F476906
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 713 | 281 | 701 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0013009|Ga0495668_0013009_671_1486 |
| Length | 271 |
| Sequence | MEKIAIDQIRIAHFSVRNWLDNGLTMRKVRRHEQGQTMIEAEWWDYDSPSEMAEAVAGDVGFIIESALDARGEALLALPGGTTAGPIYEKLAKTKLNWKRVTIIPTDDRLVPVSDPRSNIAMIARHFIPLGTRVVPIVSESAADYRAAGNAANGRLDDMKWPPDLVWLSIGIDGHVASLFPGPDLNDAIEAPASRRAIGVLPDPMPEDAAVARVSLTRSAMLSARTLIIVGSGDSKREVLETALEEGKRSTSPIGRVLADCELPVDIHWLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 3 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 4 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 5 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 6 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 7 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 8 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 9 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 10 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 11 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 264 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 265 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 266 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 268 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 269 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 271 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 272 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 273 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 274 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 276 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 281 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.32 |
| Metatranscriptomes | 0 |
| Isolates | 1.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.42 |
| Bulb | 0 |
| Endosphere | 2.66 |
| Nodule | 0 |
| Rhizoplane | 5.05 |
| Rhizosphere | 88.36 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 3.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001406 | 3300001904 | Bacteria | 4404 |
| 2 | JGI24741J21665_1003224 | 3300001915 | Bacteria | 3966 |
| 3 | JGI24752J21851_1000080 | 3300001976 | Bacteria | 12759 |
| 4 | JGI24752J21851_1000160 | 3300001976 | Bacteria | 9211 |
| 5 | JGI24746J21847_1000985 | 3300001977 | Bacteria | 4477 |
| 6 | JGI24740J21852_10005926 | 3300001979 | Bacteria | 5120 |
| 7 | JGI24739J22299_10007504 | 3300001989 | Bacteria | 4088 |
| 8 | JGI24739J22299_10033310 | 3300001989 | Bacteria | 1764 |
| 9 | JGI24739J22299_10037287 | 3300001989 | Bacteria | 1638 |
| 10 | JGI24737J22298_10000929 | 3300001990 | Bacteria | 10391 |
| 11 | JGI24737J22298_10007765 | 3300001990 | Bacteria | 3616 |
| 12 | JGI24750J21931_1001069 | 3300002070 | Bacteria | 3571 |
| 13 | JGI24748J21848_1000013 | 3300002074 | Bacteria | 149648 |
| 14 | JGI24738J21930_10001426 | 3300002075 | Bacteria | 6629 |
| 15 | JGI24738J21930_10004835 | 3300002075 | Bacteria | 3271 |
| 16 | JGI24749J21850_1000099 | 3300002076 | Bacteria | 14965 |
| 17 | JGI24749J21850_1003838 | 3300002076 | Bacteria | 2098 |
| 18 | JGI24749J21850_1005832 | 3300002076 | Bacteria | 1718 |
| 19 | JGI24033J26618_1007065 | 3300002155 | Bacteria | 1269 |
| 20 | JGI24034J26672_10000011 | 3300002239 | Bacteria | 148169 |
| 21 | JGI24034J26672_10010937 | 3300002239 | Bacteria | 1354 |
| 22 | JGI24742J22300_10005410 | 3300002244 | Bacteria | 2099 |
| 23 | JGI24751J29686_10000542 | 3300002459 | Bacteria | 10514 |
| 24 | JGI24751J29686_10022337 | 3300002459 | Bacteria | 1313 |
| 25 | rootH1_10352848 | 3300003323 | Bacteria | 2306 |
| 26 | Ga0065704_10077371 | 3300005289 | Bacteria | 4759 |
| 27 | Ga0065715_10000860 | 3300005293 | Bacteria | 10507 |
| 28 | Ga0065715_10422059 | 3300005293 | Bacteria | 855 |
| 29 | Ga0065707_10000450 | 3300005295 | Bacteria | 70667 |
| 30 | Ga0065707_10105218 | 3300005295 | Bacteria | 2655 |
| 31 | Ga0070658_10003485 | 3300005327 | Bacteria | 12923 |
| 32 | Ga0070658_10041850 | 3300005327 | Bacteria | 3696 |
| 33 | Ga0070658_10051923 | 3300005327 | Bacteria | 3324 |
| 34 | Ga0070658_10101506 | 3300005327 | Bacteria | 2378 |
| 35 | Ga0070676_10024298 | 3300005328 | Bacteria | 3413 |
| 36 | Ga0070683_100004273 | 3300005329 | Bacteria | 11728 |
| 37 | Ga0070690_100000003 | 3300005330 | Bacteria | 144748 |
| 38 | Ga0070690_100003881 | 3300005330 | Bacteria | 8242 |
| 39 | Ga0070670_100000014 | 3300005331 | Bacteria | 234648 |
| 40 | Ga0070670_100000047 | 3300005331 | Bacteria | 136625 |
| 41 | Ga0070670_100001686 | 3300005331 | Bacteria | 17947 |
| 42 | Ga0070670_100003161 | 3300005331 | Bacteria | 13616 |
| 43 | Ga0070670_100021229 | 3300005331 | Bacteria | 5587 |
| 44 | Ga0070670_100046115 | 3300005331 | Bacteria | 3748 |
| 45 | Ga0070670_100141122 | 3300005331 | Bacteria | 2083 |
| 46 | Ga0070677_10002154 | 3300005333 | Bacteria | 6292 |
| 47 | Ga0070666_10000176 | 3300005335 | Bacteria | 43811 |
| 48 | Ga0070666_10008520 | 3300005335 | Bacteria | 6370 |
| 49 | Ga0068868_100023218 | 3300005338 | Bacteria | 4692 |
| 50 | Ga0068868_100459188 | 3300005338 | Bacteria | 1109 |
| 51 | Ga0070660_100017906 | 3300005339 | Bacteria | 5168 |
| 52 | Ga0070660_100027908 | 3300005339 | Bacteria | 4218 |
| 53 | Ga0070660_100038152 | 3300005339 | Bacteria | 3645 |
| 54 | Ga0070660_100067331 | 3300005339 | Bacteria | 2790 |
| 55 | Ga0070660_100100055 | 3300005339 | Bacteria | 2296 |
| 56 | Ga0070689_100198125 | 3300005340 | Bacteria | 1638 |
| 57 | Ga0070661_100015664 | 3300005344 | Bacteria | 5351 |
| 58 | Ga0070661_100056713 | 3300005344 | Bacteria | 2870 |
| 59 | Ga0070661_100123275 | 3300005344 | Bacteria | 1942 |
| 60 | Ga0070661_100211894 | 3300005344 | Bacteria | 1483 |
| 61 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 62 | Ga0070668_100001607 | 3300005347 | Bacteria | 16353 |
| 63 | Ga0070668_100005405 | 3300005347 | Bacteria | 9482 |
| 64 | Ga0070668_100238676 | 3300005347 | Bacteria | 1505 |
| 65 | Ga0070669_100000014 | 3300005353 | Bacteria | 206875 |
| 66 | Ga0070669_100000072 | 3300005353 | Bacteria | 99184 |
| 67 | Ga0070669_100001322 | 3300005353 | Bacteria | 17877 |
| 68 | Ga0070669_100023481 | 3300005353 | Bacteria | 4415 |
| 69 | Ga0070669_100327200 | 3300005353 | Bacteria | 1239 |
| 70 | Ga0070675_100001353 | 3300005354 | Bacteria | 17951 |
| 71 | Ga0070675_100959047 | 3300005354 | Bacteria | 785 |
| 72 | Ga0070671_100000106 | 3300005355 | Bacteria | 53385 |
| 73 | Ga0070671_100011279 | 3300005355 | Bacteria | 7180 |
| 74 | Ga0070671_100012896 | 3300005355 | Bacteria | 6738 |
| 75 | Ga0070671_100015271 | 3300005355 | Bacteria | 6201 |
| 76 | Ga0070671_100016773 | 3300005355 | Bacteria | 5923 |
| 77 | Ga0070671_100062948 | 3300005355 | Bacteria | 3089 |
| 78 | Ga0070674_100027724 | 3300005356 | Bacteria | 3714 |
| 79 | Ga0070674_100172317 | 3300005356 | Bacteria | 1651 |
| 80 | Ga0070674_100313601 | 3300005356 | Bacteria | 1255 |
| 81 | Ga0070673_100001125 | 3300005364 | Bacteria | 15355 |
| 82 | Ga0070673_100006322 | 3300005364 | Bacteria | 7693 |
| 83 | Ga0070673_100162680 | 3300005364 | Bacteria | 1899 |
| 84 | Ga0070688_100000740 | 3300005365 | Bacteria | 16080 |
| 85 | Ga0070659_100038333 | 3300005366 | Bacteria | 3738 |
| 86 | Ga0070659_100049850 | 3300005366 | Bacteria | 3293 |
| 87 | Ga0070659_100125598 | 3300005366 | Bacteria | 2081 |
| 88 | Ga0070659_100191885 | 3300005366 | Bacteria | 1679 |
| 89 | Ga0070659_100941139 | 3300005366 | Bacteria | 756 |
| 90 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 91 | Ga0070667_100000144 | 3300005367 | Bacteria | 89681 |
| 92 | Ga0070667_100005432 | 3300005367 | Bacteria | 10645 |
| 93 | Ga0070667_100010339 | 3300005367 | Bacteria | 7707 |
| 94 | Ga0070667_100011171 | 3300005367 | Bacteria | 7429 |
| 95 | Ga0070667_100012958 | 3300005367 | Bacteria | 6894 |
| 96 | Ga0070714_100156476 | 3300005435 | Bacteria | 2058 |
| 97 | Ga0070713_100129476 | 3300005436 | Bacteria | 2224 |
| 98 | Ga0070713_100210091 | 3300005436 | Bacteria | 1762 |
| 99 | Ga0070663_100010813 | 3300005455 | Bacteria | 5701 |
| 100 | Ga0070663_100074477 | 3300005455 | Bacteria | 2479 |
| 101 | Ga0070663_100122143 | 3300005455 | Bacteria | 1969 |
| 102 | Ga0070678_100028839 | 3300005456 | Bacteria | 3791 |
| 103 | Ga0070678_100046580 | 3300005456 | Bacteria | 3110 |
| 104 | Ga0070662_100000741 | 3300005457 | Bacteria | 19985 |
| 105 | Ga0070662_100002121 | 3300005457 | Bacteria | 12156 |
| 106 | Ga0070662_100136878 | 3300005457 | Bacteria | 1894 |
| 107 | Ga0070662_100139437 | 3300005457 | Bacteria | 1877 |
| 108 | Ga0070662_100237280 | 3300005457 | Bacteria | 1461 |
| 109 | Ga0068867_100050084 | 3300005459 | Bacteria | 3077 |
| 110 | Ga0070685_10000034 | 3300005466 | Bacteria | 81799 |
| 111 | Ga0070679_100459015 | 3300005530 | Bacteria | 1218 |
| 112 | Ga0070684_100000841 | 3300005535 | Bacteria | 21613 |
| 113 | Ga0070684_100204313 | 3300005535 | Bacteria | 1800 |
| 114 | Ga0070684_100333746 | 3300005535 | Bacteria | 1394 |
| 115 | Ga0068853_100024201 | 3300005539 | Bacteria | 5090 |
| 116 | Ga0068853_100072666 | 3300005539 | Bacteria | 2998 |
| 117 | Ga0068853_100115983 | 3300005539 | Bacteria | 2384 |
| 118 | Ga0068853_100379080 | 3300005539 | Bacteria | 1320 |
| 119 | Ga0068853_100568877 | 3300005539 | Unclassified | 1075 |
| 120 | Ga0070672_100008666 | 3300005543 | Bacteria | 6972 |
| 121 | Ga0070672_100231577 | 3300005543 | Unclassified | 1552 |
| 122 | Ga0070686_100000023 | 3300005544 | Bacteria | 130174 |
| 123 | Ga0070686_100016476 | 3300005544 | Bacteria | 4300 |
| 124 | Ga0070665_100000019 | 3300005548 | Bacteria | 413972 |
| 125 | Ga0070665_100097517 | 3300005548 | Bacteria | 2944 |
| 126 | Ga0070665_100445744 | 3300005548 | Bacteria | 1304 |
| 127 | Ga0068855_100472023 | 3300005563 | Bacteria | 1366 |
| 128 | Ga0070664_100055951 | 3300005564 | Bacteria | 3351 |
| 129 | Ga0070664_100447642 | 3300005564 | Bacteria | 1185 |
| 130 | Ga0068857_100059516 | 3300005577 | Bacteria | 3393 |
| 131 | Ga0068857_100083933 | 3300005577 | Bacteria | 2846 |
| 132 | Ga0068857_100104890 | 3300005577 | Bacteria | 2538 |
| 133 | Ga0068857_100499871 | 3300005577 | Bacteria | 1141 |
| 134 | Ga0068854_100031128 | 3300005578 | Bacteria | 3706 |
| 135 | Ga0068854_100037269 | 3300005578 | Bacteria | 3412 |
| 136 | Ga0068854_100303659 | 3300005578 | Bacteria | 1292 |
| 137 | Ga0068856_100131804 | 3300005614 | Bacteria | 2504 |
| 138 | Ga0068856_100167170 | 3300005614 | Bacteria | 2211 |
| 139 | Ga0070702_100243359 | 3300005615 | Bacteria | 1215 |
| 140 | Ga0068852_100011677 | 3300005616 | Bacteria | 6624 |
| 141 | Ga0068852_100014143 | 3300005616 | Bacteria | 6129 |
| 142 | Ga0068852_100038258 | 3300005616 | Bacteria | 4030 |
| 143 | Ga0068852_100143339 | 3300005616 | Bacteria | 2213 |
| 144 | Ga0068859_100004899 | 3300005617 | Bacteria | 13638 |
| 145 | Ga0068859_100012629 | 3300005617 | Bacteria | 8491 |
| 146 | Ga0068859_100018286 | 3300005617 | Bacteria | 7047 |
| 147 | Ga0068859_100047437 | 3300005617 | Bacteria | 4316 |
| 148 | Ga0068859_100060005 | 3300005617 | Bacteria | 3833 |
| 149 | Ga0068859_100186610 | 3300005617 | Bacteria | 2157 |
| 150 | Ga0068864_100000021 | 3300005618 | Bacteria | 262378 |
| 151 | Ga0068864_100000051 | 3300005618 | Bacteria | 136621 |
| 152 | Ga0068864_100000306 | 3300005618 | Bacteria | 43501 |
| 153 | Ga0068864_100001847 | 3300005618 | Bacteria | 17419 |
| 154 | Ga0068864_100002997 | 3300005618 | Bacteria | 13957 |
| 155 | Ga0068864_100038921 | 3300005618 | Bacteria | 4063 |
| 156 | Ga0068864_100864567 | 3300005618 | Bacteria | 892 |
| 157 | Ga0068866_10027614 | 3300005718 | Bacteria | 2695 |
| 158 | Ga0068866_10292850 | 3300005718 | Bacteria | 1013 |
| 159 | Ga0068861_100003101 | 3300005719 | Bacteria | 10987 |
| 160 | Ga0068861_100111784 | 3300005719 | Bacteria | 2190 |
| 161 | Ga0068851_10012912 | 3300005834 | Bacteria | 3945 |
| 162 | Ga0068863_100000009 | 3300005841 | Bacteria | 250538 |
| 163 | Ga0068863_100000044 | 3300005841 | Bacteria | 149959 |
| 164 | Ga0068863_100001228 | 3300005841 | Bacteria | 25562 |
| 165 | Ga0068863_100029535 | 3300005841 | Bacteria | 5233 |
