233
229 3300031731 Ga0307405_10231098 Ga0307405_102310982 233
230 3300031731 Ga0307405_10302276 Ga0307405_103022762 233
231 3300031731 Ga0307405_10624558 Ga0307405_106245581 233
232 3300031824 Ga0307413_10015901 Ga0307413_100159014 233
233 3300031824 Ga0307413_10018567 Ga0307413_100185673 233
234 3300031824 Ga0307413_10044759 Ga0307413_100447593 233
235 3300031824 Ga0307413_10068419 Ga0307413_100684191 233
236 3300031824 Ga0307413_10235140 Ga0307413_102351402 233
237 3300031852 Ga0307410_10022719 Ga0307410_100227192 233
238 3300031852 Ga0307410_10110224 Ga0307410_101102242 233
239 3300031852 Ga0307410_10141406 Ga0307410_101414062 233
240 3300031852 Ga0307410_10147280 Ga0307410_101472801 233
241 3300031852 Ga0307410_10255843 Ga0307410_102558432 233
242 3300031852 Ga0307410_10727496 Ga0307410_107274961 233
243 3300031901 Ga0307406_10007016 Ga0307406_100070165 233
244 3300031901 Ga0307406_10026461 Ga0307406_100264612 233
245 3300031901 Ga0307406_10164763 Ga0307406_101647632 233
246 3300031903 Ga0307407_10021209 Ga0307407_100212094 233
247 3300031903 Ga0307407_10099103 Ga0307407_100991032 233
248 3300031903 Ga0307407_10150550 Ga0307407_101505502 233
249 3300031903 Ga0307407_10297281 Ga0307407_102972811 233
250 3300031903 Ga0307407_10466523 Ga0307407_104665231 233
251 3300031911 Ga0307412_10004180 Ga0307412_100041802 233
252 3300031911 Ga0307412_10156546 Ga0307412_101565461 233
253 3300031911 Ga0307412_10260062 Ga0307412_102600621 233
254 3300031911 Ga0307412_10403495 Ga0307412_104034952 233
255 3300031995 Ga0307409_100001964 Ga0307409_1000019648 233
256 3300031995 Ga0307409_100033815 Ga0307409_1000338152 233
257 3300031995 Ga0307409_100046932 Ga0307409_1000469322 233
258 3300031995 Ga0307409_100233680 Ga0307409_1002336801 233
259 3300031995 Ga0307409_100501188 Ga0307409_1005011882 233
260 3300032002 Ga0307416_100002735 Ga0307416_1000027352 233
261 3300032002 Ga0307416_100031232 Ga0307416_1000312323 233
262 3300032002 Ga0307416_100441486 Ga0307416_1004414862 233
263 3300032002 Ga0307416_100947592 Ga0307416_1009475922 233
264 3300032004 Ga0307414_10005925 Ga0307414_100059253 233
265 3300032004 Ga0307414_10014456 Ga0307414_100144562 233
266 3300032004 Ga0307414_10036275 Ga0307414_100362752 233
267 3300032004 Ga0307414_10044582 Ga0307414_100445823 233
268 3300032004 Ga0307414_10093402 Ga0307414_100934022 233
269 3300032004 Ga0307414_10096252 Ga0307414_100962522 233
270 3300032004 Ga0307414_10146174 Ga0307414_101461742 233
271 3300032004 Ga0307414_10334283 Ga0307414_103342831 233
272 3300032005 Ga0307411_10026749 Ga0307411_100267493 233
273 3300032005 Ga0307411_10074928 Ga0307411_100749282 233
274 3300032005 Ga0307411_10078996 Ga0307411_100789964 233
275 3300032005 Ga0307411_10092391 Ga0307411_100923912 233
276 3300032005 Ga0307411_10120924 Ga0307411_101209243 233
277 3300032005 Ga0307411_10144163 Ga0307411_101441633 233
278 3300032005 Ga0307411_10162531 Ga0307411_101625312 233
279 3300032005 Ga0307411_10178897 Ga0307411_101788972 233
280 3300032005 Ga0307411_10236189 Ga0307411_102361891 233
281 3300032005 Ga0307411_10566448 Ga0307411_105664482 233
282 3300032126 Ga0307415_100024549 Ga0307415_1000245493 233
283 3300032126 Ga0307415_100973542 Ga0307415_1009735421 233
284 3300035170 Ga0373943_0006799 Ga0373943_0006799_2445_3146 233
285 3300035172 Ga0373955_0115154 Ga0373955_0115154_281_982 233
286 3300035692 Ga0373935_0016502 Ga0373935_0016502_3716_4417 233
287 3300035695 Ga0373927_0150149 Ga0373927_0150149_792_1493 233
288 3300036401 Ga0373937_0775769 Ga0373937_0775769_46_747 233
289 3300037068 Ga0373925_0052685 Ga0373925_0052685_2229_2930 233
290 3300037312 Ga0395899_0042702 Ga0395899_0042702_741_1442 233
291 3300037312 Ga0395899_0068898 Ga0395899_0068898_452_1153 233
292 3300037312 Ga0395899_0248469 Ga0395899_0248469_324_1025 233
293 3300037418 Ga0395900_0199697 Ga0395900_0199697_703_1404 233
294 3300037418 Ga0395900_0217095 Ga0395900_0217095_1070_1771 233