| 166 | Ga0068863_100141123 | 3300005841 | Bacteria | 2302 |
| 167 | Ga0068858_100000555 | 3300005842 | Bacteria | 38954 |
| 168 | Ga0068858_100012260 | 3300005842 | Bacteria | 8082 |
| 169 | Ga0068858_100094471 | 3300005842 | Unclassified | 2785 |
| 170 | Ga0068860_100000074 | 3300005843 | Bacteria | 173022 |
| 171 | Ga0068860_100000601 | 3300005843 | Bacteria | 42993 |
| 172 | Ga0068860_100091147 | 3300005843 | Bacteria | 2904 |
| 173 | Ga0068860_100236451 | 3300005843 | Bacteria | 1776 |
| 174 | Ga0068862_100000017 | 3300005844 | Bacteria | 247616 |
| 175 | Ga0068862_100000036 | 3300005844 | Bacteria | 173453 |
| 176 | Ga0068862_100000700 | 3300005844 | Bacteria | 34279 |
| 177 | Ga0068862_100001801 | 3300005844 | Bacteria | 19394 |
| 178 | Ga0068862_100004294 | 3300005844 | Bacteria | 12057 |
| 179 | Ga0068862_100030889 | 3300005844 | Bacteria | 4517 |
| 180 | Ga0068862_100126154 | 3300005844 | Bacteria | 2260 |
| 181 | Ga0081455_10000244 | 3300005937 | Bacteria | 70746 |
| 182 | Ga0070717_10498722 | 3300006028 | Bacteria | 1100 |
| 183 | Ga0097621_100008240 | 3300006237 | Bacteria | 7496 |
| 184 | Ga0068871_100225210 | 3300006358 | Bacteria | 1626 |
| 185 | Ga0068865_100009906 | 3300006881 | Bacteria | 5922 |
| 186 | Ga0068865_100076748 | 3300006881 | Bacteria | 2386 |
| 187 | Ga0097620_100004899 | 3300006931 | Bacteria | 13638 |
| 188 | Ga0097620_100012629 | 3300006931 | Bacteria | 8491 |
| 189 | Ga0097620_100018286 | 3300006931 | Bacteria | 7047 |
| 190 | Ga0097620_100038608 | 3300006931 | Bacteria | 4790 |
| 191 | Ga0097620_100047436 | 3300006931 | Bacteria | 4316 |
| 192 | Ga0097620_100060006 | 3300006931 | Bacteria | 3833 |
| 193 | Ga0097620_100186601 | 3300006931 | Bacteria | 2157 |
| 194 | Ga0105251_10000507 | 3300009011 | Bacteria | 36839 |
| 195 | Ga0111539_10357984 | 3300009094 | Bacteria | 1698 |
| 196 | Ga0105245_10021056 | 3300009098 | Bacteria | 5720 |
| 197 | Ga0105247_10084611 | 3300009101 | Bacteria | 2004 |
| 198 | Ga0105247_10128225 | 3300009101 | Bacteria | 1651 |
| 199 | Ga0105243_10053958 | 3300009148 | Bacteria | 3189 |
| 200 | Ga0105243_10085310 | 3300009148 | Bacteria | 2588 |
| 201 | Ga0105241_10035270 | 3300009174 | Bacteria | 3762 |
| 202 | Ga0105242_10122298 | 3300009176 | Bacteria | 2236 |
| 203 | Ga0105248_10000030 | 3300009177 | Bacteria | 206609 |
| 204 | Ga0105248_10000662 | 3300009177 | Bacteria | 39143 |
| 205 | Ga0105248_10027779 | 3300009177 | Bacteria | 6301 |
| 206 | Ga0105248_10043610 | 3300009177 | Bacteria | 5030 |
| 207 | Ga0105248_10143208 | 3300009177 | Bacteria | 2697 |
| 208 | Ga0105248_10283132 | 3300009177 | Bacteria | 1866 |
| 209 | Ga0105248_10320155 | 3300009177 | Bacteria | 1747 |
| 210 | Ga0105248_10371965 | 3300009177 | Bacteria | 1609 |
| 211 | Ga0105248_10707411 | 3300009177 | Bacteria | 1137 |
| 212 | Ga0105237_10006580 | 3300009545 | Bacteria | 12855 |
| 213 | Ga0105237_10067830 | 3300009545 | Bacteria | 3561 |
| 214 | Ga0105238_10006524 | 3300009551 | Bacteria | 11613 |
| 215 | Ga0105238_10053669 | 3300009551 | Bacteria | 4050 |
| 216 | Ga0105238_10138388 | 3300009551 | Bacteria | 2412 |
| 217 | Ga0105238_10957705 | 3300009551 | Bacteria | 876 |
| 218 | Ga0105238_10957706 | 3300009551 | Bacteria | 876 |
| 219 | Ga0105249_10000137 | 3300009553 | Bacteria | 95985 |
| 220 | Ga0105249_10000390 | 3300009553 | Bacteria | 42999 |
| 221 | Ga0105249_10007780 | 3300009553 | Bacteria | 9339 |
| 222 | Ga0105249_10183293 | 3300009553 | Bacteria | 2038 |
| 223 | Ga0105239_10012441 | 3300010375 | Bacteria | 9479 |
| 224 | Ga0105239_10322877 | 3300010375 | Unclassified | 1741 |
| 225 | Ga0157373_10083231 | 3300013100 | Bacteria | 2255 |
| 226 | Ga0157373_10342795 | 3300013100 | Bacteria | 1065 |
| 227 | Ga0157371_10010300 | 3300013102 | Bacteria | 7294 |
| 228 | Ga0157371_10063063 | 3300013102 | Bacteria | 2627 |
| 229 | Ga0157370_10060985 | 3300013104 | Bacteria | 3579 |
| 230 | Ga0157370_10213666 | 3300013104 | Bacteria | 1787 |
| 231 | Ga0157370_10342038 | 3300013104 | Bacteria | 1379 |
| 232 | Ga0157370_10346591 | 3300013104 | Bacteria | 1369 |
| 233 | Ga0157370_10353480 | 3300013104 | Bacteria | 1354 |
| 234 | Ga0157369_10053489 | 3300013105 | Bacteria | 4364 |
| 235 | Ga0157369_10060021 | 3300013105 | Bacteria | 4102 |
| 236 | Ga0157369_10087703 | 3300013105 | Bacteria | 3322 |
| 237 | Ga0157369_10631466 | 3300013105 | Bacteria | 1105 |
| 238 | Ga0157369_10908389 | 3300013105 | Bacteria | 903 |
| 239 | Ga0157378_10018423 | 3300013297 | Bacteria | 6131 |
| 240 | Ga0157378_10545740 | 3300013297 | Bacteria | 1164 |
| 241 | Ga0163162_10047411 | 3300013306 | Bacteria | 4306 |
| 242 | Ga0163162_10085773 | 3300013306 | Bacteria | 3226 |
| 243 | Ga0163162_10153079 | 3300013306 | Bacteria | 2424 |
| 244 | Ga0163162_10179430 | 3300013306 | Bacteria | 2243 |
| 245 | Ga0163162_10208314 | 3300013306 | Bacteria | 2084 |
| 246 | Ga0163162_10496668 | 3300013306 | Bacteria | 1351 |
| 247 | Ga0157372_10025303 | 3300013307 | Bacteria | 6451 |
| 248 | Ga0157372_10212139 | 3300013307 | Bacteria | 2244 |
| 249 | Ga0157375_10039075 | 3300013308 | Bacteria | 4563 |
| 250 | Ga0157375_10221373 | 3300013308 | Bacteria | 2051 |
| 251 | Ga0163163_10048624 | 3300014325 | Bacteria | 4171 |
| 252 | Ga0163163_10049520 | 3300014325 | Bacteria | 4136 |
| 253 | Ga0157380_10000130 | 3300014326 | Bacteria | 41786 |
| 254 | Ga0157380_10000276 | 3300014326 | Bacteria | 30816 |
| 255 | Ga0157380_10001012 | 3300014326 | Bacteria | 17871 |
| 256 | Ga0157380_10004675 | 3300014326 | Bacteria | 9531 |
| 257 | Ga0157380_10023921 | 3300014326 | Bacteria | 4616 |
| 258 | Ga0157377_10041819 | 3300014745 | Bacteria | 2544 |
| 259 | Ga0157379_10007527 | 3300014968 | Bacteria | 9426 |
| 260 | Ga0157379_10048531 | 3300014968 | Bacteria | 3789 |
| 261 | Ga0157376_10008531 | 3300014969 | Bacteria | 7401 |
| 262 | Ga0163161_10000718 | 3300017792 | Bacteria | 26157 |
| 263 | Ga0163161_10000723 | 3300017792 | Bacteria | 25974 |
| 264 | Ga0163161_10031070 | 3300017792 | Bacteria | 3803 |
| 265 | Ga0163161_10215557 | 3300017792 | Bacteria | 1484 |
| 266 | Ga0213874_10013842 | 3300021377 | Bacteria | 2099 |
| 267 | Ga0207672_1000583 | 3300025223 | Bacteria | 4435 |
| 268 | Ga0207697_10000595 | 3300025315 | Bacteria | 20569 |
| 269 | Ga0207697_10025200 | 3300025315 | Bacteria | 2432 |
| 270 | Ga0207697_10027436 | 3300025315 | Bacteria | 2327 |
| 271 | Ga0207656_10004664 | 3300025321 | Bacteria | 4802 |
| 272 | Ga0207656_10029168 | 3300025321 | Bacteria | 2270 |
| 273 | Ga0207713_1030856 | 3300025735 | Bacteria | 2380 |
| 274 | Ga0207682_10001140 | 3300025893 | Bacteria | 12312 |
| 275 | Ga0207710_10029782 | 3300025900 | Bacteria | 2378 |
| 276 | Ga0207710_10105106 | 3300025900 | Bacteria | 1336 |
| 277 | Ga0207688_10210920 | 3300025901 | Bacteria | 1167 |
| 278 | Ga0207680_10000081 | 3300025903 | Bacteria | 43007 |
| 279 | Ga0207680_10018306 | 3300025903 | Bacteria | 3721 |
| 280 | Ga0207647_10033782 | 3300025904 | Bacteria | 3271 |
| 281 | Ga0207647_10065007 | 3300025904 | Bacteria | 2215 |
| 282 | Ga0207645_10027573 | 3300025907 | Bacteria | 3667 |
| 283 | Ga0207705_10002277 | 3300025909 | Bacteria | 14851 |
| 284 | Ga0207705_10015211 | 3300025909 | Bacteria | 5528 |
| 285 | Ga0207705_10017957 | 3300025909 | Bacteria | 5059 |
| 286 | Ga0207705_10021128 | 3300025909 | Bacteria | 4643 |
| 287 | Ga0207705_10033698 | 3300025909 | Bacteria | 3659 |
| 288 | Ga0207705_10127862 | 3300025909 | Bacteria | 1889 |
| 289 | Ga0207654_10001441 | 3300025911 | Bacteria | 12612 |
| 290 | Ga0207654_10018673 | 3300025911 | Bacteria | 3643 |
| 291 | Ga0207707_10168717 | 3300025912 | Bacteria | 1913 |
| 292 | Ga0207695_10070959 | 3300025913 | Bacteria | 3559 |
| 293 | Ga0207695_10146879 | 3300025913 | Bacteria | 2301 |
| 294 | Ga0207671_10008068 | 3300025914 | Bacteria | 8996 |
| 295 | Ga0207671_10019862 | 3300025914 | Bacteria | 5128 |
| 296 | Ga0207671_10180695 | 3300025914 | Bacteria | 1642 |
| 297 | Ga0207657_10003139 | 3300025919 | Bacteria | 17676 |
| 298 | Ga0207657_10038683 | 3300025919 | Bacteria | 4244 |
| 299 | Ga0207657_10056177 | 3300025919 | Bacteria | 3397 |
| 300 | Ga0207657_10088189 | 3300025919 | Bacteria | 2594 |
| 301 | Ga0207657_10142302 | 3300025919 | Unclassified | 1959 |
| 302 | Ga0207649_10052336 | 3300025920 | Bacteria | 2533 |
| 303 | Ga0207649_10150387 | 3300025920 | Bacteria | 1603 |
| 304 | Ga0207649_10447580 | 3300025920 | Bacteria | 974 |
| 305 | Ga0207652_10250991 | 3300025921 | Bacteria | 1595 |
| 306 | Ga0207681_10000061 | 3300025923 | Bacteria | 102257 |
| 307 | Ga0207681_10000082 | 3300025923 | Bacteria | 84963 |
| 308 | Ga0207681_10001281 | 3300025923 | Bacteria | 16234 |
| 309 | Ga0207681_10108942 | 3300025923 | Bacteria | 2011 |
| 310 | Ga0207681_10305920 | 3300025923 | Bacteria | 1259 |
| 311 | Ga0207694_10006657 | 3300025924 | Bacteria | 8777 |
| 312 | Ga0207694_10008012 | 3300025924 | Bacteria | 7989 |
| 313 | Ga0207694_10025521 | 3300025924 | Bacteria | 4492 |
| 314 | Ga0207694_10254608 | 3300025924 | Bacteria | 1437 |
| 315 | Ga0207650_10000038 | 3300025925 | Bacteria | 206081 |
| 316 | Ga0207650_10000095 | 3300025925 | Bacteria | 116052 |
| 317 | Ga0207650_10000861 | 3300025925 | Bacteria | 23057 |
| 318 | Ga0207650_10000897 | 3300025925 | Bacteria | 22469 |
| 319 | Ga0207650_10082005 | 3300025925 | Bacteria | 2447 |
| 320 | Ga0207659_10004033 | 3300025926 | Bacteria | 8862 |
| 321 | Ga0207700_10206411 | 3300025928 | Bacteria | 1658 |
| 322 | Ga0207664_10328413 | 3300025929 | Bacteria | 1350 |
| 323 | Ga0207644_10000047 | 3300025931 | Bacteria | 103158 |
| 324 | Ga0207644_10001654 | 3300025931 | Bacteria | 14363 |
| 325 | Ga0207644_10002074 | 3300025931 | Bacteria | 12971 |
| 326 | Ga0207644_10002206 | 3300025931 | Bacteria | 12638 |
| 327 | Ga0207644_10003796 | 3300025931 | Bacteria | 9786 |
| 328 | Ga0207644_10028465 | 3300025931 | Bacteria | 3869 |
| 329 | Ga0207644_10042019 | 3300025931 | Bacteria | 3237 |
| 330 | Ga0207644_10215617 | 3300025931 | Bacteria | 1519 |
| 331 | Ga0207690_10060516 | 3300025932 | Bacteria | 2570 |
| 332 | Ga0207690_10067986 | 3300025932 | Bacteria | 2446 |
| 333 | Ga0207690_10072123 | 3300025932 | Bacteria | 2384 |
| 334 | Ga0207690_10135103 | 3300025932 | Bacteria | 1810 |
| 335 | Ga0207690_10175858 | 3300025932 | Bacteria | 1607 |
| 336 | Ga0207690_10529168 | 3300025932 | Bacteria | 956 |
| 337 | Ga0207706_10001065 | 3300025933 | Bacteria | 27880 |
| 338 | Ga0207706_10002092 | 3300025933 | Bacteria | 19526 |
| 339 | Ga0207706_10006146 | 3300025933 | Bacteria | 11151 |
| 340 | Ga0207706_10049700 | 3300025933 | Bacteria | 3705 |
| 341 | Ga0207706_10068243 | 3300025933 | Bacteria | 3129 |
| 342 | Ga0207686_10049887 | 3300025934 | Bacteria | 2600 |
| 343 | Ga0207709_10019687 | 3300025935 | Bacteria | 3799 |
| 344 | Ga0207670_10322390 | 3300025936 | Bacteria | 1216 |
| 345 | Ga0207669_10094646 | 3300025937 | Bacteria | 1955 |
| 346 | Ga0207669_10259693 | 3300025937 | Bacteria | 1298 |
| 347 | Ga0207665_10012224 | 3300025939 | Bacteria | 5638 |
| 348 | Ga0207691_10002271 | 3300025940 | Bacteria | 18831 |
| 349 | Ga0207691_10004006 | 3300025940 | Bacteria | 14287 |
| 350 | Ga0207691_10389506 | 3300025940 | Unclassified | 1189 |
| 351 | Ga0207711_10000029 | 3300025941 | Bacteria | 206826 |
| 352 | Ga0207711_10000254 | 3300025941 | Bacteria | 57648 |
| 353 | Ga0207711_10004526 | 3300025941 | Bacteria | 11836 |
| 354 | Ga0207711_10046418 | 3300025941 | Bacteria | 3711 |
| 355 | Ga0207711_10157542 | 3300025941 | Bacteria | 2053 |
| 356 | Ga0207661_10008596 | 3300025944 | Bacteria | 7297 |
| 357 | Ga0207661_10196889 | 3300025944 | Bacteria | 1769 |
| 358 | Ga0207679_10073625 | 3300025945 | Bacteria | 2585 |
| 359 | Ga0207679_10099501 | 3300025945 | Bacteria | 2271 |
| 360 | Ga0207679_10176992 | 3300025945 | Bacteria | 1762 |
| 361 | Ga0207679_10515156 | 3300025945 | Bacteria | 1069 |
| 362 | Ga0207667_10004100 | 3300025949 | Bacteria | 17907 |
| 363 | Ga0207667_10141917 | 3300025949 | Bacteria | 2473 |
| 364 | Ga0207667_10175962 | 3300025949 | Bacteria | 2198 |
| 365 | Ga0207651_10000766 | 3300025960 | Bacteria | 13825 |
| 366 | Ga0207651_10001642 | 3300025960 | Bacteria | 10273 |
| 367 | Ga0207651_10006978 | 3300025960 | Bacteria | 5979 |
| 368 | Ga0207651_10059332 | 3300025960 | Bacteria | 2650 |
| 369 | Ga0207712_10000335 | 3300025961 | Bacteria | 43007 |
| 370 | Ga0207712_10000734 | 3300025961 | Bacteria | 24952 |
| 371 | Ga0207712_10008869 | 3300025961 | Bacteria | 6357 |
| 372 | Ga0207712_10065333 | 3300025961 | Bacteria | 2596 |
| 373 | Ga0207668_10000009 | 3300025972 | Bacteria | 188071 |
| 374 | Ga0207668_10000651 | 3300025972 | Bacteria | 21279 |
| 375 | Ga0207668_10004813 | 3300025972 | Bacteria | 7945 |
| 376 | Ga0207668_10034946 | 3300025972 | Bacteria | 3342 |
| 377 | Ga0207668_10217044 | 3300025972 | Bacteria | 1533 |
| 378 | Ga0207668_10672098 | 3300025972 | Bacteria | 908 |
| 379 | Ga0207640_10009909 | 3300025981 | Bacteria | 5350 |
| 380 | Ga0207640_10030017 | 3300025981 | Bacteria | 3345 |
| 381 | Ga0207640_10033724 | 3300025981 | Bacteria | 3188 |
| 382 | Ga0207640_10334792 | 3300025981 | Bacteria | 1210 |
| 383 | Ga0207658_10000010 | 3300025986 | Bacteria | 240224 |
| 384 | Ga0207658_10000728 | 3300025986 | Bacteria | 28460 |
| 385 | Ga0207658_10001866 | 3300025986 | Bacteria | 15789 |
| 386 | Ga0207658_10004027 | 3300025986 | Bacteria | 10284 |
| 387 | Ga0207658_10018853 | 3300025986 | Bacteria | 4772 |
| 388 | Ga0207658_10067794 | 3300025986 | Bacteria | 2689 |
| 389 | Ga0207677_10021253 | 3300026023 | Bacteria | 3961 |
| 390 | Ga0207677_10234867 | 3300026023 | Bacteria | 1479 |
| 391 | Ga0207703_10000368 | 3300026035 | Bacteria | 48197 |
| 392 | Ga0207703_10000822 | 3300026035 | Bacteria | 30583 |
| 393 | Ga0207703_10002210 | 3300026035 | Bacteria | 17083 |
| 394 | Ga0207703_10013306 | 3300026035 | Bacteria | 6410 |
| 395 | Ga0207703_10015512 | 3300026035 | Bacteria | 5940 |
| 396 | Ga0207639_10000136 | 3300026041 | Bacteria | 54387 |
| 397 | Ga0207639_10025845 | 3300026041 | Bacteria | 4260 |
| 398 | Ga0207639_10109442 | 3300026041 | Bacteria | 2248 |
| 399 | Ga0207639_10231045 | 3300026041 | Bacteria | 1603 |
| 400 | Ga0207678_10021656 | 3300026067 | Bacteria | 5637 |
| 401 | Ga0207678_10226565 | 3300026067 | Bacteria | 1600 |
| 402 | Ga0207708_10122700 | 3300026075 | Bacteria | 2025 |
| 403 | Ga0207702_10008931 | 3300026078 | Bacteria | 8451 |
| 404 | Ga0207702_10105164 | 3300026078 | Bacteria | 2500 |
| 405 | Ga0207702_10120149 | 3300026078 | Bacteria | 2350 |
| 406 | Ga0207702_10244348 | 3300026078 | Bacteria | 1683 |
| 407 | Ga0207702_10260779 | 3300026078 | Bacteria | 1632 |
| 408 | Ga0207702_10291475 | 3300026078 | Bacteria | 1546 |
| 409 | Ga0207702_10704662 | 3300026078 | Bacteria | 995 |
| 410 | Ga0207641_10000017 | 3300026088 | Bacteria | 299119 |
| 411 | Ga0207641_10000073 | 3300026088 | Bacteria | 149989 |
| 412 | Ga0207641_10000914 | 3300026088 | Bacteria | 30517 |
| 413 | Ga0207641_10010624 | 3300026088 | Bacteria | 7556 |
| 414 | Ga0207641_10133438 | 3300026088 | Bacteria | 2232 |
| 415 | Ga0207648_10004534 | 3300026089 | Bacteria | 14239 |
| 416 | Ga0207648_10043202 | 3300026089 | Bacteria | 3957 |
| 417 | Ga0207676_10000034 | 3300026095 | Bacteria | 206058 |
| 418 | Ga0207676_10000037 | 3300026095 | Bacteria | 180826 |
| 419 | Ga0207676_10000193 | 3300026095 | Bacteria | 53147 |
| 420 | Ga0207676_10000781 | 3300026095 | Bacteria | 24823 |
| 421 | Ga0207676_10000956 | 3300026095 | Bacteria | 22336 |
| 422 | Ga0207676_10008378 | 3300026095 | Bacteria | 7348 |
| 423 | Ga0207676_10023450 | 3300026095 | Bacteria | 4553 |
| 424 | Ga0207676_10196790 | 3300026095 | Bacteria | 1778 |
| 425 | Ga0207676_10251517 | 3300026095 | Bacteria | 1591 |
| 426 | Ga0207674_10007312 | 3300026116 | Bacteria | 12867 |
| 427 | Ga0207674_10012221 | 3300026116 | Bacteria | 9604 |
| 428 | Ga0207674_10659374 | 3300026116 | Bacteria | 1010 |
| 429 | Ga0207675_100001462 | 3300026118 | Bacteria | 23681 |
| 430 | Ga0207675_100040755 | 3300026118 | Bacteria | 4337 |
| 431 | Ga0207675_100042095 | 3300026118 | Bacteria | 4263 |
| 432 | Ga0207683_10001298 | 3300026121 | Bacteria | 22583 |
| 433 | Ga0207683_10002767 | 3300026121 | Bacteria | 15321 |
| 434 | Ga0207698_10006770 | 3300026142 | Bacteria | 7163 |
| 435 | Ga0207698_10020877 | 3300026142 | Bacteria | 4518 |
| 436 | Ga0207698_10030281 | 3300026142 | Bacteria | 3889 |
| 437 | Ga0207698_10123678 | 3300026142 | Bacteria | 2195 |
| 438 | Ga0207698_10342017 | 3300026142 | Bacteria | 1410 |
| 439 | Ga0207698_10578732 | 3300026142 | Bacteria | 1104 |
| 440 | Ga0207698_10785461 | 3300026142 | Bacteria | 953 |
| 441 | Ga0207428_10217731 | 3300027907 | Bacteria | 1432 |
| 442 | Ga0268266_10000025 | 3300028379 | Bacteria | 477143 |
| 443 | Ga0268265_10000025 | 3300028380 | Bacteria | 250207 |
| 444 | Ga0268265_10000052 | 3300028380 | Bacteria | 174254 |
| 445 | Ga0268265_10000143 | 3300028380 | Bacteria | 90469 |
| 446 | Ga0268265_10000530 | 3300028380 | Bacteria | 38976 |
| 447 | Ga0268265_10006096 | 3300028380 | Bacteria | 8185 |
| 448 | Ga0268265_10064835 | 3300028380 | Bacteria | 2816 |
| 449 | Ga0268265_10099046 | 3300028380 | Bacteria | 2349 |
| 450 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 451 | Ga0268264_10000608 | 3300028381 | Bacteria | 43007 |
| 452 | Ga0268264_10025525 | 3300028381 | Bacteria | 4829 |
| 453 | Ga0268264_10208074 | 3300028381 | Bacteria | 1794 |
| 454 | Ga0268264_10797412 | 3300028381 | Bacteria | 943 |
| 455 | Ga0307408_100005910 | 3300031548 | Bacteria | 8150 |
| 456 | Ga0307408_100035719 | 3300031548 | Bacteria | 3489 |
| 457 | Ga0307408_100123881 | 3300031548 | Bacteria | 2006 |
| 458 | Ga0307408_100333102 | 3300031548 | Bacteria | 1282 |
| 459 | Ga0307408_100399680 | 3300031548 | Bacteria | 1179 |
| 460 | Ga0307405_10005862 | 3300031731 | Bacteria | 5983 |
| 461 | Ga0307405_10045552 | 3300031731 | Bacteria | 2689 |
| 462 | Ga0307405_10088678 | 3300031731 | Bacteria | 2041 |
| 463 | Ga0307405_10231098 | 3300031731 | Bacteria | 1363 |
| 464 | Ga0307405_10302276 | 3300031731 | Bacteria | 1214 |
| 465 | Ga0307405_10624558 | 3300031731 | Bacteria | 882 |
| 466 | Ga0307413_10015901 | 3300031824 | Bacteria | 3869 |
| 467 | Ga0307413_10018567 | 3300031824 | Bacteria | 3653 |
| 468 | Ga0307413_10044759 | 3300031824 | Bacteria | 2618 |
| 469 | Ga0307413_10068419 | 3300031824 | Bacteria | 2224 |
| 470 | Ga0307413_10235140 | 3300031824 | Bacteria | 1348 |
| 471 | Ga0307410_10022719 | 3300031852 | Bacteria | 3883 |
| 472 | Ga0307410_10110224 | 3300031852 | Bacteria | 1990 |
| 473 | Ga0307410_10141406 | 3300031852 | Bacteria | 1781 |
| 474 | Ga0307410_10147280 | 3300031852 | Bacteria | 1748 |
| 475 | Ga0307410_10255843 | 3300031852 | Bacteria | 1363 |
| 476 | Ga0307410_10727496 | 3300031852 | Bacteria | 838 |
| 477 | Ga0307406_10007016 | 3300031901 | Bacteria | 6235 |
| 478 | Ga0307406_10026461 | 3300031901 | Bacteria | 3485 |
| 479 | Ga0307406_10164763 | 3300031901 | Bacteria | 1598 |
| 480 | Ga0307407_10021209 | 3300031903 | Bacteria | 3345 |
| 481 | Ga0307407_10099103 | 3300031903 | Bacteria | 1804 |
| 482 | Ga0307407_10150550 | 3300031903 | Bacteria | 1511 |
| 483 | Ga0307407_10297281 | 3300031903 | Bacteria | 1124 |
| 484 | Ga0307407_10466523 | 3300031903 | Bacteria | 919 |
| 485 | Ga0307412_10004180 | 3300031911 | Bacteria | 8048 |
| 486 | Ga0307412_10017153 | 3300031911 | Bacteria | 4330 |
| 487 | Ga0307412_10039927 | 3300031911 | Bacteria | 3033 |
| 488 | Ga0307412_10151739 | 3300031911 | Bacteria | 1710 |
| 489 | Ga0307412_10156546 | 3300031911 | Bacteria | 1687 |
| 490 | Ga0307412_10260062 | 3300031911 | Bacteria | 1352 |
| 491 | Ga0307412_10403495 | 3300031911 | Bacteria | 1113 |
| 492 | Ga0307409_100001964 | 3300031995 | Bacteria | 10525 |
| 493 | Ga0307409_100033815 | 3300031995 | Bacteria | 3725 |
| 494 | Ga0307409_100046932 | 3300031995 | Bacteria | 3273 |
| 495 | Ga0307409_100233680 | 3300031995 | Bacteria | 1668 |
| 496 | Ga0307409_100274774 | 3300031995 | Bacteria | 1554 |
| 497 | Ga0307409_100501188 | 3300031995 | Bacteria | 1182 |
| 498 | Ga0307416_100002735 | 3300032002 | Bacteria | 10227 |
| 499 | Ga0307416_100031232 | 3300032002 | Bacteria | 4006 |
| 500 | Ga0307416_100180619 | 3300032002 | Bacteria | 1977 |
| 501 | Ga0307416_100441486 | 3300032002 | Bacteria | 1351 |
| 502 | Ga0307416_100947592 | 3300032002 | Bacteria | 962 |
| 503 | Ga0307414_10005925 | 3300032004 | Bacteria | 6768 |
| 504 | Ga0307414_10014456 | 3300032004 | Bacteria | 4733 |
| 505 | Ga0307414_10036275 | 3300032004 | Bacteria | 3290 |
| 506 | Ga0307414_10044582 | 3300032004 | Bacteria | 3030 |
| 507 | Ga0307414_10093402 | 3300032004 | Bacteria | 2242 |
| 508 | Ga0307414_10096252 | 3300032004 | Bacteria | 2214 |
| 509 | Ga0307414_10146174 | 3300032004 | Bacteria | 1858 |
| 510 | Ga0307414_10334283 | 3300032004 | Bacteria | 1294 |
| 511 | Ga0307411_10026749 | 3300032005 | Bacteria | 3477 |
| 512 | Ga0307411_10074928 | 3300032005 | Bacteria | 2308 |
| 513 | Ga0307411_10078996 | 3300032005 | Bacteria | 2257 |
| 514 | Ga0307411_10092391 | 3300032005 | Bacteria | 2116 |
| 515 | Ga0307411_10120924 | 3300032005 | Bacteria | 1894 |
| 516 | Ga0307411_10144163 | 3300032005 | Bacteria | 1760 |
| 517 | Ga0307411_10162531 | 3300032005 | Bacteria | 1674 |
| 518 | Ga0307411_10178897 | 3300032005 | Bacteria | 1607 |
| 519 | Ga0307411_10236189 | 3300032005 | Bacteria | 1428 |
| 520 | Ga0307411_10566448 | 3300032005 | Bacteria | 971 |
| 521 | Ga0307415_100024549 | 3300032126 | Bacteria | 3765 |
| 522 | Ga0307415_100127980 | 3300032126 | Bacteria | 1917 |
| 523 | Ga0307415_100973542 | 3300032126 | Bacteria | 787 |
| 524 | Ga0307510_10026690 | 3300033180 | Bacteria | 6633 |
| 525 | Ga0373943_0006799 | 3300035170 | Bacteria | 5132 |
| 526 | Ga0373955_0115154 | 3300035172 | Bacteria | 1558 |
| 527 | Ga0373935_0016502 | 3300035692 | Bacteria | 4468 |
| 528 | Ga0373927_0150149 | 3300035695 | Unclassified | 1526 |
| 529 | Ga0373937_0775769 | 3300036401 | Bacteria | 906 |
| 530 | Ga0373925_0052685 | 3300037068 | Bacteria | 3041 |
| 531 | Ga0395899_0009253 | 3300037312 | Bacteria | 7563 |
| 532 | Ga0395899_0042702 | 3300037312 | Bacteria | 3383 |
| 533 | Ga0395899_0046034 | 3300037312 | Bacteria | 3249 |
| 534 | Ga0395899_0068898 | 3300037312 | Bacteria | 2593 |
| 535 | Ga0395899_0248469 | 3300037312 | Bacteria | 1221 |
| 536 | Ga0395900_0000964 | 3300037418 | Bacteria | 37445 |
| 537 | Ga0395900_0013554 | 3300037418 | Bacteria | 8326 |
| 538 | Ga0395900_0027700 | 3300037418 | Bacteria | 5804 |
| 539 | Ga0395900_0199697 | 3300037418 | Bacteria | 2024 |
| 540 | Ga0395900_0217095 | 3300037418 | Bacteria | 1929 |
| 541 | Ga0395900_0313031 | 3300037418 | Bacteria | 1553 |
| 542 | Ga0395900_0517077 | 3300037418 | Bacteria | 1142 |
| 543 | Ga0395898_0022701 | 3300037466 | Bacteria | 6351 |
| 544 | Ga0395898_0124698 | 3300037466 | Bacteria | 2467 |
| 545 | Ga0395898_0194760 | 3300037466 | Bacteria | 1936 |
| 546 | Ga0395898_0252930 | 3300037466 | Bacteria | 1680 |
| 547 | Ga0395898_0292276 | 3300037466 | Bacteria | 1554 |
| 548 | Ga0395898_0982602 | 3300037466 | Bacteria | 780 |
| 549 | Ga0395905_0058159 | 3300037471 | Bacteria | 3616 |
| 550 | Ga0395905_0067234 | 3300037471 | Bacteria | 3357 |
| 551 | Ga0395905_0098859 | 3300037471 | Bacteria | 2740 |
| 552 | Ga0395905_0111624 | 3300037471 | Bacteria | 2567 |
| 553 | Ga0395905_0117965 | 3300037471 | Bacteria | 2494 |
| 554 | Ga0395905_0136652 | 3300037471 | Bacteria | 2306 |
| 555 | Ga0395905_0152137 | 3300037471 | Bacteria | 2176 |
| 556 | Ga0395905_0198861 | 3300037471 | Bacteria | 1879 |
| 557 | Ga0395905_0547021 | 3300037471 | Bacteria | 1059 |
| 558 | Ga0395905_0585715 | 3300037471 | Unclassified | 1017 |
| 559 | Ga0436364_0443678 | 3300037853 | Bacteria | 1304 |
| 560 | Ga0395901_0001061 | 3300038443 | Bacteria | 29546 |
| 561 | Ga0395901_0015808 | 3300038443 | Bacteria | 7690 |
| 562 | Ga0395901_0034086 | 3300038443 | Bacteria | 5257 |
| 563 | Ga0395901_0216806 | 3300038443 | Bacteria | 2001 |
| 564 | Ga0395901_0273210 | 3300038443 | Bacteria | 1757 |
| 565 | Ga0395901_0385091 | 3300038443 | Bacteria | 1443 |