295 3300037418 Ga0395900_0313031 Ga0395900_0313031_91_792 233
296 3300037418 Ga0395900_0517077 Ga0395900_0517077_161_862 233
297 3300037466 Ga0395898_0124698 Ga0395898_0124698_834_1535 233
298 3300037466 Ga0395898_0194760 Ga0395898_0194760_180_881 233
299 3300037466 Ga0395898_0252930 Ga0395898_0252930_659_1360 233
300 3300037466 Ga0395898_0982602 Ga0395898_0982602_25_726 233
301 3300037471 Ga0395905_0058159 Ga0395905_0058159_2776_3477 233
302 3300037471 Ga0395905_0067234 Ga0395905_0067234_2196_2897 233
303 3300037471 Ga0395905_0111624 Ga0395905_0111624_996_1721 233
304 3300037471 Ga0395905_0117965 Ga0395905_0117965_806_1507 233
305 3300037471 Ga0395905_0152137 Ga0395905_0152137_543_1244 233
306 3300037471 Ga0395905_0198861 Ga0395905_0198861_532_1233 233
307 3300037471 Ga0395905_0547021 Ga0395905_0547021_25_726 233
308 3300037471 Ga0395905_0585715 Ga0395905_0585715_243_944 233
309 3300038443 Ga0395901_0216806 Ga0395901_0216806_967_1668 233
310 3300038443 Ga0395901_0273210 Ga0395901_0273210_973_1674 233
311 3300038443 Ga0395901_0385091 Ga0395901_0385091_401_1102 233
312 3300042876 Ga0451577_0128518 Ga0451577_0128518_987_1688 233
313 3300042876 Ga0451577_0207959 Ga0451577_0207959_223_927 233
314 3300044693 Ga0466961_0078360 Ga0466961_0078360_754_1455 233
315 3300044694 Ga0466963_0084850 Ga0466963_0084850_416_1117 233
316 3300045049 Ga0466959_0295538 Ga0466959_0295538_242_943 233
317 3300045051 Ga0451576_0022614 Ga0451576_0022614_4138_4845 233
318 3300045051 Ga0451576_0184087 Ga0451576_0184087_734_1435 233
319 3300045836 Ga0466958_0326382 Ga0466958_0326382_76_777 233
320 3300045976 Ga0466967_0101872 Ga0466967_0101872_1153_1854 233
321 3300046507 Ga0495606_0001464 Ga0495606_0001464_13737_14438 233
322 3300046525 Ga0495663_0026908 Ga0495663_0026908_18_719 233
323 3300046537 Ga0495598_0007650 Ga0495598_0007650_1454_2155 233
324 3300046539 Ga0495621_0000770 Ga0495621_0000770_2873_3574 233
325 3300046539 Ga0495621_0123445 Ga0495621_0123445_289_990 233
326 3300046558 Ga0495633_0019904 Ga0495633_0019904_2133_2834 233
327 3300046664 Ga0495659_0091401 Ga0495659_0091401_425_1126 233
328 3300046684 Ga0495669_0032654 Ga0495669_0032654_310_1011 233
329 3300046684 Ga0495669_0034603 Ga0495669_0034603_470_1171 233
330 3300046691 Ga0495670_0002921 Ga0495670_0002921_2076_2777 233
331 3300046691 Ga0495670_0024619 Ga0495670_0024619_1235_1936 233
332 3300047445 Ga0495677_0133135 Ga0495677_0133135_113_814 233
333 3300047445 Ga0495677_0171494 Ga0495677_0171494_121_822 233
334 3300047472 Ga0495686_0001258 Ga0495686_0001258_17659_18363 233
335 3300047472 Ga0495686_0001855 Ga0495686_0001855_8809_9510 233
336 3300047472 Ga0495686_0005308 Ga0495686_0005308_4003_4707 233
337 3300048903 Ga0496100_0429979 Ga0496100_0429979_59_760 233
338 3300048904 Ga0496101_0003944 Ga0496101_0003944_3172_3873 233
339 3300048904 Ga0496101_0165854 Ga0496101_0165854_747_1448 233
340 3300048905 Ga0496102_0077914 Ga0496102_0077914_1957_2658 233
341 3300048906 Ga0496103_0382378 Ga0496103_0382378_149_850 233
342 3300048907 Ga0496104_0448340 Ga0496104_0448340_149_850 233
343 3300048908 Ga0496105_0048846 Ga0496105_0048846_228_929 233
344 3300048910 Ga0496107_0005406 Ga0496107_0005406_4631_5332 233
345 3300048911 Ga0496108_0024681 Ga0496108_0024681_2755_3456 233
346 3300048911 Ga0496108_0223420 Ga0496108_0223420_611_1312 233
347 3300048912 Ga0496109_0353468 Ga0496109_0353468_615_1316 233
348 3300048912 Ga0496109_0386608 Ga0496109_0386608_135_836 233
349 3300048913 Ga0496110_0015422 Ga0496110_0015422_2769_3470 233
350 3300048913 Ga0496110_0029095 Ga0496110_0029095_3207_3908 233
351 3300048914 Ga0496111_0013508 Ga0496111_0013508_3194_3895 233
352 3300048914 Ga0496111_0046130 Ga0496111_0046130_278_979 233
353 3300048915 Ga0496112_0022111 Ga0496112_0022111_2763_3464 233
354 3300048915 Ga0496112_0036134 Ga0496112_0036134_3480_4181 233
355 3300048916 Ga0496113_0010700 Ga0496113_0010700_2379_3080 233