| 566 | Ga0436363_0896344 | 3300039450 | Bacteria | 3063 |
| 567 | Ga0436363_1706034 | 3300039450 | Bacteria | 985 |
| 568 | Ga0451577_0128518 | 3300042876 | Bacteria | 2272 |
| 569 | Ga0451577_0207959 | 3300042876 | Unclassified | 1767 |
| 570 | Ga0466961_0078360 | 3300044693 | Bacteria | 2093 |
| 571 | Ga0466963_0012713 | 3300044694 | Bacteria | 5156 |
| 572 | Ga0466963_0042034 | 3300044694 | Bacteria | 3000 |
| 573 | Ga0466963_0084850 | 3300044694 | Bacteria | 2149 |
| 574 | Ga0466959_0254148 | 3300045049 | Bacteria | 1212 |
| 575 | Ga0466959_0295538 | 3300045049 | Bacteria | 1110 |
| 576 | Ga0451576_0022614 | 3300045051 | Bacteria | 6815 |
| 577 | Ga0451576_0184087 | 3300045051 | Bacteria | 2181 |
| 578 | Ga0466958_0326382 | 3300045836 | Bacteria | 987 |
| 579 | Ga0466967_0027105 | 3300045976 | Bacteria | 4761 |
| 580 | Ga0466967_0101872 | 3300045976 | Bacteria | 2625 |
| 581 | Ga0466967_0147945 | 3300045976 | Bacteria | 2192 |
| 582 | Ga0495583_0099442 | 3300046506 | Bacteria | 1243 |
| 583 | Ga0495606_0001464 | 3300046507 | Bacteria | 31526 |
| 584 | Ga0495637_0056169 | 3300046520 | Bacteria | 1630 |
| 585 | Ga0495643_0048100 | 3300046522 | Bacteria | 2307 |
| 586 | Ga0495643_0072685 | 3300046522 | Bacteria | 1803 |
| 587 | Ga0495648_0075240 | 3300046524 | Bacteria | 1943 |
| 588 | Ga0495648_0110136 | 3300046524 | Bacteria | 1500 |
| 589 | Ga0495663_0026908 | 3300046525 | Bacteria | 1685 |
| 590 | Ga0495663_0027919 | 3300046525 | Bacteria | 1659 |
| 591 | Ga0495654_0005164 | 3300046530 | Bacteria | 7616 |
| 592 | Ga0495598_0007650 | 3300046537 | Bacteria | 2486 |
| 593 | Ga0495621_0000770 | 3300046539 | Bacteria | 8118 |
| 594 | Ga0495621_0123445 | 3300046539 | Bacteria | 1002 |
| 595 | Ga0495597_0061300 | 3300046542 | Bacteria | 1639 |
| 596 | Ga0495633_0019904 | 3300046558 | Bacteria | 3386 |
| 597 | Ga0495668_0007229 | 3300046616 | Bacteria | 7125 |
| 598 | Ga0495668_0013009 | 3300046616 | Bacteria | 4924 |
| 599 | Ga0495668_0027327 | 3300046616 | Bacteria | 3233 |
| 600 | Ga0495625_0042424 | 3300046660 | Bacteria | 3306 |
| 601 | Ga0495625_0098269 | 3300046660 | Bacteria | 2014 |
| 602 | Ga0495659_0091401 | 3300046664 | Bacteria | 1169 |
| 603 | Ga0495659_0285464 | 3300046664 | Bacteria | 694 |
| 604 | Ga0495669_0032654 | 3300046684 | Bacteria | 2289 |
| 605 | Ga0495669_0034603 | 3300046684 | Bacteria | 2227 |
| 606 | Ga0495670_0000004 | 3300046691 | Bacteria | 310086 |
| 607 | Ga0495670_0002921 | 3300046691 | Bacteria | 8421 |
| 608 | Ga0495670_0024619 | 3300046691 | Bacteria | 2976 |
| 609 | Ga0495677_0034076 | 3300047445 | Bacteria | 1857 |
| 610 | Ga0495677_0133135 | 3300047445 | Bacteria | 952 |
| 611 | Ga0495677_0171494 | 3300047445 | Bacteria | 839 |
| 612 | Ga0495686_0001258 | 3300047472 | Bacteria | 28752 |
| 613 | Ga0495686_0001855 | 3300047472 | Bacteria | 21198 |
| 614 | Ga0495686_0005308 | 3300047472 | Bacteria | 10212 |
| 615 | Ga0496100_0429979 | 3300048903 | Unclassified | 1009 |
| 616 | Ga0496101_0003944 | 3300048904 | Bacteria | 9275 |
| 617 | Ga0496101_0165854 | 3300048904 | Bacteria | 1696 |
| 618 | Ga0496101_0389750 | 3300048904 | Bacteria | 1096 |
| 619 | Ga0496102_0000010 | 3300048905 | Bacteria | 324617 |
| 620 | Ga0496102_0042162 | 3300048905 | Bacteria | 4135 |
| 621 | Ga0496102_0077914 | 3300048905 | Bacteria | 3051 |
| 622 | Ga0496103_0000029 | 3300048906 | Bacteria | 213326 |
| 623 | Ga0496103_0001613 | 3300048906 | Bacteria | 14821 |
| 624 | Ga0496103_0382378 | 3300048906 | Unclassified | 904 |
| 625 | Ga0496104_0050732 | 3300048907 | Bacteria | 3915 |
| 626 | Ga0496104_0448340 | 3300048907 | Bacteria | 1202 |
| 627 | Ga0496105_0048846 | 3300048908 | Bacteria | 3493 |
| 628 | Ga0496105_0054789 | 3300048908 | Bacteria | 3292 |
| 629 | Ga0496105_0184534 | 3300048908 | Bacteria | 1707 |
| 630 | Ga0496106_0067686 | 3300048909 | Bacteria | 2723 |
| 631 | Ga0496107_0005406 | 3300048910 | Bacteria | 8741 |
| 632 | Ga0496107_0027803 | 3300048910 | Bacteria | 4018 |
| 633 | Ga0496108_0024681 | 3300048911 | Bacteria | 4951 |
| 634 | Ga0496108_0223420 | 3300048911 | Bacteria | 1636 |
| 635 | Ga0496109_0011644 | 3300048912 | Bacteria | 7563 |
| 636 | Ga0496109_0353468 | 3300048912 | Bacteria | 1388 |
| 637 | Ga0496109_0386608 | 3300048912 | Bacteria | 1322 |
| 638 | Ga0496109_0960554 | 3300048912 | Bacteria | 792 |
| 639 | Ga0496110_0015422 | 3300048913 | Bacteria | 6358 |
| 640 | Ga0496110_0029095 | 3300048913 | Bacteria | 4750 |
| 641 | Ga0496110_0155580 | 3300048913 | Bacteria | 2071 |
| 642 | Ga0496110_0201160 | 3300048913 | Bacteria | 1810 |
| 643 | Ga0496111_0013508 | 3300048914 | Bacteria | 5560 |
| 644 | Ga0496111_0046130 | 3300048914 | Bacteria | 3137 |
| 645 | Ga0496112_0022111 | 3300048915 | Bacteria | 6057 |
| 646 | Ga0496112_0036134 | 3300048915 | Bacteria | 4817 |
| 647 | Ga0496113_0010700 | 3300048916 | Bacteria | 6077 |
| 648 | Ga0496113_0029704 | 3300048916 | Bacteria | 3951 |
| 649 | Ga0496114_0260145 | 3300048917 | Bacteria | 1528 |
| 650 | Ga0496116_0003035 | 3300048919 | Bacteria | 16987 |
| 651 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 652 | Ga0496117_0005000 | 3300048920 | Bacteria | 14220 |
| 653 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 654 | Ga0496118_0000216 | 3300048921 | Bacteria | 100502 |
| 655 | Ga0496119_0030248 | 3300048922 | Bacteria | 3656 |
| 656 | Ga0496120_0132918 | 3300048923 | Bacteria | 1272 |
| 657 | Ga0496121_0018311 | 3300048924 | Bacteria | 7072 |
| 658 | Ga0496122_0305577 | 3300048925 | Bacteria | 855 |
| 659 | Ga0496123_0025909 | 3300048926 | Bacteria | 4407 |
| 660 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 661 | Ga0496124_0001292 | 3300048927 | Bacteria | 38002 |
| 662 | Ga0496124_0002507 | 3300048927 | Bacteria | 23886 |
| 663 | Ga0496124_0009995 | 3300048927 | Bacteria | 9688 |
| 664 | Ga0496126_0255449 | 3300048929 | Bacteria | 1459 |
| 665 | Ga0501032_0045189 | 3300049569 | Bacteria | 2980 |
| 666 | Ga0501036_0265314 | 3300049572 | Bacteria | 1438 |
| 667 | Ga0501043_0562122 | 3300049579 | Bacteria | 846 |
| 668 | Ga0501046_0261935 | 3300049580 | Bacteria | 1270 |
| 669 | Ga0501048_0112062 | 3300049582 | Bacteria | 1926 |
| 670 | Ga0501067_0071112 | 3300049583 | Bacteria | 1927 |
| 671 | Ga0501074_0195265 | 3300049590 | Bacteria | 1443 |
| 672 | Ga0501076_0102453 | 3300049592 | Bacteria | 2308 |
| 673 | Ga0501223_017236 | 3300049663 | Bacteria | 1425 |
| 674 | Ga0501080_0470016 | 3300049742 | Bacteria | 1126 |
| 675 | Ga0501270_006060 | 3300049767 | Bacteria | 1434 |
| 676 | Ga0501035_0294604 | 3300049822 | Bacteria | 1369 |
| 677 | Ga0501044_0044786 | 3300049823 | Bacteria | 4589 |
| 678 | nmdc:mga08y16_302064_c1 | 3300050511 | Bacteria | 1650 |
| 679 | Ga0495655_0000236 | 3300053083 | Bacteria | 10313 |
| 680 | Ga0500643_000478 | 3300053087 | Bacteria | 29274 |
| 681 | Ga0500643_018106 | 3300053087 | Bacteria | 2345 |
| 682 | Ga0500643_024690 | 3300053087 | Bacteria | 1904 |
| 683 | Ga0500651_0006612 | 3300053093 | Bacteria | 6701 |
| 684 | Ga0500562_043538 | 3300053108 | Bacteria | 1195 |
| 685 | Ga0500592_015980 | 3300053116 | Bacteria | 1205 |
| 686 | Ga0500642_0000714 | 3300053130 | Bacteria | 9811 |
| 687 | Ga0500655_000061 | 3300053133 | Bacteria | 29562 |
| 688 | Ga0500559_0010319 | 3300053136 | Bacteria | 4015 |
| 689 | Ga0500559_0068844 | 3300053136 | Bacteria | 1591 |
| 690 | Ga0500559_0149949 | 3300053136 | Bacteria | 1094 |
| 691 | Ga0500573_0000061 | 3300053140 | Bacteria | 67535 |
| 692 | Ga0500590_002284 | 3300053148 | Bacteria | 8422 |
| 693 | Ga0500616_0075480 | 3300053153 | Bacteria | 1706 |
| 694 | Ga0500622_0040895 | 3300053156 | Bacteria | 2413 |
| 695 | Ga0500627_0004783 | 3300053158 | Bacteria | 4404 |
| 696 | Ga0500639_032266 | 3300053163 | Bacteria | 2770 |
| 697 | Ga0500636_0240556 | 3300053177 | Bacteria | 930 |
| 698 | Ga0500570_001475 | 3300053724 | Bacteria | 10892 |
| 699 | Ga0501082_0526142 | 3300060353 | Unclassified | 1034 |
| 700 | Ga0466962_0124079 | 3300061719 | Bacteria | 1247 |
| 701 | Ga0530510_0063971 | 3300061734 | Bacteria | 2664 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025919 | Ga0207657_10003139 | Ga0207657_1000313912 | 214 |
| 2 | 3300005457 | Ga0070662_100237280 | Ga0070662_1002372802 | 215 |
| 3 | 3300005539 | Ga0068853_100379080 | Ga0068853_1003790802 | 215 |
| 4 | 3300013104 | Ga0157370_10353480 | Ga0157370_103534802 | 215 |
| 5 | 3300025949 | Ga0207667_10141917 | Ga0207667_101419173 | 215 |
| 6 | 3300045049 | Ga0466959_0254148 | Ga0466959_0254148_343_1044 | 215 |
| 7 | 3300005355 | Ga0070671_100062948 | Ga0070671_1000629483 | 217 |
| 8 | 3300005535 | Ga0070684_100333746 | Ga0070684_1003337462 | 217 |
| 9 | 3300005564 | Ga0070664_100447642 | Ga0070664_1004476421 | 217 |
| 10 | 3300025932 | Ga0207690_10529168 | Ga0207690_105291682 | 217 |
| 11 | 3300025944 | Ga0207661_10008596 | Ga0207661_100085965 | 217 |
| 12 | 3300025945 | Ga0207679_10073625 | Ga0207679_100736252 | 217 |
| 13 | 3300026116 | Ga0207674_10012221 | Ga0207674_100122217 | 217 |
| 14 | 3300031995 | Ga0307409_100274774 | Ga0307409_1002747741 | 217 |
| 15 | 3300032126 | Ga0307415_100127980 | Ga0307415_1001279802 | 217 |
| 16 | 3300046664 | Ga0495659_0285464 | Ga0495659_0285464_25_684 | 219 |
| 17 | 3300046524 | Ga0495648_0110136 | Ga0495648_0110136_807_1472 | 220 |
| 18 | 3300049579 | Ga0501043_0562122 | Ga0501043_0562122_31_693 | 220 |
| 19 | 3300025315 | Ga0207697_10025200 | Ga0207697_100252002 | 222 |
| 20 | 3300005293 | Ga0065715_10422059 | Ga0065715_104220591 | 224 |
| 21 | iso_pu_bacteria | 2885427238 | 2885428873 | 229 |
| 22 | 3300025937 | Ga0207669_10094646 | Ga0207669_100946463 | 230 |
| 23 | iso_pu_bacteria | 2830075706 | 2830076759 | 230 |
| 24 | iso_pu_bacteria | 2990265787 | 2990267758 | 230 |
| 25 | iso_pu_bacteria | 2993693658 | 2993695001 | 230 |
| 26 | iso_pu_bacteria | 2599185359 | 2600226396 | 231 |
| 27 | iso_pu_bacteria | 2818991466 | 2819712622 | 231 |
| 28 | iso_pu_bacteria | 2879163058 | 2879164575 | 231 |
| 29 | iso_pu_bacteria | 2928027323 | 2928027759 | 231 |
| 30 | iso_pu_bacteria | 2928526807 | 2928527217 | 231 |
| 31 | iso_pu_bacteria | 2928968154 | 2928969297 | 231 |
| 32 | iso_pu_bacteria | 2984564862 | 2984567686 | 231 |
| 33 | iso_pu_bacteria | 8057101203 | 8057103705 | 231 |
| 34 | 3300005843 | Ga0068860_100236451 | Ga0068860_1002364512 | 232 |
| 35 | 3300006931 | Ga0097620_100038608 | Ga0097620_1000386085 | 232 |
| 36 | 3300009101 | Ga0105247_10128225 | Ga0105247_101282252 | 232 |
| 37 | 3300009177 | Ga0105248_10043610 | Ga0105248_100436102 | 232 |
| 38 | 3300025900 | Ga0207710_10029782 | Ga0207710_100297822 | 232 |
| 39 | 3300028381 | Ga0268264_10797412 | Ga0268264_107974122 | 232 |
| 40 | 3300001977 | JGI24746J21847_1000985 | JGI24746J21847_10009854 | 233 |
| 41 | 3300001989 | JGI24739J22299_10007504 | JGI24739J22299_100075045 | 233 |
| 42 | 3300001989 | JGI24739J22299_10037287 | JGI24739J22299_100372871 | 233 |
| 43 | 3300001990 | JGI24737J22298_10000929 | JGI24737J22298_100009292 | 233 |
| 44 | 3300002076 | JGI24749J21850_1003838 | JGI24749J21850_10038382 | 233 |
| 45 | 3300002155 | JGI24033J26618_1007065 | JGI24033J26618_10070652 | 233 |
| 46 | 3300002239 | JGI24034J26672_10010937 | JGI24034J26672_100109372 | 233 |
| 47 | 3300005293 | Ga0065715_10000860 | Ga0065715_1000086011 | 233 |
| 48 | 3300005327 | Ga0070658_10041850 | Ga0070658_100418504 | 233 |
| 49 | 3300005328 | Ga0070676_10024298 | Ga0070676_100242983 | 233 |
| 50 | 3300005330 | Ga0070690_100003881 | Ga0070690_1000038812 | 233 |
| 51 | 3300005331 | Ga0070670_100001686 | Ga0070670_10000168613 | 233 |
| 52 | 3300005331 | Ga0070670_100021229 | Ga0070670_1000212296 | 233 |
| 53 | 3300005333 | Ga0070677_10002154 | Ga0070677_100021542 | 233 |
| 54 | 3300005338 | Ga0068868_100023218 | Ga0068868_1000232182 | 233 |
| 55 | 3300005339 | Ga0070660_100017906 | Ga0070660_1000179065 | 233 |
| 56 | 3300005339 | Ga0070660_100027908 | Ga0070660_1000279084 | 233 |
| 57 | 3300005339 | Ga0070660_100038152 | Ga0070660_1000381522 | 233 |
| 58 | 3300005339 | Ga0070660_100067331 | Ga0070660_1000673314 | 233 |
| 59 | 3300005344 | Ga0070661_100015664 | Ga0070661_1000156644 | 233 |
| 60 | 3300005347 | Ga0070668_100001607 | Ga0070668_10000160711 | 233 |
| 61 | 3300005353 | Ga0070669_100001322 | Ga0070669_1000013228 | 233 |
| 62 | 3300005353 | Ga0070669_100327200 | Ga0070669_1003272002 | 233 |
| 63 | 3300005354 | Ga0070675_100001353 | Ga0070675_10000135312 | 233 |
| 64 | 3300005354 | Ga0070675_100959047 | Ga0070675_1009590471 | 233 |
| 65 | 3300005355 | Ga0070671_100011279 | Ga0070671_1000112795 | 233 |
| 66 | 3300005355 | Ga0070671_100012896 | Ga0070671_1000128962 | 233 |
| 67 | 3300005355 | Ga0070671_100015271 | Ga0070671_1000152712 | 233 |
| 68 | 3300005356 | Ga0070674_100027724 | Ga0070674_1000277244 | 233 |
| 69 | 3300005356 | Ga0070674_100172317 | Ga0070674_1001723172 | 233 |
| 70 | 3300005364 | Ga0070673_100001125 | Ga0070673_1000011256 | 233 |
| 71 | 3300005364 | Ga0070673_100006322 | Ga0070673_1000063225 | 233 |
| 72 | 3300005366 | Ga0070659_100049850 | Ga0070659_1000498502 | 233 |
| 73 | 3300005366 | Ga0070659_100125598 | Ga0070659_1001255982 | 233 |
| 74 | 3300005366 | Ga0070659_100941139 | Ga0070659_1009411391 | 233 |
| 75 | 3300005367 | Ga0070667_100005432 | Ga0070667_1000054324 | 233 |
| 76 | 3300005367 | Ga0070667_100011171 | Ga0070667_1000111713 | 233 |
| 77 | 3300005435 | Ga0070714_100156476 | Ga0070714_1001564762 | 233 |
| 78 | 3300005436 | Ga0070713_100129476 | Ga0070713_1001294762 | 233 |
| 79 | 3300005436 | Ga0070713_100210091 | Ga0070713_1002100912 | 233 |
| 80 | 3300005455 | Ga0070663_100010813 | Ga0070663_1000108132 | 233 |
| 81 | 3300005455 | Ga0070663_100122143 | Ga0070663_1001221432 | 233 |
| 82 | 3300005456 | Ga0070678_100028839 | Ga0070678_1000288392 | 233 |
| 83 | 3300005456 | Ga0070678_100046580 | Ga0070678_1000465802 | 233 |
| 84 | 3300005457 | Ga0070662_100000741 | Ga0070662_10000074111 | 233 |
| 85 | 3300005457 | Ga0070662_100002121 | Ga0070662_1000021214 | 233 |
| 86 | 3300005457 | Ga0070662_100139437 | Ga0070662_1001394372 | 233 |
| 87 | 3300005459 | Ga0068867_100050084 | Ga0068867_1000500842 | 233 |
| 88 | 3300005539 | Ga0068853_100072666 | Ga0068853_1000726661 | 233 |
| 89 | 3300005539 | Ga0068853_100568877 | Ga0068853_1005688772 | 233 |
| 90 | 3300005543 | Ga0070672_100008666 | Ga0070672_1000086662 | 233 |
| 91 | 3300005544 | Ga0070686_100016476 | Ga0070686_1000164764 | 233 |
| 92 | 3300005548 | Ga0070665_100097517 | Ga0070665_1000975174 | 233 |
| 93 | 3300005564 | Ga0070664_100055951 | Ga0070664_1000559513 | 233 |
| 94 | 3300005577 | Ga0068857_100083933 | Ga0068857_1000839332 | 233 |
| 95 | 3300005578 | Ga0068854_100037269 | Ga0068854_1000372694 | 233 |
| 96 | 3300005614 | Ga0068856_100131804 | Ga0068856_1001318042 | 233 |
| 97 | 3300005614 | Ga0068856_100167170 | Ga0068856_1001671703 | 233 |
| 98 | 3300005615 | Ga0070702_100243359 | Ga0070702_1002433592 | 233 |
| 99 | 3300005616 | Ga0068852_100038258 | Ga0068852_1000382585 | 233 |
| 100 | 3300005617 | Ga0068859_100004899 | Ga0068859_1000048998 | 233 |
| 101 | 3300005617 | Ga0068859_100047437 | Ga0068859_1000474373 | 233 |
| 102 | 3300005618 | Ga0068864_100038921 | Ga0068864_1000389212 | 233 |
| 103 | 3300005618 | Ga0068864_100864567 | Ga0068864_1008645671 | 233 |
| 104 | 3300005718 | Ga0068866_10027614 | Ga0068866_100276142 | 233 |
| 105 | 3300005718 | Ga0068866_10292850 | Ga0068866_102928502 | 233 |
| 106 | 3300005834 | Ga0068851_10012912 | Ga0068851_100129123 | 233 |
| 107 | 3300005841 | Ga0068863_100029535 | Ga0068863_1000295356 | 233 |
| 108 | 3300005842 | Ga0068858_100094471 | Ga0068858_1000944712 | 233 |
| 109 | 3300005843 | Ga0068860_100091147 | Ga0068860_1000911472 | 233 |
| 110 | 3300005844 | Ga0068862_100004294 | Ga0068862_1000042948 | 233 |
| 111 | 3300005844 | Ga0068862_100030889 | Ga0068862_1000308894 | 233 |
| 112 | 3300005844 | Ga0068862_100126154 | Ga0068862_1001261543 | 233 |
| 113 | 3300006028 | Ga0070717_10498722 | Ga0070717_104987221 | 233 |
| 114 | 3300006237 | Ga0097621_100008240 | Ga0097621_1000082407 | 233 |
| 115 | 3300006881 | Ga0068865_100009906 | Ga0068865_1000099066 | 233 |
| 116 | 3300006881 | Ga0068865_100076748 | Ga0068865_1000767482 | 233 |
| 117 | 3300006931 | Ga0097620_100004899 | Ga0097620_1000048998 | 233 |
| 118 | 3300006931 | Ga0097620_100047436 | Ga0097620_1000474363 | 233 |
| 119 | 3300009094 | Ga0111539_10357984 | Ga0111539_103579842 | 233 |
| 120 | 3300009098 | Ga0105245_10021056 | Ga0105245_100210564 | 233 |
| 121 | 3300009148 | Ga0105243_10053958 | Ga0105243_100539583 | 233 |
| 122 | 3300009148 | Ga0105243_10085310 | Ga0105243_100853102 | 233 |
| 123 | 3300009176 | Ga0105242_10122298 | Ga0105242_101222982 | 233 |
| 124 | 3300009177 | Ga0105248_10027779 | Ga0105248_100277796 | 233 |
| 125 | 3300009177 | Ga0105248_10320155 | Ga0105248_103201552 | 233 |
| 126 | 3300009177 | Ga0105248_10707411 | Ga0105248_107074111 | 233 |
| 127 | 3300009551 | Ga0105238_10053669 | Ga0105238_100536694 | 233 |
| 128 | 3300009553 | Ga0105249_10007780 | Ga0105249_100077808 | 233 |
| 129 | 3300010375 | Ga0105239_10322877 | Ga0105239_103228772 | 233 |
| 130 | 3300013100 | Ga0157373_10083231 | Ga0157373_100832312 | 233 |
| 131 | 3300013105 | Ga0157369_10053489 | Ga0157369_100534894 | 233 |
| 132 | 3300013105 | Ga0157369_10631466 | Ga0157369_106314662 | 233 |
| 133 | 3300013297 | Ga0157378_10545740 | Ga0157378_105457402 | 233 |
| 134 | 3300013306 | Ga0163162_10047411 | Ga0163162_100474113 | 233 |
| 135 | 3300013306 | Ga0163162_10208314 | Ga0163162_102083142 | 233 |
| 136 | 3300013308 | Ga0157375_10039075 | Ga0157375_100390756 | 233 |
| 137 | 3300013308 | Ga0157375_10221373 | Ga0157375_102213733 | 233 |
| 138 | 3300014326 | Ga0157380_10001012 | Ga0157380_1000101213 | 233 |
| 139 | 3300014326 | Ga0157380_10004675 | Ga0157380_100046758 | 233 |
| 140 | 3300014745 | Ga0157377_10041819 | Ga0157377_100418193 | 233 |
| 141 | 3300014968 | Ga0157379_10048531 | Ga0157379_100485313 | 233 |
| 142 | 3300014969 | Ga0157376_10008531 | Ga0157376_100085316 | 233 |
| 143 | 3300017792 | Ga0163161_10031070 | Ga0163161_100310702 | 233 |
| 144 | 3300017792 | Ga0163161_10215557 | Ga0163161_102155572 | 233 |
| 145 | 3300025315 | Ga0207697_10000595 | Ga0207697_1000059513 | 233 |
| 146 | 3300025321 | Ga0207656_10029168 | Ga0207656_100291682 | 233 |
| 147 | 3300025893 | Ga0207682_10001140 | Ga0207682_100011406 | 233 |
| 148 | 3300025901 | Ga0207688_10210920 | Ga0207688_102109201 | 233 |
| 149 | 3300025904 | Ga0207647_10065007 | Ga0207647_100650072 | 233 |
| 150 | 3300025907 | Ga0207645_10027573 | Ga0207645_100275732 | 233 |
| 151 | 3300025909 | Ga0207705_10002277 | Ga0207705_1000227715 | 233 |
| 152 | 3300025909 | Ga0207705_10017957 | Ga0207705_100179572 | 233 |
| 153 | 3300025909 | Ga0207705_10033698 | Ga0207705_100336983 | 233 |
| 154 | 3300025909 | Ga0207705_10127862 | Ga0207705_101278622 | 233 |
| 155 | 3300025919 | Ga0207657_10038683 | Ga0207657_100386834 | 233 |
| 156 | 3300025919 | Ga0207657_10056177 | Ga0207657_100561772 | 233 |
| 157 | 3300025919 | Ga0207657_10142302 | Ga0207657_101423022 | 233 |
| 158 | 3300025920 | Ga0207649_10052336 | Ga0207649_100523362 | 233 |
| 159 | 3300025920 | Ga0207649_10447580 | Ga0207649_104475801 | 233 |
| 160 | 3300025923 | Ga0207681_10001281 | Ga0207681_1000128111 | 233 |
| 161 | 3300025923 | Ga0207681_10305920 | Ga0207681_103059202 | 233 |
| 162 | 3300025925 | Ga0207650_10000897 | Ga0207650_1000089712 | 233 |
| 163 | 3300025925 | Ga0207650_10082005 | Ga0207650_100820053 | 233 |
| 164 | 3300025926 | Ga0207659_10004033 | Ga0207659_100040336 | 233 |
| 165 | 3300025928 | Ga0207700_10206411 | Ga0207700_102064112 | 233 |
| 166 | 3300025929 | Ga0207664_10328413 | Ga0207664_103284132 | 233 |
| 167 | 3300025931 | Ga0207644_10001654 | Ga0207644_100016544 | 233 |
| 168 | 3300025931 | Ga0207644_10002074 | Ga0207644_100020749 | 233 |
| 169 | 3300025931 | Ga0207644_10042019 | Ga0207644_100420193 | 233 |
| 170 | 3300025931 | Ga0207644_10215617 | Ga0207644_102156172 | 233 |
| 171 | 3300025932 | Ga0207690_10067986 | Ga0207690_100679861 | 233 |
| 172 | 3300025932 | Ga0207690_10135103 | Ga0207690_101351032 | 233 |
| 173 | 3300025933 | Ga0207706_10001065 | Ga0207706_100010659 | 233 |
| 174 | 3300025933 | Ga0207706_10002092 | Ga0207706_100020926 | 233 |
| 175 | 3300025933 | Ga0207706_10006146 | Ga0207706_100061466 | 233 |
| 176 | 3300025934 | Ga0207686_10049887 | Ga0207686_100498873 | 233 |
| 177 | 3300025937 | Ga0207669_10259693 | Ga0207669_102596932 | 233 |
| 178 | 3300025939 | Ga0207665_10012224 | Ga0207665_100122245 | 233 |
| 179 | 3300025940 | Ga0207691_10002271 | Ga0207691_100022717 | 233 |
| 180 | 3300025940 | Ga0207691_10004006 | Ga0207691_1000400614 | 233 |
| 181 | 3300025941 | Ga0207711_10004526 | Ga0207711_100045264 | 233 |
| 182 | 3300025941 | Ga0207711_10046418 | Ga0207711_100464182 | 233 |
| 183 | 3300025945 | Ga0207679_10176992 | Ga0207679_101769921 | 233 |
| 184 | 3300025945 | Ga0207679_10515156 | Ga0207679_105151562 | 233 |
| 185 | 3300025960 | Ga0207651_10000766 | Ga0207651_100007664 | 233 |
| 186 | 3300025960 | Ga0207651_10001642 | Ga0207651_1000164210 | 233 |
| 187 | 3300025960 | Ga0207651_10006978 | Ga0207651_100069782 | 233 |
| 188 | 3300025961 | Ga0207712_10008869 | Ga0207712_100088695 | 233 |
| 189 | 3300025972 | Ga0207668_10000651 | Ga0207668_1000065115 | 233 |
| 190 | 3300025972 | Ga0207668_10034946 | Ga0207668_100349464 | 233 |
| 191 | 3300025972 | Ga0207668_10672098 | Ga0207668_106720981 | 233 |
| 192 | 3300025981 | Ga0207640_10030017 | Ga0207640_100300171 | 233 |
| 193 | 3300025986 | Ga0207658_10018853 | Ga0207658_100188535 | 233 |
| 194 | 3300025986 | Ga0207658_10067794 | Ga0207658_100677943 | 233 |
| 195 | 3300026023 | Ga0207677_10021253 | Ga0207677_100212533 | 233 |
| 196 | 3300026023 | Ga0207677_10234867 | Ga0207677_102348671 | 233 |
| 197 | 3300026035 | Ga0207703_10013306 | Ga0207703_100133063 | 233 |
| 198 | 3300026035 | Ga0207703_10015512 | Ga0207703_100155123 | 233 |
| 199 | 3300026041 | Ga0207639_10109442 | Ga0207639_101094422 | 233 |
| 200 | 3300026067 | Ga0207678_10226565 | Ga0207678_102265652 | 233 |
| 201 | 3300026075 | Ga0207708_10122700 | Ga0207708_101227002 | 233 |
| 202 | 3300026078 | Ga0207702_10120149 | Ga0207702_101201493 | 233 |
| 203 | 3300026078 | Ga0207702_10244348 | Ga0207702_102443482 | 233 |
| 204 | 3300026078 | Ga0207702_10260779 | Ga0207702_102607792 | 233 |
| 205 | 3300026078 | Ga0207702_10291475 | Ga0207702_102914751 | 233 |
| 206 | 3300026089 | Ga0207648_10004534 | Ga0207648_100045347 | 233 |
| 207 | 3300026089 | Ga0207648_10043202 | Ga0207648_100432024 | 233 |
| 208 | 3300026095 | Ga0207676_10008378 | Ga0207676_100083785 | 233 |
| 209 | 3300026095 | Ga0207676_10196790 | Ga0207676_101967902 | 233 |
| 210 | 3300026095 | Ga0207676_10251517 | Ga0207676_102515172 | 233 |
| 211 | 3300026118 | Ga0207675_100040755 | Ga0207675_1000407553 | 233 |
| 212 | 3300026121 | Ga0207683_10001298 | Ga0207683_1000129814 | 233 |
| 213 | 3300026121 | Ga0207683_10002767 | Ga0207683_100027675 | 233 |
| 214 | 3300026142 | Ga0207698_10030281 | Ga0207698_100302813 | 233 |
| 215 | 3300026142 | Ga0207698_10578732 | Ga0207698_105787321 | 233 |
| 216 | 3300027907 | Ga0207428_10217731 | Ga0207428_102177312 | 233 |
| 217 | 3300028380 | Ga0268265_10006096 | Ga0268265_100060967 | 233 |
| 218 | 3300028380 | Ga0268265_10064835 | Ga0268265_100648353 | 233 |
| 219 | 3300028380 | Ga0268265_10099046 | Ga0268265_100990461 | 233 |
| 220 | 3300028381 | Ga0268264_10025525 | Ga0268264_100255252 | 233 |
| 221 | 3300028381 | Ga0268264_10208074 | Ga0268264_102080742 | 233 |
| 222 | 3300031548 | Ga0307408_100005910 | Ga0307408_1000059103 | 233 |
| 223 | 3300031548 | Ga0307408_100123881 | Ga0307408_1001238812 | 233 |
| 224 | 3300031548 | Ga0307408_100333102 | Ga0307408_1003331021 | 233 |
| 225 | 3300031548 | Ga0307408_100399680 | Ga0307408_1003996802 | 233 |
| 226 | 3300031731 | Ga0307405_10005862 | Ga0307405_100058622 | 233 |
| 227 | 3300031731 | Ga0307405_10045552 | Ga0307405_100455522 | 233 |
| 228 | 3300031731 | Ga0307405_10088678 | Ga0307405_100886782 | 233 |
| 229 | 3300031731 | Ga0307405_10231098 | Ga0307405_102310982 | 233 |