356 3300048917 Ga0496114_0260145 Ga0496114_0260145_732_1433 233
357 3300049663 Ga0501223_017236 Ga0501223_017236_252_953 233
358 3300049767 Ga0501270_006060 Ga0501270_006060_419_1120 233
359 3300050511 nmdc:mga08y16_302064_c1 nmdc:mga08y16_302064_c1_488_1189 233
360 3300053136 Ga0500559_0010319 Ga0500559_0010319_619_1323 233
361 3300053153 Ga0500616_0075480 Ga0500616_0075480_864_1565 233
362 3300061719 Ga0466962_0124079 Ga0466962_0124079_259_960 233
363 3300001904 JGI24736J21556_1001406 JGI24736J21556_10014066 234
364 3300001915 JGI24741J21665_1003224 JGI24741J21665_10032242 234
365 3300001976 JGI24752J21851_1000080 JGI24752J21851_10000808 234
366 3300001976 JGI24752J21851_1000160 JGI24752J21851_100016010 234
367 3300001979 JGI24740J21852_10005926 JGI24740J21852_100059264 234
368 3300001989 JGI24739J22299_10033310 JGI24739J22299_100333103 234
369 3300001990 JGI24737J22298_10007765 JGI24737J22298_100077652 234
370 3300002070 JGI24750J21931_1001069 JGI24750J21931_10010692 234
371 3300002074 JGI24748J21848_1000013 JGI24748J21848_100001312 234
372 3300002075 JGI24738J21930_10001426 JGI24738J21930_100014265 234
373 3300002075 JGI24738J21930_10004835 JGI24738J21930_100048352 234
374 3300002076 JGI24749J21850_1000099 JGI24749J21850_100009913 234
375 3300002076 JGI24749J21850_1005832 JGI24749J21850_10058322 234
376 3300002239 JGI24034J26672_10000011 JGI24034J26672_1000001189 234
377 3300002244 JGI24742J22300_10005410 JGI24742J22300_100054102 234
378 3300002459 JGI24751J29686_10000542 JGI24751J29686_100005424 234
379 3300002459 JGI24751J29686_10022337 JGI24751J29686_100223372 234
380 3300003323 rootH1_10352848 rootH1_103528483 234
381 3300005289 Ga0065704_10077371 Ga0065704_100773715 234
382 3300005295 Ga0065707_10000450 Ga0065707_1000045039 234
383 3300005295 Ga0065707_10105218 Ga0065707_101052182 234
384 3300005327 Ga0070658_10003485 Ga0070658_100034858 234
385 3300005327 Ga0070658_10051923 Ga0070658_100519234 234
386 3300005327 Ga0070658_10101506 Ga0070658_101015062 234
387 3300005329 Ga0070683_100004273 Ga0070683_1000042737 234
388 3300005330 Ga0070690_100000003 Ga0070690_1000000033 234
389 3300005331 Ga0070670_100000014 Ga0070670_100000014132 234
390 3300005331 Ga0070670_100000047 Ga0070670_10000004779 234
391 3300005331 Ga0070670_100003161 Ga0070670_10000316111 234
392 3300005331 Ga0070670_100046115 Ga0070670_1000461154 234
393 3300005331 Ga0070670_100141122 Ga0070670_1001411222 234
394 3300005335 Ga0070666_10000176 Ga0070666_100001764 234
395 3300005335 Ga0070666_10008520 Ga0070666_100085204 234
396 3300005338 Ga0068868_100459188 Ga0068868_1004591881 234
397 3300005339 Ga0070660_100100055 Ga0070660_1001000552 234
398 3300005340 Ga0070689_100198125 Ga0070689_1001981252 234
399 3300005344 Ga0070661_100056713 Ga0070661_1000567133 234
400 3300005344 Ga0070661_100123275 Ga0070661_1001232752 234
401 3300005344 Ga0070661_100211894 Ga0070661_1002118942 234
402 3300005347 Ga0070668_100000001 Ga0070668_100000001126 234
403 3300005347 Ga0070668_100005405 Ga0070668_1000054057 234
404 3300005347 Ga0070668_100238676 Ga0070668_1002386762 234
405 3300005353 Ga0070669_100000014 Ga0070669_10000001486 234
406 3300005353 Ga0070669_100000072 Ga0070669_10000007250 234
407 3300005353 Ga0070669_100023481 Ga0070669_1000234812 234
408 3300005355 Ga0070671_100000106 Ga0070671_10000010634 234
409 3300005355 Ga0070671_100016773 Ga0070671_1000167733 234
410 3300005356 Ga0070674_100313601 Ga0070674_1003136012 234
411 3300005364 Ga0070673_100162680 Ga0070673_1001626802 234
412 3300005365 Ga0070688_100000740 Ga0070688_1000007401 234
413 3300005366 Ga0070659_100038333 Ga0070659_1000383332 234
414 3300005366 Ga0070659_100191885 Ga0070659_1001918852 234
415 3300005367 Ga0070667_100000006 Ga0070667_100000006167 234
416 3300005367 Ga0070667_100000144 Ga0070667_10000014467 234
417 3300005367 Ga0070667_100010339 Ga0070667_1000103395 234