| 230 | 3300031731 | Ga0307405_10302276 | Ga0307405_103022762 | 233 |
| 231 | 3300031731 | Ga0307405_10624558 | Ga0307405_106245581 | 233 |
| 232 | 3300031824 | Ga0307413_10015901 | Ga0307413_100159014 | 233 |
| 233 | 3300031824 | Ga0307413_10018567 | Ga0307413_100185673 | 233 |
| 234 | 3300031824 | Ga0307413_10044759 | Ga0307413_100447593 | 233 |
| 235 | 3300031824 | Ga0307413_10068419 | Ga0307413_100684191 | 233 |
| 236 | 3300031824 | Ga0307413_10235140 | Ga0307413_102351402 | 233 |
| 237 | 3300031852 | Ga0307410_10022719 | Ga0307410_100227192 | 233 |
| 238 | 3300031852 | Ga0307410_10110224 | Ga0307410_101102242 | 233 |
| 239 | 3300031852 | Ga0307410_10141406 | Ga0307410_101414062 | 233 |
| 240 | 3300031852 | Ga0307410_10147280 | Ga0307410_101472801 | 233 |
| 241 | 3300031852 | Ga0307410_10255843 | Ga0307410_102558432 | 233 |
| 242 | 3300031852 | Ga0307410_10727496 | Ga0307410_107274961 | 233 |
| 243 | 3300031901 | Ga0307406_10007016 | Ga0307406_100070165 | 233 |
| 244 | 3300031901 | Ga0307406_10026461 | Ga0307406_100264612 | 233 |
| 245 | 3300031901 | Ga0307406_10164763 | Ga0307406_101647632 | 233 |
| 246 | 3300031903 | Ga0307407_10021209 | Ga0307407_100212094 | 233 |
| 247 | 3300031903 | Ga0307407_10099103 | Ga0307407_100991032 | 233 |
| 248 | 3300031903 | Ga0307407_10150550 | Ga0307407_101505502 | 233 |
| 249 | 3300031903 | Ga0307407_10297281 | Ga0307407_102972811 | 233 |
| 250 | 3300031903 | Ga0307407_10466523 | Ga0307407_104665231 | 233 |
| 251 | 3300031911 | Ga0307412_10004180 | Ga0307412_100041802 | 233 |
| 252 | 3300031911 | Ga0307412_10156546 | Ga0307412_101565461 | 233 |
| 253 | 3300031911 | Ga0307412_10260062 | Ga0307412_102600621 | 233 |
| 254 | 3300031911 | Ga0307412_10403495 | Ga0307412_104034952 | 233 |
| 255 | 3300031995 | Ga0307409_100001964 | Ga0307409_1000019648 | 233 |
| 256 | 3300031995 | Ga0307409_100033815 | Ga0307409_1000338152 | 233 |
| 257 | 3300031995 | Ga0307409_100046932 | Ga0307409_1000469322 | 233 |
| 258 | 3300031995 | Ga0307409_100233680 | Ga0307409_1002336801 | 233 |
| 259 | 3300031995 | Ga0307409_100501188 | Ga0307409_1005011882 | 233 |
| 260 | 3300032002 | Ga0307416_100002735 | Ga0307416_1000027352 | 233 |
| 261 | 3300032002 | Ga0307416_100031232 | Ga0307416_1000312323 | 233 |
| 262 | 3300032002 | Ga0307416_100441486 | Ga0307416_1004414862 | 233 |
| 263 | 3300032002 | Ga0307416_100947592 | Ga0307416_1009475922 | 233 |
| 264 | 3300032004 | Ga0307414_10005925 | Ga0307414_100059253 | 233 |
| 265 | 3300032004 | Ga0307414_10014456 | Ga0307414_100144562 | 233 |
| 266 | 3300032004 | Ga0307414_10036275 | Ga0307414_100362752 | 233 |
| 267 | 3300032004 | Ga0307414_10044582 | Ga0307414_100445823 | 233 |
| 268 | 3300032004 | Ga0307414_10093402 | Ga0307414_100934022 | 233 |
| 269 | 3300032004 | Ga0307414_10096252 | Ga0307414_100962522 | 233 |
| 270 | 3300032004 | Ga0307414_10146174 | Ga0307414_101461742 | 233 |
| 271 | 3300032004 | Ga0307414_10334283 | Ga0307414_103342831 | 233 |
| 272 | 3300032005 | Ga0307411_10026749 | Ga0307411_100267493 | 233 |
| 273 | 3300032005 | Ga0307411_10074928 | Ga0307411_100749282 | 233 |
| 274 | 3300032005 | Ga0307411_10078996 | Ga0307411_100789964 | 233 |
| 275 | 3300032005 | Ga0307411_10092391 | Ga0307411_100923912 | 233 |
| 276 | 3300032005 | Ga0307411_10120924 | Ga0307411_101209243 | 233 |
| 277 | 3300032005 | Ga0307411_10144163 | Ga0307411_101441633 | 233 |
| 278 | 3300032005 | Ga0307411_10162531 | Ga0307411_101625312 | 233 |
| 279 | 3300032005 | Ga0307411_10178897 | Ga0307411_101788972 | 233 |
| 280 | 3300032005 | Ga0307411_10236189 | Ga0307411_102361891 | 233 |
| 281 | 3300032005 | Ga0307411_10566448 | Ga0307411_105664482 | 233 |
| 282 | 3300032126 | Ga0307415_100024549 | Ga0307415_1000245493 | 233 |
| 283 | 3300032126 | Ga0307415_100973542 | Ga0307415_1009735421 | 233 |
| 284 | 3300035170 | Ga0373943_0006799 | Ga0373943_0006799_2445_3146 | 233 |
| 285 | 3300035172 | Ga0373955_0115154 | Ga0373955_0115154_281_982 | 233 |
| 286 | 3300035692 | Ga0373935_0016502 | Ga0373935_0016502_3716_4417 | 233 |
| 287 | 3300035695 | Ga0373927_0150149 | Ga0373927_0150149_792_1493 | 233 |
| 288 | 3300036401 | Ga0373937_0775769 | Ga0373937_0775769_46_747 | 233 |
| 289 | 3300037068 | Ga0373925_0052685 | Ga0373925_0052685_2229_2930 | 233 |
| 290 | 3300037312 | Ga0395899_0042702 | Ga0395899_0042702_741_1442 | 233 |
| 291 | 3300037312 | Ga0395899_0068898 | Ga0395899_0068898_452_1153 | 233 |
| 292 | 3300037312 | Ga0395899_0248469 | Ga0395899_0248469_324_1025 | 233 |
| 293 | 3300037418 | Ga0395900_0199697 | Ga0395900_0199697_703_1404 | 233 |
| 294 | 3300037418 | Ga0395900_0217095 | Ga0395900_0217095_1070_1771 | 233 |
| 295 | 3300037418 | Ga0395900_0313031 | Ga0395900_0313031_91_792 | 233 |
| 296 | 3300037418 | Ga0395900_0517077 | Ga0395900_0517077_161_862 | 233 |
| 297 | 3300037466 | Ga0395898_0124698 | Ga0395898_0124698_834_1535 | 233 |
| 298 | 3300037466 | Ga0395898_0194760 | Ga0395898_0194760_180_881 | 233 |
| 299 | 3300037466 | Ga0395898_0252930 | Ga0395898_0252930_659_1360 | 233 |
| 300 | 3300037466 | Ga0395898_0982602 | Ga0395898_0982602_25_726 | 233 |
| 301 | 3300037471 | Ga0395905_0058159 | Ga0395905_0058159_2776_3477 | 233 |
| 302 | 3300037471 | Ga0395905_0067234 | Ga0395905_0067234_2196_2897 | 233 |
| 303 | 3300037471 | Ga0395905_0111624 | Ga0395905_0111624_996_1721 | 233 |
| 304 | 3300037471 | Ga0395905_0117965 | Ga0395905_0117965_806_1507 | 233 |
| 305 | 3300037471 | Ga0395905_0152137 | Ga0395905_0152137_543_1244 | 233 |
| 306 | 3300037471 | Ga0395905_0198861 | Ga0395905_0198861_532_1233 | 233 |
| 307 | 3300037471 | Ga0395905_0547021 | Ga0395905_0547021_25_726 | 233 |
| 308 | 3300037471 | Ga0395905_0585715 | Ga0395905_0585715_243_944 | 233 |
| 309 | 3300038443 | Ga0395901_0216806 | Ga0395901_0216806_967_1668 | 233 |
| 310 | 3300038443 | Ga0395901_0273210 | Ga0395901_0273210_973_1674 | 233 |
| 311 | 3300038443 | Ga0395901_0385091 | Ga0395901_0385091_401_1102 | 233 |
| 312 | 3300042876 | Ga0451577_0128518 | Ga0451577_0128518_987_1688 | 233 |
| 313 | 3300042876 | Ga0451577_0207959 | Ga0451577_0207959_223_927 | 233 |
| 314 | 3300044693 | Ga0466961_0078360 | Ga0466961_0078360_754_1455 | 233 |
| 315 | 3300044694 | Ga0466963_0084850 | Ga0466963_0084850_416_1117 | 233 |
| 316 | 3300045049 | Ga0466959_0295538 | Ga0466959_0295538_242_943 | 233 |
| 317 | 3300045051 | Ga0451576_0022614 | Ga0451576_0022614_4138_4845 | 233 |
| 318 | 3300045051 | Ga0451576_0184087 | Ga0451576_0184087_734_1435 | 233 |
| 319 | 3300045836 | Ga0466958_0326382 | Ga0466958_0326382_76_777 | 233 |
| 320 | 3300045976 | Ga0466967_0101872 | Ga0466967_0101872_1153_1854 | 233 |
| 321 | 3300046507 | Ga0495606_0001464 | Ga0495606_0001464_13737_14438 | 233 |
| 322 | 3300046525 | Ga0495663_0026908 | Ga0495663_0026908_18_719 | 233 |
| 323 | 3300046537 | Ga0495598_0007650 | Ga0495598_0007650_1454_2155 | 233 |
| 324 | 3300046539 | Ga0495621_0000770 | Ga0495621_0000770_2873_3574 | 233 |
| 325 | 3300046539 | Ga0495621_0123445 | Ga0495621_0123445_289_990 | 233 |
| 326 | 3300046558 | Ga0495633_0019904 | Ga0495633_0019904_2133_2834 | 233 |
| 327 | 3300046664 | Ga0495659_0091401 | Ga0495659_0091401_425_1126 | 233 |
| 328 | 3300046684 | Ga0495669_0032654 | Ga0495669_0032654_310_1011 | 233 |
| 329 | 3300046684 | Ga0495669_0034603 | Ga0495669_0034603_470_1171 | 233 |
| 330 | 3300046691 | Ga0495670_0002921 | Ga0495670_0002921_2076_2777 | 233 |
| 331 | 3300046691 | Ga0495670_0024619 | Ga0495670_0024619_1235_1936 | 233 |
| 332 | 3300047445 | Ga0495677_0133135 | Ga0495677_0133135_113_814 | 233 |
| 333 | 3300047445 | Ga0495677_0171494 | Ga0495677_0171494_121_822 | 233 |
| 334 | 3300047472 | Ga0495686_0001258 | Ga0495686_0001258_17659_18363 | 233 |
| 335 | 3300047472 | Ga0495686_0001855 | Ga0495686_0001855_8809_9510 | 233 |
| 336 | 3300047472 | Ga0495686_0005308 | Ga0495686_0005308_4003_4707 | 233 |
| 337 | 3300048903 | Ga0496100_0429979 | Ga0496100_0429979_59_760 | 233 |
| 338 | 3300048904 | Ga0496101_0003944 | Ga0496101_0003944_3172_3873 | 233 |
| 339 | 3300048904 | Ga0496101_0165854 | Ga0496101_0165854_747_1448 | 233 |
| 340 | 3300048905 | Ga0496102_0077914 | Ga0496102_0077914_1957_2658 | 233 |
| 341 | 3300048906 | Ga0496103_0382378 | Ga0496103_0382378_149_850 | 233 |
| 342 | 3300048907 | Ga0496104_0448340 | Ga0496104_0448340_149_850 | 233 |
| 343 | 3300048908 | Ga0496105_0048846 | Ga0496105_0048846_228_929 | 233 |
| 344 | 3300048910 | Ga0496107_0005406 | Ga0496107_0005406_4631_5332 | 233 |
| 345 | 3300048911 | Ga0496108_0024681 | Ga0496108_0024681_2755_3456 | 233 |
| 346 | 3300048911 | Ga0496108_0223420 | Ga0496108_0223420_611_1312 | 233 |
| 347 | 3300048912 | Ga0496109_0353468 | Ga0496109_0353468_615_1316 | 233 |
| 348 | 3300048912 | Ga0496109_0386608 | Ga0496109_0386608_135_836 | 233 |
| 349 | 3300048913 | Ga0496110_0015422 | Ga0496110_0015422_2769_3470 | 233 |
| 350 | 3300048913 | Ga0496110_0029095 | Ga0496110_0029095_3207_3908 | 233 |
| 351 | 3300048914 | Ga0496111_0013508 | Ga0496111_0013508_3194_3895 | 233 |
| 352 | 3300048914 | Ga0496111_0046130 | Ga0496111_0046130_278_979 | 233 |
| 353 | 3300048915 | Ga0496112_0022111 | Ga0496112_0022111_2763_3464 | 233 |
| 354 | 3300048915 | Ga0496112_0036134 | Ga0496112_0036134_3480_4181 | 233 |
| 355 | 3300048916 | Ga0496113_0010700 | Ga0496113_0010700_2379_3080 | 233 |
| 356 | 3300048917 | Ga0496114_0260145 | Ga0496114_0260145_732_1433 | 233 |
| 357 | 3300049663 | Ga0501223_017236 | Ga0501223_017236_252_953 | 233 |
| 358 | 3300049767 | Ga0501270_006060 | Ga0501270_006060_419_1120 | 233 |
| 359 | 3300050511 | nmdc:mga08y16_302064_c1 | nmdc:mga08y16_302064_c1_488_1189 | 233 |
| 360 | 3300053136 | Ga0500559_0010319 | Ga0500559_0010319_619_1323 | 233 |
| 361 | 3300053153 | Ga0500616_0075480 | Ga0500616_0075480_864_1565 | 233 |
| 362 | 3300061719 | Ga0466962_0124079 | Ga0466962_0124079_259_960 | 233 |
| 363 | 3300001904 | JGI24736J21556_1001406 | JGI24736J21556_10014066 | 234 |
| 364 | 3300001915 | JGI24741J21665_1003224 | JGI24741J21665_10032242 | 234 |
| 365 | 3300001976 | JGI24752J21851_1000080 | JGI24752J21851_10000808 | 234 |
| 366 | 3300001976 | JGI24752J21851_1000160 | JGI24752J21851_100016010 | 234 |
| 367 | 3300001979 | JGI24740J21852_10005926 | JGI24740J21852_100059264 | 234 |
| 368 | 3300001989 | JGI24739J22299_10033310 | JGI24739J22299_100333103 | 234 |
| 369 | 3300001990 | JGI24737J22298_10007765 | JGI24737J22298_100077652 | 234 |
| 370 | 3300002070 | JGI24750J21931_1001069 | JGI24750J21931_10010692 | 234 |
| 371 | 3300002074 | JGI24748J21848_1000013 | JGI24748J21848_100001312 | 234 |
| 372 | 3300002075 | JGI24738J21930_10001426 | JGI24738J21930_100014265 | 234 |
| 373 | 3300002075 | JGI24738J21930_10004835 | JGI24738J21930_100048352 | 234 |
| 374 | 3300002076 | JGI24749J21850_1000099 | JGI24749J21850_100009913 | 234 |
| 375 | 3300002076 | JGI24749J21850_1005832 | JGI24749J21850_10058322 | 234 |
| 376 | 3300002239 | JGI24034J26672_10000011 | JGI24034J26672_1000001189 | 234 |
| 377 | 3300002244 | JGI24742J22300_10005410 | JGI24742J22300_100054102 | 234 |
| 378 | 3300002459 | JGI24751J29686_10000542 | JGI24751J29686_100005424 | 234 |
| 379 | 3300002459 | JGI24751J29686_10022337 | JGI24751J29686_100223372 | 234 |
| 380 | 3300003323 | rootH1_10352848 | rootH1_103528483 | 234 |
| 381 | 3300005289 | Ga0065704_10077371 | Ga0065704_100773715 | 234 |
| 382 | 3300005295 | Ga0065707_10000450 | Ga0065707_1000045039 | 234 |
| 383 | 3300005295 | Ga0065707_10105218 | Ga0065707_101052182 | 234 |
| 384 | 3300005327 | Ga0070658_10003485 | Ga0070658_100034858 | 234 |
| 385 | 3300005327 | Ga0070658_10051923 | Ga0070658_100519234 | 234 |
| 386 | 3300005327 | Ga0070658_10101506 | Ga0070658_101015062 | 234 |
| 387 | 3300005329 | Ga0070683_100004273 | Ga0070683_1000042737 | 234 |
| 388 | 3300005330 | Ga0070690_100000003 | Ga0070690_1000000033 | 234 |
| 389 | 3300005331 | Ga0070670_100000014 | Ga0070670_100000014132 | 234 |
| 390 | 3300005331 | Ga0070670_100000047 | Ga0070670_10000004779 | 234 |
| 391 | 3300005331 | Ga0070670_100003161 | Ga0070670_10000316111 | 234 |
| 392 | 3300005331 | Ga0070670_100046115 | Ga0070670_1000461154 | 234 |