418 3300005367 Ga0070667_100012958 Ga0070667_1000129583 234
419 3300005455 Ga0070663_100074477 Ga0070663_1000744773 234
420 3300005457 Ga0070662_100136878 Ga0070662_1001368783 234
421 3300005466 Ga0070685_10000034 Ga0070685_1000003449 234
422 3300005530 Ga0070679_100459015 Ga0070679_1004590152 234
423 3300005535 Ga0070684_100000841 Ga0070684_10000084115 234
424 3300005535 Ga0070684_100204313 Ga0070684_1002043132 234
425 3300005539 Ga0068853_100024201 Ga0068853_1000242013 234
426 3300005539 Ga0068853_100115983 Ga0068853_1001159833 234
427 3300005543 Ga0070672_100231577 Ga0070672_1002315771 234
428 3300005544 Ga0070686_100000023 Ga0070686_10000002333 234
429 3300005548 Ga0070665_100000019 Ga0070665_100000019419 234
430 3300005548 Ga0070665_100445744 Ga0070665_1004457442 234
431 3300005563 Ga0068855_100472023 Ga0068855_1004720232 234
432 3300005577 Ga0068857_100059516 Ga0068857_1000595163 234
433 3300005577 Ga0068857_100104890 Ga0068857_1001048902 234
434 3300005577 Ga0068857_100499871 Ga0068857_1004998712 234
435 3300005578 Ga0068854_100031128 Ga0068854_1000311282 234
436 3300005578 Ga0068854_100303659 Ga0068854_1003036592 234
437 3300005616 Ga0068852_100011677 Ga0068852_1000116778 234
438 3300005616 Ga0068852_100014143 Ga0068852_1000141437 234
439 3300005616 Ga0068852_100143339 Ga0068852_1001433392 234
440 3300005617 Ga0068859_100012629 Ga0068859_1000126295 234
441 3300005617 Ga0068859_100018286 Ga0068859_1000182863 234
442 3300005617 Ga0068859_100060005 Ga0068859_1000600054 234
443 3300005617 Ga0068859_100186610 Ga0068859_1001866102 234
444 3300005618 Ga0068864_100000021 Ga0068864_100000021143 234
445 3300005618 Ga0068864_100000051 Ga0068864_10000005179 234
446 3300005618 Ga0068864_100000306 Ga0068864_10000030610 234
447 3300005618 Ga0068864_100001847 Ga0068864_10000184714 234
448 3300005618 Ga0068864_100002997 Ga0068864_1000029977 234
449 3300005719 Ga0068861_100003101 Ga0068861_1000031013 234
450 3300005719 Ga0068861_100111784 Ga0068861_1001117842 234
451 3300005841 Ga0068863_100000009 Ga0068863_100000009150 234
452 3300005841 Ga0068863_100000044 Ga0068863_100000044119 234
453 3300005841 Ga0068863_100001228 Ga0068863_1000012285 234
454 3300005841 Ga0068863_100141123 Ga0068863_1001411232 234
455 3300005842 Ga0068858_100000555 Ga0068858_10000055527 234
456 3300005842 Ga0068858_100012260 Ga0068858_1000122603 234
457 3300005843 Ga0068860_100000074 Ga0068860_1000000748 234
458 3300005843 Ga0068860_100000601 Ga0068860_1000006014 234
459 3300005844 Ga0068862_100000017 Ga0068862_100000017146 234
460 3300005844 Ga0068862_100000036 Ga0068862_100000036120 234
461 3300005844 Ga0068862_100000700 Ga0068862_1000007005 234
462 3300005844 Ga0068862_100001801 Ga0068862_1000018013 234
463 3300005937 Ga0081455_10000244 Ga0081455_1000024417 234
464 3300006358 Ga0068871_100225210 Ga0068871_1002252103 234
465 3300006931 Ga0097620_100012629 Ga0097620_1000126293 234
466 3300006931 Ga0097620_100018286 Ga0097620_1000182863 234
467 3300006931 Ga0097620_100060006 Ga0097620_1000600062 234
468 3300006931 Ga0097620_100186601 Ga0097620_1001866012 234
469 3300009011 Ga0105251_10000507 Ga0105251_1000050738 234
470 3300009101 Ga0105247_10084611 Ga0105247_100846112 234
471 3300009174 Ga0105241_10035270 Ga0105241_100352702 234
472 3300009177 Ga0105248_10000030 Ga0105248_1000003066 234
473 3300009177 Ga0105248_10000662 Ga0105248_1000066219 234
474 3300009177 Ga0105248_10143208 Ga0105248_101432082 234
475 3300009177 Ga0105248_10283132 Ga0105248_102831322 234
476 3300009177 Ga0105248_10371965 Ga0105248_103719652 234
477 3300009545 Ga0105237_10006580 Ga0105237_100065803 234
478 3300009545 Ga0105237_10067830 Ga0105237_100678302 234
479 3300009551 Ga0105238_10006524 Ga0105238_1000652410 234
480 3300009551 Ga0105238_10138388 Ga0105238_101383882 234
481 3300009551 Ga0105238_10957705 Ga0105238_109577051 234
482 3300009551 Ga0105238_10957706 Ga0105238_109577061 234
483 3300009553 Ga0105249_10000137 Ga0105249_1000013781 234
484 3300009553 Ga0105249_10000390 Ga0105249_1000039034 234
485 3300009553 Ga0105249_10183293 Ga0105249_101832932 234
486 3300010375 Ga0105239_10012441 Ga0105239_100124412 234
487 3300013100 Ga0157373_10342795 Ga0157373_103427952 234
488 3300013102 Ga0157371_10010300 Ga0157371_100103007 234
489 3300013102 Ga0157371_10063063 Ga0157371_100630634 234
490 3300013104 Ga0157370_10060985 Ga0157370_100609855 234
491 3300013104 Ga0157370_10213666 Ga0157370_102136663 234
492 3300013104 Ga0157370_10342038 Ga0157370_103420382 234
493 3300013104 Ga0157370_10346591 Ga0157370_103465911 234
494 3300013105 Ga0157369_10060021 Ga0157369_100600212 234
495 3300013105 Ga0157369_10087703 Ga0157369_100877032 234
496 3300013105 Ga0157369_10908389 Ga0157369_109083892 234
497 3300013297 Ga0157378_10018423 Ga0157378_100184234 234
498 3300013306 Ga0163162_10085773 Ga0163162_100857732 234
499 3300013306 Ga0163162_10153079 Ga0163162_101530792 234
500 3300013306 Ga0163162_10179430 Ga0163162_101794302 234
501 3300013306 Ga0163162_10496668 Ga0163162_104966682 234
502 3300013307 Ga0157372_10025303 Ga0157372_100253037 234
503 3300013307 Ga0157372_10212139 Ga0157372_102121391 234
504 3300014325 Ga0163163_10048624 Ga0163163_100486242 234
505 3300014325 Ga0163163_10049520 Ga0163163_100495201 234
506 3300014326 Ga0157380_10000130 Ga0157380_1000013014 234
507 3300014326 Ga0157380_10000276 Ga0157380_100002769 234
508 3300014326 Ga0157380_10023921 Ga0157380_100239214 234
509 3300014968 Ga0157379_10007527 Ga0157379_100075275 234
510 3300017792 Ga0163161_10000718 Ga0163161_100007183 234
511 3300017792 Ga0163161_10000723 Ga0163161_1000072316 234
512 3300021377 Ga0213874_10013842 Ga0213874_100138421 234
513 3300025223 Ga0207672_1000583 Ga0207672_10005833 234
514 3300025315 Ga0207697_10027436 Ga0207697_100274362 234
515 3300025321 Ga0207656_10004664 Ga0207656_100046644 234
516 3300025735 Ga0207713_1030856 Ga0207713_10308562 234
517 3300025900 Ga0207710_10105106 Ga0207710_101051061 234
518 3300025903 Ga0207680_10000081 Ga0207680_1000008134 234
519 3300025903 Ga0207680_10018306 Ga0207680_100183062 234
520 3300025904 Ga0207647_10033782 Ga0207647_100337824 234
521 3300025909 Ga0207705_10015211 Ga0207705_100152115 234
522 3300025909 Ga0207705_10021128 Ga0207705_100211282 234
523 3300025911 Ga0207654_10001441 Ga0207654_1000144112 234
524 3300025911 Ga0207654_10018673 Ga0207654_100186732 234
525 3300025912 Ga0207707_10168717 Ga0207707_101687172 234
526 3300025913 Ga0207695_10070959 Ga0207695_100709594 234
527 3300025913 Ga0207695_10146879 Ga0207695_101468793 234
528 3300025914 Ga0207671_10008068 Ga0207671_1000806810 234
529 3300025914 Ga0207671_10019862 Ga0207671_100198627 234
530 3300025914 Ga0207671_10180695 Ga0207671_101806952 234
531 3300025919 Ga0207657_10088189 Ga0207657_100881894 234
532 3300025920 Ga0207649_10150387 Ga0207649_101503871 234
533 3300025921 Ga0207652_10250991 Ga0207652_102509912 234
534 3300025923 Ga0207681_10000061 Ga0207681_1000006145 234
535 3300025923 Ga0207681_10000082 Ga0207681_1000008210 234
536 3300025923 Ga0207681_10108942 Ga0207681_101089422 234
537 3300025924 Ga0207694_10006657 Ga0207694_100066572 234
538 3300025924 Ga0207694_10008012 Ga0207694_100080126 234
539 3300025924 Ga0207694_10025521 Ga0207694_100255213 234
540 3300025924 Ga0207694_10254608 Ga0207694_102546082 234
541 3300025925 Ga0207650_10000038 Ga0207650_1000003818 234
542 3300025925 Ga0207650_10000095 Ga0207650_1000009590 234
543 3300025925 Ga0207650_10000861 Ga0207650_1000086111 234
544 3300025931 Ga0207644_10000047 Ga0207644_1000004773 234
545 3300025931 Ga0207644_10002206 Ga0207644_100022065 234
546 3300025931 Ga0207644_10003796 Ga0207644_100037963 234
547 3300025931 Ga0207644_10028465 Ga0207644_100284652 234
548 3300025932 Ga0207690_10060516 Ga0207690_100605162 234
549 3300025932 Ga0207690_10072123 Ga0207690_100721233 234
550 3300025932 Ga0207690_10175858 Ga0207690_101758582 234