| 393 | 3300005331 | Ga0070670_100141122 | Ga0070670_1001411222 | 234 |
| 394 | 3300005335 | Ga0070666_10000176 | Ga0070666_100001764 | 234 |
| 395 | 3300005335 | Ga0070666_10008520 | Ga0070666_100085204 | 234 |
| 396 | 3300005338 | Ga0068868_100459188 | Ga0068868_1004591881 | 234 |
| 397 | 3300005339 | Ga0070660_100100055 | Ga0070660_1001000552 | 234 |
| 398 | 3300005340 | Ga0070689_100198125 | Ga0070689_1001981252 | 234 |
| 399 | 3300005344 | Ga0070661_100056713 | Ga0070661_1000567133 | 234 |
| 400 | 3300005344 | Ga0070661_100123275 | Ga0070661_1001232752 | 234 |
| 401 | 3300005344 | Ga0070661_100211894 | Ga0070661_1002118942 | 234 |
| 402 | 3300005347 | Ga0070668_100000001 | Ga0070668_100000001126 | 234 |
| 403 | 3300005347 | Ga0070668_100005405 | Ga0070668_1000054057 | 234 |
| 404 | 3300005347 | Ga0070668_100238676 | Ga0070668_1002386762 | 234 |
| 405 | 3300005353 | Ga0070669_100000014 | Ga0070669_10000001486 | 234 |
| 406 | 3300005353 | Ga0070669_100000072 | Ga0070669_10000007250 | 234 |
| 407 | 3300005353 | Ga0070669_100023481 | Ga0070669_1000234812 | 234 |
| 408 | 3300005355 | Ga0070671_100000106 | Ga0070671_10000010634 | 234 |
| 409 | 3300005355 | Ga0070671_100016773 | Ga0070671_1000167733 | 234 |
| 410 | 3300005356 | Ga0070674_100313601 | Ga0070674_1003136012 | 234 |
| 411 | 3300005364 | Ga0070673_100162680 | Ga0070673_1001626802 | 234 |
| 412 | 3300005365 | Ga0070688_100000740 | Ga0070688_1000007401 | 234 |
| 413 | 3300005366 | Ga0070659_100038333 | Ga0070659_1000383332 | 234 |
| 414 | 3300005366 | Ga0070659_100191885 | Ga0070659_1001918852 | 234 |
| 415 | 3300005367 | Ga0070667_100000006 | Ga0070667_100000006167 | 234 |
| 416 | 3300005367 | Ga0070667_100000144 | Ga0070667_10000014467 | 234 |
| 417 | 3300005367 | Ga0070667_100010339 | Ga0070667_1000103395 | 234 |
| 418 | 3300005367 | Ga0070667_100012958 | Ga0070667_1000129583 | 234 |
| 419 | 3300005455 | Ga0070663_100074477 | Ga0070663_1000744773 | 234 |
| 420 | 3300005457 | Ga0070662_100136878 | Ga0070662_1001368783 | 234 |
| 421 | 3300005466 | Ga0070685_10000034 | Ga0070685_1000003449 | 234 |
| 422 | 3300005530 | Ga0070679_100459015 | Ga0070679_1004590152 | 234 |
| 423 | 3300005535 | Ga0070684_100000841 | Ga0070684_10000084115 | 234 |
| 424 | 3300005535 | Ga0070684_100204313 | Ga0070684_1002043132 | 234 |
| 425 | 3300005539 | Ga0068853_100024201 | Ga0068853_1000242013 | 234 |
| 426 | 3300005539 | Ga0068853_100115983 | Ga0068853_1001159833 | 234 |
| 427 | 3300005543 | Ga0070672_100231577 | Ga0070672_1002315771 | 234 |
| 428 | 3300005544 | Ga0070686_100000023 | Ga0070686_10000002333 | 234 |
| 429 | 3300005548 | Ga0070665_100000019 | Ga0070665_100000019419 | 234 |
| 430 | 3300005548 | Ga0070665_100445744 | Ga0070665_1004457442 | 234 |
| 431 | 3300005563 | Ga0068855_100472023 | Ga0068855_1004720232 | 234 |
| 432 | 3300005577 | Ga0068857_100059516 | Ga0068857_1000595163 | 234 |
| 433 | 3300005577 | Ga0068857_100104890 | Ga0068857_1001048902 | 234 |
| 434 | 3300005577 | Ga0068857_100499871 | Ga0068857_1004998712 | 234 |
| 435 | 3300005578 | Ga0068854_100031128 | Ga0068854_1000311282 | 234 |
| 436 | 3300005578 | Ga0068854_100303659 | Ga0068854_1003036592 | 234 |
| 437 | 3300005616 | Ga0068852_100011677 | Ga0068852_1000116778 | 234 |
| 438 | 3300005616 | Ga0068852_100014143 | Ga0068852_1000141437 | 234 |
| 439 | 3300005616 | Ga0068852_100143339 | Ga0068852_1001433392 | 234 |
| 440 | 3300005617 | Ga0068859_100012629 | Ga0068859_1000126295 | 234 |
| 441 | 3300005617 | Ga0068859_100018286 | Ga0068859_1000182863 | 234 |
| 442 | 3300005617 | Ga0068859_100060005 | Ga0068859_1000600054 | 234 |
| 443 | 3300005617 | Ga0068859_100186610 | Ga0068859_1001866102 | 234 |
| 444 | 3300005618 | Ga0068864_100000021 | Ga0068864_100000021143 | 234 |
| 445 | 3300005618 | Ga0068864_100000051 | Ga0068864_10000005179 | 234 |
| 446 | 3300005618 | Ga0068864_100000306 | Ga0068864_10000030610 | 234 |
| 447 | 3300005618 | Ga0068864_100001847 | Ga0068864_10000184714 | 234 |
| 448 | 3300005618 | Ga0068864_100002997 | Ga0068864_1000029977 | 234 |
| 449 | 3300005719 | Ga0068861_100003101 | Ga0068861_1000031013 | 234 |
| 450 | 3300005719 | Ga0068861_100111784 | Ga0068861_1001117842 | 234 |
| 451 | 3300005841 | Ga0068863_100000009 | Ga0068863_100000009150 | 234 |
| 452 | 3300005841 | Ga0068863_100000044 | Ga0068863_100000044119 | 234 |
| 453 | 3300005841 | Ga0068863_100001228 | Ga0068863_1000012285 | 234 |
| 454 | 3300005841 | Ga0068863_100141123 | Ga0068863_1001411232 | 234 |
| 455 | 3300005842 | Ga0068858_100000555 | Ga0068858_10000055527 | 234 |
| 456 | 3300005842 | Ga0068858_100012260 | Ga0068858_1000122603 | 234 |
| 457 | 3300005843 | Ga0068860_100000074 | Ga0068860_1000000748 | 234 |
| 458 | 3300005843 | Ga0068860_100000601 | Ga0068860_1000006014 | 234 |
| 459 | 3300005844 | Ga0068862_100000017 | Ga0068862_100000017146 | 234 |
| 460 | 3300005844 | Ga0068862_100000036 | Ga0068862_100000036120 | 234 |
| 461 | 3300005844 | Ga0068862_100000700 | Ga0068862_1000007005 | 234 |
| 462 | 3300005844 | Ga0068862_100001801 | Ga0068862_1000018013 | 234 |
| 463 | 3300005937 | Ga0081455_10000244 | Ga0081455_1000024417 | 234 |
| 464 | 3300006358 | Ga0068871_100225210 | Ga0068871_1002252103 | 234 |
| 465 | 3300006931 | Ga0097620_100012629 | Ga0097620_1000126293 | 234 |
| 466 | 3300006931 | Ga0097620_100018286 | Ga0097620_1000182863 | 234 |
| 467 | 3300006931 | Ga0097620_100060006 | Ga0097620_1000600062 | 234 |
| 468 | 3300006931 | Ga0097620_100186601 | Ga0097620_1001866012 | 234 |
| 469 | 3300009011 | Ga0105251_10000507 | Ga0105251_1000050738 | 234 |
| 470 | 3300009101 | Ga0105247_10084611 | Ga0105247_100846112 | 234 |
| 471 | 3300009174 | Ga0105241_10035270 | Ga0105241_100352702 | 234 |
| 472 | 3300009177 | Ga0105248_10000030 | Ga0105248_1000003066 | 234 |
| 473 | 3300009177 | Ga0105248_10000662 | Ga0105248_1000066219 | 234 |
| 474 | 3300009177 | Ga0105248_10143208 | Ga0105248_101432082 | 234 |
| 475 | 3300009177 | Ga0105248_10283132 | Ga0105248_102831322 | 234 |
| 476 | 3300009177 | Ga0105248_10371965 | Ga0105248_103719652 | 234 |
| 477 | 3300009545 | Ga0105237_10006580 | Ga0105237_100065803 | 234 |
| 478 | 3300009545 | Ga0105237_10067830 | Ga0105237_100678302 | 234 |
| 479 | 3300009551 | Ga0105238_10006524 | Ga0105238_1000652410 | 234 |
| 480 | 3300009551 | Ga0105238_10138388 | Ga0105238_101383882 | 234 |
| 481 | 3300009551 | Ga0105238_10957705 | Ga0105238_109577051 | 234 |
| 482 | 3300009551 | Ga0105238_10957706 | Ga0105238_109577061 | 234 |
| 483 | 3300009553 | Ga0105249_10000137 | Ga0105249_1000013781 | 234 |
| 484 | 3300009553 | Ga0105249_10000390 | Ga0105249_1000039034 | 234 |
| 485 | 3300009553 | Ga0105249_10183293 | Ga0105249_101832932 | 234 |
| 486 | 3300010375 | Ga0105239_10012441 | Ga0105239_100124412 | 234 |
| 487 | 3300013100 | Ga0157373_10342795 | Ga0157373_103427952 | 234 |
| 488 | 3300013102 | Ga0157371_10010300 | Ga0157371_100103007 | 234 |
| 489 | 3300013102 | Ga0157371_10063063 | Ga0157371_100630634 | 234 |
| 490 | 3300013104 | Ga0157370_10060985 | Ga0157370_100609855 | 234 |
| 491 | 3300013104 | Ga0157370_10213666 | Ga0157370_102136663 | 234 |
| 492 | 3300013104 | Ga0157370_10342038 | Ga0157370_103420382 | 234 |
| 493 | 3300013104 | Ga0157370_10346591 | Ga0157370_103465911 | 234 |
| 494 | 3300013105 | Ga0157369_10060021 | Ga0157369_100600212 | 234 |
| 495 | 3300013105 | Ga0157369_10087703 | Ga0157369_100877032 | 234 |
| 496 | 3300013105 | Ga0157369_10908389 | Ga0157369_109083892 | 234 |
| 497 | 3300013297 | Ga0157378_10018423 | Ga0157378_100184234 | 234 |
| 498 | 3300013306 | Ga0163162_10085773 | Ga0163162_100857732 | 234 |
| 499 | 3300013306 | Ga0163162_10153079 | Ga0163162_101530792 | 234 |
| 500 | 3300013306 | Ga0163162_10179430 | Ga0163162_101794302 | 234 |
| 501 | 3300013306 | Ga0163162_10496668 | Ga0163162_104966682 | 234 |
| 502 | 3300013307 | Ga0157372_10025303 | Ga0157372_100253037 | 234 |
| 503 | 3300013307 | Ga0157372_10212139 | Ga0157372_102121391 | 234 |
| 504 | 3300014325 | Ga0163163_10048624 | Ga0163163_100486242 | 234 |
| 505 | 3300014325 | Ga0163163_10049520 | Ga0163163_100495201 | 234 |
| 506 | 3300014326 | Ga0157380_10000130 | Ga0157380_1000013014 | 234 |
| 507 | 3300014326 | Ga0157380_10000276 | Ga0157380_100002769 | 234 |
| 508 | 3300014326 | Ga0157380_10023921 | Ga0157380_100239214 | 234 |
| 509 | 3300014968 | Ga0157379_10007527 | Ga0157379_100075275 | 234 |
| 510 | 3300017792 | Ga0163161_10000718 | Ga0163161_100007183 | 234 |
| 511 | 3300017792 | Ga0163161_10000723 | Ga0163161_1000072316 | 234 |
| 512 | 3300021377 | Ga0213874_10013842 | Ga0213874_100138421 | 234 |
| 513 | 3300025223 | Ga0207672_1000583 | Ga0207672_10005833 | 234 |
| 514 | 3300025315 | Ga0207697_10027436 | Ga0207697_100274362 | 234 |
| 515 | 3300025321 | Ga0207656_10004664 | Ga0207656_100046644 | 234 |
| 516 | 3300025735 | Ga0207713_1030856 | Ga0207713_10308562 | 234 |
| 517 | 3300025900 | Ga0207710_10105106 | Ga0207710_101051061 | 234 |
| 518 | 3300025903 | Ga0207680_10000081 | Ga0207680_1000008134 | 234 |
| 519 | 3300025903 | Ga0207680_10018306 | Ga0207680_100183062 | 234 |
| 520 | 3300025904 | Ga0207647_10033782 | Ga0207647_100337824 | 234 |
| 521 | 3300025909 | Ga0207705_10015211 | Ga0207705_100152115 | 234 |
| 522 | 3300025909 | Ga0207705_10021128 | Ga0207705_100211282 | 234 |
| 523 | 3300025911 | Ga0207654_10001441 | Ga0207654_1000144112 | 234 |
| 524 | 3300025911 | Ga0207654_10018673 | Ga0207654_100186732 | 234 |
| 525 | 3300025912 | Ga0207707_10168717 | Ga0207707_101687172 | 234 |
| 526 | 3300025913 | Ga0207695_10070959 | Ga0207695_100709594 | 234 |
| 527 | 3300025913 | Ga0207695_10146879 | Ga0207695_101468793 | 234 |
| 528 | 3300025914 | Ga0207671_10008068 | Ga0207671_1000806810 | 234 |
| 529 | 3300025914 | Ga0207671_10019862 | Ga0207671_100198627 | 234 |
| 530 | 3300025914 | Ga0207671_10180695 | Ga0207671_101806952 | 234 |
| 531 | 3300025919 | Ga0207657_10088189 | Ga0207657_100881894 | 234 |
| 532 | 3300025920 | Ga0207649_10150387 | Ga0207649_101503871 | 234 |
| 533 | 3300025921 | Ga0207652_10250991 | Ga0207652_102509912 | 234 |
| 534 | 3300025923 | Ga0207681_10000061 | Ga0207681_1000006145 | 234 |
| 535 | 3300025923 | Ga0207681_10000082 | Ga0207681_1000008210 | 234 |
| 536 | 3300025923 | Ga0207681_10108942 | Ga0207681_101089422 | 234 |
| 537 | 3300025924 | Ga0207694_10006657 | Ga0207694_100066572 | 234 |
| 538 | 3300025924 | Ga0207694_10008012 | Ga0207694_100080126 | 234 |
| 539 | 3300025924 | Ga0207694_10025521 | Ga0207694_100255213 | 234 |
| 540 | 3300025924 | Ga0207694_10254608 | Ga0207694_102546082 | 234 |
| 541 | 3300025925 | Ga0207650_10000038 | Ga0207650_1000003818 | 234 |
| 542 | 3300025925 | Ga0207650_10000095 | Ga0207650_1000009590 | 234 |
| 543 | 3300025925 | Ga0207650_10000861 | Ga0207650_1000086111 | 234 |
| 544 | 3300025931 | Ga0207644_10000047 | Ga0207644_1000004773 | 234 |
| 545 | 3300025931 | Ga0207644_10002206 | Ga0207644_100022065 | 234 |
| 546 | 3300025931 | Ga0207644_10003796 | Ga0207644_100037963 | 234 |
| 547 | 3300025931 | Ga0207644_10028465 | Ga0207644_100284652 | 234 |
| 548 | 3300025932 | Ga0207690_10060516 | Ga0207690_100605162 | 234 |
| 549 | 3300025932 | Ga0207690_10072123 | Ga0207690_100721233 | 234 |
| 550 | 3300025932 | Ga0207690_10175858 | Ga0207690_101758582 | 234 |
| 551 | 3300025933 | Ga0207706_10049700 | Ga0207706_100497002 | 234 |
| 552 | 3300025933 | Ga0207706_10068243 | Ga0207706_100682433 | 234 |
| 553 | 3300025935 | Ga0207709_10019687 | Ga0207709_100196872 | 234 |
| 554 | 3300025936 | Ga0207670_10322390 | Ga0207670_103223902 | 234 |
| 555 | 3300025940 | Ga0207691_10389506 | Ga0207691_103895061 | 234 |
| 556 | 3300025941 | Ga0207711_10000029 | Ga0207711_1000002966 | 234 |
| 557 | 3300025941 | Ga0207711_10000254 | Ga0207711_1000025424 | 234 |
| 558 | 3300025941 | Ga0207711_10157542 | Ga0207711_101575422 | 234 |
| 559 | 3300025944 | Ga0207661_10196889 | Ga0207661_101968892 | 234 |
| 560 | 3300025945 | Ga0207679_10099501 | Ga0207679_100995012 | 234 |
| 561 | 3300025949 | Ga0207667_10004100 | Ga0207667_1000410017 | 234 |