551 3300025933 Ga0207706_10049700 Ga0207706_100497002 234
552 3300025933 Ga0207706_10068243 Ga0207706_100682433 234
553 3300025935 Ga0207709_10019687 Ga0207709_100196872 234
554 3300025936 Ga0207670_10322390 Ga0207670_103223902 234
555 3300025940 Ga0207691_10389506 Ga0207691_103895061 234
556 3300025941 Ga0207711_10000029 Ga0207711_1000002966 234
557 3300025941 Ga0207711_10000254 Ga0207711_1000025424 234
558 3300025941 Ga0207711_10157542 Ga0207711_101575422 234
559 3300025944 Ga0207661_10196889 Ga0207661_101968892 234
560 3300025945 Ga0207679_10099501 Ga0207679_100995012 234
561 3300025949 Ga0207667_10004100 Ga0207667_1000410017 234
562 3300025949 Ga0207667_10175962 Ga0207667_101759622 234
563 3300025960 Ga0207651_10059332 Ga0207651_100593323 234
564 3300025961 Ga0207712_10000335 Ga0207712_1000033534 234
565 3300025961 Ga0207712_10000734 Ga0207712_1000073415 234
566 3300025961 Ga0207712_10065333 Ga0207712_100653332 234
567 3300025972 Ga0207668_10000009 Ga0207668_1000000931 234
568 3300025972 Ga0207668_10004813 Ga0207668_100048135 234
569 3300025972 Ga0207668_10217044 Ga0207668_102170442 234
570 3300025981 Ga0207640_10009909 Ga0207640_100099092 234
571 3300025981 Ga0207640_10033724 Ga0207640_100337242 234
572 3300025981 Ga0207640_10334792 Ga0207640_103347922 234
573 3300025986 Ga0207658_10000010 Ga0207658_10000010164 234
574 3300025986 Ga0207658_10000728 Ga0207658_1000072816 234
575 3300025986 Ga0207658_10001866 Ga0207658_100018665 234
576 3300025986 Ga0207658_10004027 Ga0207658_100040278 234
577 3300026035 Ga0207703_10000368 Ga0207703_1000036810 234
578 3300026035 Ga0207703_10000822 Ga0207703_100008223 234
579 3300026035 Ga0207703_10002210 Ga0207703_100022107 234
580 3300026041 Ga0207639_10000136 Ga0207639_1000013636 234
581 3300026041 Ga0207639_10025845 Ga0207639_100258452 234
582 3300026041 Ga0207639_10231045 Ga0207639_102310452 234
583 3300026067 Ga0207678_10021656 Ga0207678_100216564 234
584 3300026078 Ga0207702_10008931 Ga0207702_1000893110 234
585 3300026078 Ga0207702_10105164 Ga0207702_101051642 234
586 3300026078 Ga0207702_10704662 Ga0207702_107046621 234
587 3300026088 Ga0207641_10000017 Ga0207641_10000017170 234
588 3300026088 Ga0207641_10000073 Ga0207641_1000007313 234
589 3300026088 Ga0207641_10000914 Ga0207641_1000091428 234
590 3300026088 Ga0207641_10010624 Ga0207641_100106242 234
591 3300026088 Ga0207641_10133438 Ga0207641_101334383 234
592 3300026095 Ga0207676_10000034 Ga0207676_10000034165 234
593 3300026095 Ga0207676_10000037 Ga0207676_10000037116 234
594 3300026095 Ga0207676_10000193 Ga0207676_1000019328 234
595 3300026095 Ga0207676_10000781 Ga0207676_1000078111 234
596 3300026095 Ga0207676_10000956 Ga0207676_1000095614 234
597 3300026095 Ga0207676_10023450 Ga0207676_100234504 234
598 3300026116 Ga0207674_10007312 Ga0207674_1000731214 234
599 3300026116 Ga0207674_10659374 Ga0207674_106593742 234
600 3300026118 Ga0207675_100001462 Ga0207675_1000014624 234
601 3300026118 Ga0207675_100042095 Ga0207675_1000420952 234
602 3300026142 Ga0207698_10006770 Ga0207698_100067702 234
603 3300026142 Ga0207698_10020877 Ga0207698_100208772 234
604 3300026142 Ga0207698_10123678 Ga0207698_101236782 234
605 3300026142 Ga0207698_10342017 Ga0207698_103420173 234
606 3300026142 Ga0207698_10785461 Ga0207698_107854611 234
607 3300028379 Ga0268266_10000025 Ga0268266_1000002586 234
608 3300028380 Ga0268265_10000025 Ga0268265_1000002593 234
609 3300028380 Ga0268265_10000052 Ga0268265_10000052113 234
610 3300028380 Ga0268265_10000143 Ga0268265_1000014378 234
611 3300028380 Ga0268265_10000530 Ga0268265_1000053018 234
612 3300028381 Ga0268264_10000070 Ga0268264_10000070104 234
613 3300028381 Ga0268264_10000608 Ga0268264_1000060834 234
614 3300031548 Ga0307408_100035719 Ga0307408_1000357192 234
615 3300031911 Ga0307412_10017153 Ga0307412_100171532 234
616 3300031911 Ga0307412_10039927 Ga0307412_100399273 234
617 3300031911 Ga0307412_10151739 Ga0307412_101517391 234
618 3300032002 Ga0307416_100180619 Ga0307416_1001806192 234
619 3300033180 Ga0307510_10026690 Ga0307510_100266903 234
620 3300037312 Ga0395899_0009253 Ga0395899_0009253_1281_1985 234
621 3300037312 Ga0395899_0046034 Ga0395899_0046034_1954_2658 234
622 3300037418 Ga0395900_0000964 Ga0395900_0000964_348_1052 234
623 3300037418 Ga0395900_0013554 Ga0395900_0013554_4633_5337 234
624 3300037418 Ga0395900_0027700 Ga0395900_0027700_1857_2561 234
625 3300037466 Ga0395898_0022701 Ga0395898_0022701_3074_3778 234
626 3300037466 Ga0395898_0292276 Ga0395898_0292276_146_850 234
627 3300037471 Ga0395905_0098859 Ga0395905_0098859_1729_2433 234
628 3300037471 Ga0395905_0136652 Ga0395905_0136652_718_1422 234
629 3300037853 Ga0436364_0443678 Ga0436364_0443678_413_1123 234
630 3300038443 Ga0395901_0001061 Ga0395901_0001061_25109_25813 234
631 3300038443 Ga0395901_0015808 Ga0395901_0015808_2355_3059 234
632 3300038443 Ga0395901_0034086 Ga0395901_0034086_1903_2607 234
633 3300039450 Ga0436363_0896344 Ga0436363_0896344_2073_2780 234
634 3300039450 Ga0436363_1706034 Ga0436363_1706034_87_794 234
635 3300044694 Ga0466963_0012713 Ga0466963_0012713_2264_2968 234
636 3300044694 Ga0466963_0042034 Ga0466963_0042034_1864_2568 234
637 3300045976 Ga0466967_0027105 Ga0466967_0027105_639_1343 234
638 3300045976 Ga0466967_0147945 Ga0466967_0147945_896_1600 234
639 3300046506 Ga0495583_0099442 Ga0495583_0099442_100_804 234
640 3300046520 Ga0495637_0056169 Ga0495637_0056169_469_1173 234
641 3300046522 Ga0495643_0048100 Ga0495643_0048100_1272_1976 234
642 3300046522 Ga0495643_0072685 Ga0495643_0072685_428_1156 234
643 3300046524 Ga0495648_0075240 Ga0495648_0075240_781_1494 234
644 3300046525 Ga0495663_0027919 Ga0495663_0027919_221_925 234
645 3300046530 Ga0495654_0005164 Ga0495654_0005164_4600_5304 234
646 3300046542 Ga0495597_0061300 Ga0495597_0061300_660_1388 234
647 3300046616 Ga0495668_0007229 Ga0495668_0007229_2660_3364 234
648 3300046616 Ga0495668_0013009 Ga0495668_0013009_671_1486 234
649 3300046616 Ga0495668_0027327 Ga0495668_0027327_1119_1847 234
650 3300046660 Ga0495625_0042424 Ga0495625_0042424_1242_1955 234
651 3300046660 Ga0495625_0098269 Ga0495625_0098269_993_1883 234
652 3300046691 Ga0495670_0000004 Ga0495670_0000004_192236_192943 234
653 3300047445 Ga0495677_0034076 Ga0495677_0034076_526_1239 234
654 3300048904 Ga0496101_0389750 Ga0496101_0389750_262_1062 234
655 3300048905 Ga0496102_0000010 Ga0496102_0000010_289509_290213 234
656 3300048905 Ga0496102_0042162 Ga0496102_0042162_1030_1734 234
657 3300048906 Ga0496103_0000029 Ga0496103_0000029_178218_178922 234
658 3300048906 Ga0496103_0001613 Ga0496103_0001613_1030_1734 234
659 3300048907 Ga0496104_0050732 Ga0496104_0050732_491_1195 234
660 3300048908 Ga0496105_0054789 Ga0496105_0054789_2069_2773 234
661 3300048908 Ga0496105_0184534 Ga0496105_0184534_315_1019 234
662 3300048909 Ga0496106_0067686 Ga0496106_0067686_865_1569 234
663 3300048910 Ga0496107_0027803 Ga0496107_0027803_2094_2798 234
664 3300048912 Ga0496109_0011644 Ga0496109_0011644_303_1007 234
665 3300048912 Ga0496109_0960554 Ga0496109_0960554_74_778 234
666 3300048913 Ga0496110_0155580 Ga0496110_0155580_418_1122 234
667 3300048913 Ga0496110_0201160 Ga0496110_0201160_355_1059 234
668 3300048916 Ga0496113_0029704 Ga0496113_0029704_474_1178 234
669 3300048919 Ga0496116_0003035 Ga0496116_0003035_7671_8375 234
670 3300048920 Ga0496117_0000037 Ga0496117_0000037_290111_290815 234
671 3300048920 Ga0496117_0005000 Ga0496117_0005000_7378_8178 234
672 3300048921 Ga0496118_0000034 Ga0496118_0000034_287915_288619 234
673 3300048921 Ga0496118_0000216 Ga0496118_0000216_92823_93623 234
674 3300048922 Ga0496119_0030248 Ga0496119_0030248_122_826 234
675 3300048923 Ga0496120_0132918 Ga0496120_0132918_379_1086 234
676 3300048924 Ga0496121_0018311 Ga0496121_0018311_2175_2879 234
677 3300048925 Ga0496122_0305577 Ga0496122_0305577_89_793 234
678 3300048926 Ga0496123_0025909 Ga0496123_0025909_2843_3550 234
679 3300048927 Ga0496124_0000033 Ga0496124_0000033_287915_288619 234
680 3300048927 Ga0496124_0001292 Ga0496124_0001292_34326_35033 234
681 3300048927 Ga0496124_0002507 Ga0496124_0002507_18989_19696 234
682 3300048927 Ga0496124_0009995 Ga0496124_0009995_5383_6090 234
683 3300048929 Ga0496126_0255449 Ga0496126_0255449_500_1207 234
684 3300049569 Ga0501032_0045189 Ga0501032_0045189_653_1384 234
685 3300049572 Ga0501036_0265314 Ga0501036_0265314_465_1172 234
686 3300049580 Ga0501046_0261935 Ga0501046_0261935_390_1097 234
687 3300049582 Ga0501048_0112062 Ga0501048_0112062_371_1078 234
688 3300049583 Ga0501067_0071112 Ga0501067_0071112_19_726 234
689 3300049590 Ga0501074_0195265 Ga0501074_0195265_183_890 234
690 3300049592 Ga0501076_0102453 Ga0501076_0102453_381_1088 234
691 3300049742 Ga0501080_0470016 Ga0501080_0470016_60_767 234
692 3300049822 Ga0501035_0294604 Ga0501035_0294604_513_1220 234
693 3300049823 Ga0501044_0044786 Ga0501044_0044786_1855_2586 234
694 3300053083 Ga0495655_0000236 Ga0495655_0000236_7246_7953 234
695 3300053087 Ga0500643_000478 Ga0500643_000478_8729_9472 234
696 3300053087 Ga0500643_018106 Ga0500643_018106_530_1237 234
697 3300053087 Ga0500643_024690 Ga0500643_024690_579_1292 234
698 3300053093 Ga0500651_0006612 Ga0500651_0006612_433_1161 234
699 3300053108 Ga0500562_043538 Ga0500562_043538_374_1081 234
700 3300053116 Ga0500592_015980 Ga0500592_015980_120_824 234
701 3300053130 Ga0500642_0000714 Ga0500642_0000714_8722_9450 234
702 3300053133 Ga0500655_000061 Ga0500655_000061_28108_28836 234
703 3300053136 Ga0500559_0068844 Ga0500559_0068844_31_744 234
704 3300053136 Ga0500559_0149949 Ga0500559_0149949_114_821 234
705 3300053140 Ga0500573_0000061 Ga0500573_0000061_44483_45190 234
706 3300053148 Ga0500590_002284 Ga0500590_002284_2372_3100 234
707 3300053156 Ga0500622_0040895 Ga0500622_0040895_782_1510 234
708 3300053158 Ga0500627_0004783 Ga0500627_0004783_2562_3266 234
709 3300053163 Ga0500639_032266 Ga0500639_032266_1650_2378 234
710 3300053177 Ga0500636_0240556 Ga0500636_0240556_12_740 234
711 3300053724 Ga0500570_001475 Ga0500570_001475_532_1260 234
712 3300060353 Ga0501082_0526142 Ga0501082_0526142_217_924 234
713 3300061734 Ga0530510_0063971 Ga0530510_0063971_1178_1885 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

47

269

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lwd-assembly1.cif.gz_A-2 crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution 0.9269 12 232
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.9227 3 234
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.9036 3 234
3lwd-assembly1.cif.gz_A-2 crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution 0.891 12 232
1vl1-assembly1.cif.gz_A crystal structure of 6-phosphogluconolactonase (tm1154) from thermotoga maritima at 1.70a resolution 0.8825 3 233
ID Description Score Start End Superfamily
3lwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9264 12 232 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9085 3 234 3.40.50.1360
3lhiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8974 6 234 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8932 3 234 3.40.50.1360
3lwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8904 12 232 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A520J0Y3-F1-model_v4 6-phosphogluconolactonase 0.9929 107 234 GO:0005975
AF-A0A520J0Y3-F1-model_v4 6-phosphogluconolactonase 0.9852 107 234 GO:0005975
AF-A0A520JB25-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9825 3 190 GO:0005975
GO:0006098
GO:0017057
AF-A0A2D8AYU0-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9784 6 234 GO:0005975
GO:0006098
GO:0017057
AF-A0A7G9KZA4-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9779 1 233 GO:0005975
GO:0006098
GO:0017057

Feature Viewer

pLDDT pTM Quality
95.53 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map