| 562 | 3300025949 | Ga0207667_10175962 | Ga0207667_101759622 | 234 |
| 563 | 3300025960 | Ga0207651_10059332 | Ga0207651_100593323 | 234 |
| 564 | 3300025961 | Ga0207712_10000335 | Ga0207712_1000033534 | 234 |
| 565 | 3300025961 | Ga0207712_10000734 | Ga0207712_1000073415 | 234 |
| 566 | 3300025961 | Ga0207712_10065333 | Ga0207712_100653332 | 234 |
| 567 | 3300025972 | Ga0207668_10000009 | Ga0207668_1000000931 | 234 |
| 568 | 3300025972 | Ga0207668_10004813 | Ga0207668_100048135 | 234 |
| 569 | 3300025972 | Ga0207668_10217044 | Ga0207668_102170442 | 234 |
| 570 | 3300025981 | Ga0207640_10009909 | Ga0207640_100099092 | 234 |
| 571 | 3300025981 | Ga0207640_10033724 | Ga0207640_100337242 | 234 |
| 572 | 3300025981 | Ga0207640_10334792 | Ga0207640_103347922 | 234 |
| 573 | 3300025986 | Ga0207658_10000010 | Ga0207658_10000010164 | 234 |
| 574 | 3300025986 | Ga0207658_10000728 | Ga0207658_1000072816 | 234 |
| 575 | 3300025986 | Ga0207658_10001866 | Ga0207658_100018665 | 234 |
| 576 | 3300025986 | Ga0207658_10004027 | Ga0207658_100040278 | 234 |
| 577 | 3300026035 | Ga0207703_10000368 | Ga0207703_1000036810 | 234 |
| 578 | 3300026035 | Ga0207703_10000822 | Ga0207703_100008223 | 234 |
| 579 | 3300026035 | Ga0207703_10002210 | Ga0207703_100022107 | 234 |
| 580 | 3300026041 | Ga0207639_10000136 | Ga0207639_1000013636 | 234 |
| 581 | 3300026041 | Ga0207639_10025845 | Ga0207639_100258452 | 234 |
| 582 | 3300026041 | Ga0207639_10231045 | Ga0207639_102310452 | 234 |
| 583 | 3300026067 | Ga0207678_10021656 | Ga0207678_100216564 | 234 |
| 584 | 3300026078 | Ga0207702_10008931 | Ga0207702_1000893110 | 234 |
| 585 | 3300026078 | Ga0207702_10105164 | Ga0207702_101051642 | 234 |
| 586 | 3300026078 | Ga0207702_10704662 | Ga0207702_107046621 | 234 |
| 587 | 3300026088 | Ga0207641_10000017 | Ga0207641_10000017170 | 234 |
| 588 | 3300026088 | Ga0207641_10000073 | Ga0207641_1000007313 | 234 |
| 589 | 3300026088 | Ga0207641_10000914 | Ga0207641_1000091428 | 234 |
| 590 | 3300026088 | Ga0207641_10010624 | Ga0207641_100106242 | 234 |
| 591 | 3300026088 | Ga0207641_10133438 | Ga0207641_101334383 | 234 |
| 592 | 3300026095 | Ga0207676_10000034 | Ga0207676_10000034165 | 234 |
| 593 | 3300026095 | Ga0207676_10000037 | Ga0207676_10000037116 | 234 |
| 594 | 3300026095 | Ga0207676_10000193 | Ga0207676_1000019328 | 234 |
| 595 | 3300026095 | Ga0207676_10000781 | Ga0207676_1000078111 | 234 |
| 596 | 3300026095 | Ga0207676_10000956 | Ga0207676_1000095614 | 234 |
| 597 | 3300026095 | Ga0207676_10023450 | Ga0207676_100234504 | 234 |
| 598 | 3300026116 | Ga0207674_10007312 | Ga0207674_1000731214 | 234 |
| 599 | 3300026116 | Ga0207674_10659374 | Ga0207674_106593742 | 234 |
| 600 | 3300026118 | Ga0207675_100001462 | Ga0207675_1000014624 | 234 |
| 601 | 3300026118 | Ga0207675_100042095 | Ga0207675_1000420952 | 234 |
| 602 | 3300026142 | Ga0207698_10006770 | Ga0207698_100067702 | 234 |
| 603 | 3300026142 | Ga0207698_10020877 | Ga0207698_100208772 | 234 |
| 604 | 3300026142 | Ga0207698_10123678 | Ga0207698_101236782 | 234 |
| 605 | 3300026142 | Ga0207698_10342017 | Ga0207698_103420173 | 234 |
| 606 | 3300026142 | Ga0207698_10785461 | Ga0207698_107854611 | 234 |
| 607 | 3300028379 | Ga0268266_10000025 | Ga0268266_1000002586 | 234 |
| 608 | 3300028380 | Ga0268265_10000025 | Ga0268265_1000002593 | 234 |
| 609 | 3300028380 | Ga0268265_10000052 | Ga0268265_10000052113 | 234 |
| 610 | 3300028380 | Ga0268265_10000143 | Ga0268265_1000014378 | 234 |
| 611 | 3300028380 | Ga0268265_10000530 | Ga0268265_1000053018 | 234 |
| 612 | 3300028381 | Ga0268264_10000070 | Ga0268264_10000070104 | 234 |
| 613 | 3300028381 | Ga0268264_10000608 | Ga0268264_1000060834 | 234 |
| 614 | 3300031548 | Ga0307408_100035719 | Ga0307408_1000357192 | 234 |
| 615 | 3300031911 | Ga0307412_10017153 | Ga0307412_100171532 | 234 |
| 616 | 3300031911 | Ga0307412_10039927 | Ga0307412_100399273 | 234 |
| 617 | 3300031911 | Ga0307412_10151739 | Ga0307412_101517391 | 234 |
| 618 | 3300032002 | Ga0307416_100180619 | Ga0307416_1001806192 | 234 |
| 619 | 3300033180 | Ga0307510_10026690 | Ga0307510_100266903 | 234 |
| 620 | 3300037312 | Ga0395899_0009253 | Ga0395899_0009253_1281_1985 | 234 |
| 621 | 3300037312 | Ga0395899_0046034 | Ga0395899_0046034_1954_2658 | 234 |
| 622 | 3300037418 | Ga0395900_0000964 | Ga0395900_0000964_348_1052 | 234 |
| 623 | 3300037418 | Ga0395900_0013554 | Ga0395900_0013554_4633_5337 | 234 |
| 624 | 3300037418 | Ga0395900_0027700 | Ga0395900_0027700_1857_2561 | 234 |
| 625 | 3300037466 | Ga0395898_0022701 | Ga0395898_0022701_3074_3778 | 234 |
| 626 | 3300037466 | Ga0395898_0292276 | Ga0395898_0292276_146_850 | 234 |
| 627 | 3300037471 | Ga0395905_0098859 | Ga0395905_0098859_1729_2433 | 234 |
| 628 | 3300037471 | Ga0395905_0136652 | Ga0395905_0136652_718_1422 | 234 |
| 629 | 3300037853 | Ga0436364_0443678 | Ga0436364_0443678_413_1123 | 234 |
| 630 | 3300038443 | Ga0395901_0001061 | Ga0395901_0001061_25109_25813 | 234 |
| 631 | 3300038443 | Ga0395901_0015808 | Ga0395901_0015808_2355_3059 | 234 |
| 632 | 3300038443 | Ga0395901_0034086 | Ga0395901_0034086_1903_2607 | 234 |
| 633 | 3300039450 | Ga0436363_0896344 | Ga0436363_0896344_2073_2780 | 234 |
| 634 | 3300039450 | Ga0436363_1706034 | Ga0436363_1706034_87_794 | 234 |
| 635 | 3300044694 | Ga0466963_0012713 | Ga0466963_0012713_2264_2968 | 234 |
| 636 | 3300044694 | Ga0466963_0042034 | Ga0466963_0042034_1864_2568 | 234 |
| 637 | 3300045976 | Ga0466967_0027105 | Ga0466967_0027105_639_1343 | 234 |
| 638 | 3300045976 | Ga0466967_0147945 | Ga0466967_0147945_896_1600 | 234 |
| 639 | 3300046506 | Ga0495583_0099442 | Ga0495583_0099442_100_804 | 234 |
| 640 | 3300046520 | Ga0495637_0056169 | Ga0495637_0056169_469_1173 | 234 |
| 641 | 3300046522 | Ga0495643_0048100 | Ga0495643_0048100_1272_1976 | 234 |
| 642 | 3300046522 | Ga0495643_0072685 | Ga0495643_0072685_428_1156 | 234 |
| 643 | 3300046524 | Ga0495648_0075240 | Ga0495648_0075240_781_1494 | 234 |
| 644 | 3300046525 | Ga0495663_0027919 | Ga0495663_0027919_221_925 | 234 |
| 645 | 3300046530 | Ga0495654_0005164 | Ga0495654_0005164_4600_5304 | 234 |
| 646 | 3300046542 | Ga0495597_0061300 | Ga0495597_0061300_660_1388 | 234 |
| 647 | 3300046616 | Ga0495668_0007229 | Ga0495668_0007229_2660_3364 | 234 |
| 648 | 3300046616 | Ga0495668_0013009 | Ga0495668_0013009_671_1486 | 234 |
| 649 | 3300046616 | Ga0495668_0027327 | Ga0495668_0027327_1119_1847 | 234 |
| 650 | 3300046660 | Ga0495625_0042424 | Ga0495625_0042424_1242_1955 | 234 |
| 651 | 3300046660 | Ga0495625_0098269 | Ga0495625_0098269_993_1883 | 234 |
| 652 | 3300046691 | Ga0495670_0000004 | Ga0495670_0000004_192236_192943 | 234 |
| 653 | 3300047445 | Ga0495677_0034076 | Ga0495677_0034076_526_1239 | 234 |
| 654 | 3300048904 | Ga0496101_0389750 | Ga0496101_0389750_262_1062 | 234 |
| 655 | 3300048905 | Ga0496102_0000010 | Ga0496102_0000010_289509_290213 | 234 |
| 656 | 3300048905 | Ga0496102_0042162 | Ga0496102_0042162_1030_1734 | 234 |
| 657 | 3300048906 | Ga0496103_0000029 | Ga0496103_0000029_178218_178922 | 234 |
| 658 | 3300048906 | Ga0496103_0001613 | Ga0496103_0001613_1030_1734 | 234 |
| 659 | 3300048907 | Ga0496104_0050732 | Ga0496104_0050732_491_1195 | 234 |
| 660 | 3300048908 | Ga0496105_0054789 | Ga0496105_0054789_2069_2773 | 234 |
| 661 | 3300048908 | Ga0496105_0184534 | Ga0496105_0184534_315_1019 | 234 |
| 662 | 3300048909 | Ga0496106_0067686 | Ga0496106_0067686_865_1569 | 234 |
| 663 | 3300048910 | Ga0496107_0027803 | Ga0496107_0027803_2094_2798 | 234 |
| 664 | 3300048912 | Ga0496109_0011644 | Ga0496109_0011644_303_1007 | 234 |
| 665 | 3300048912 | Ga0496109_0960554 | Ga0496109_0960554_74_778 | 234 |
| 666 | 3300048913 | Ga0496110_0155580 | Ga0496110_0155580_418_1122 | 234 |
| 667 | 3300048913 | Ga0496110_0201160 | Ga0496110_0201160_355_1059 | 234 |
| 668 | 3300048916 | Ga0496113_0029704 | Ga0496113_0029704_474_1178 | 234 |
| 669 | 3300048919 | Ga0496116_0003035 | Ga0496116_0003035_7671_8375 | 234 |
| 670 | 3300048920 | Ga0496117_0000037 | Ga0496117_0000037_290111_290815 | 234 |
| 671 | 3300048920 | Ga0496117_0005000 | Ga0496117_0005000_7378_8178 | 234 |
| 672 | 3300048921 | Ga0496118_0000034 | Ga0496118_0000034_287915_288619 | 234 |
| 673 | 3300048921 | Ga0496118_0000216 | Ga0496118_0000216_92823_93623 | 234 |
| 674 | 3300048922 | Ga0496119_0030248 | Ga0496119_0030248_122_826 | 234 |
| 675 | 3300048923 | Ga0496120_0132918 | Ga0496120_0132918_379_1086 | 234 |
| 676 | 3300048924 | Ga0496121_0018311 | Ga0496121_0018311_2175_2879 | 234 |
| 677 | 3300048925 | Ga0496122_0305577 | Ga0496122_0305577_89_793 | 234 |
| 678 | 3300048926 | Ga0496123_0025909 | Ga0496123_0025909_2843_3550 | 234 |
| 679 | 3300048927 | Ga0496124_0000033 | Ga0496124_0000033_287915_288619 | 234 |
| 680 | 3300048927 | Ga0496124_0001292 | Ga0496124_0001292_34326_35033 | 234 |
| 681 | 3300048927 | Ga0496124_0002507 | Ga0496124_0002507_18989_19696 | 234 |
| 682 | 3300048927 | Ga0496124_0009995 | Ga0496124_0009995_5383_6090 | 234 |
| 683 | 3300048929 | Ga0496126_0255449 | Ga0496126_0255449_500_1207 | 234 |
| 684 | 3300049569 | Ga0501032_0045189 | Ga0501032_0045189_653_1384 | 234 |
| 685 | 3300049572 | Ga0501036_0265314 | Ga0501036_0265314_465_1172 | 234 |
| 686 | 3300049580 | Ga0501046_0261935 | Ga0501046_0261935_390_1097 | 234 |
| 687 | 3300049582 | Ga0501048_0112062 | Ga0501048_0112062_371_1078 | 234 |
| 688 | 3300049583 | Ga0501067_0071112 | Ga0501067_0071112_19_726 | 234 |
| 689 | 3300049590 | Ga0501074_0195265 | Ga0501074_0195265_183_890 | 234 |
| 690 | 3300049592 | Ga0501076_0102453 | Ga0501076_0102453_381_1088 | 234 |
| 691 | 3300049742 | Ga0501080_0470016 | Ga0501080_0470016_60_767 | 234 |
| 692 | 3300049822 | Ga0501035_0294604 | Ga0501035_0294604_513_1220 | 234 |
| 693 | 3300049823 | Ga0501044_0044786 | Ga0501044_0044786_1855_2586 | 234 |
| 694 | 3300053083 | Ga0495655_0000236 | Ga0495655_0000236_7246_7953 | 234 |
| 695 | 3300053087 | Ga0500643_000478 | Ga0500643_000478_8729_9472 | 234 |
| 696 | 3300053087 | Ga0500643_018106 | Ga0500643_018106_530_1237 | 234 |
| 697 | 3300053087 | Ga0500643_024690 | Ga0500643_024690_579_1292 | 234 |
| 698 | 3300053093 | Ga0500651_0006612 | Ga0500651_0006612_433_1161 | 234 |
| 699 | 3300053108 | Ga0500562_043538 | Ga0500562_043538_374_1081 | 234 |
| 700 | 3300053116 | Ga0500592_015980 | Ga0500592_015980_120_824 | 234 |
| 701 | 3300053130 | Ga0500642_0000714 | Ga0500642_0000714_8722_9450 | 234 |
| 702 | 3300053133 | Ga0500655_000061 | Ga0500655_000061_28108_28836 | 234 |
| 703 | 3300053136 | Ga0500559_0068844 | Ga0500559_0068844_31_744 | 234 |
| 704 | 3300053136 | Ga0500559_0149949 | Ga0500559_0149949_114_821 | 234 |
| 705 | 3300053140 | Ga0500573_0000061 | Ga0500573_0000061_44483_45190 | 234 |
| 706 | 3300053148 | Ga0500590_002284 | Ga0500590_002284_2372_3100 | 234 |
| 707 | 3300053156 | Ga0500622_0040895 | Ga0500622_0040895_782_1510 | 234 |
| 708 | 3300053158 | Ga0500627_0004783 | Ga0500627_0004783_2562_3266 | 234 |
| 709 | 3300053163 | Ga0500639_032266 | Ga0500639_032266_1650_2378 | 234 |
| 710 | 3300053177 | Ga0500636_0240556 | Ga0500636_0240556_12_740 | 234 |
| 711 | 3300053724 | Ga0500570_001475 | Ga0500570_001475_532_1260 | 234 |
| 712 | 3300060353 | Ga0501082_0526142 | Ga0501082_0526142_217_924 | 234 |
| 713 | 3300061734 | Ga0530510_0063971 | Ga0530510_0063971_1178_1885 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lwd-assembly1.cif.gz_A-2 | crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution | 0.9269 | 12 | 232 |
| 3nwp-assembly2.cif.gz_B | crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution | 0.9227 | 3 | 234 |
| 3nwp-assembly2.cif.gz_B | crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution | 0.9036 | 3 | 234 |
| 3lwd-assembly1.cif.gz_A-2 | crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution | 0.891 | 12 | 232 |
| 1vl1-assembly1.cif.gz_A | crystal structure of 6-phosphogluconolactonase (tm1154) from thermotoga maritima at 1.70a resolution | 0.8825 | 3 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lwdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9264 | 12 | 232 | 3.40.50.1360 |
| 3nwpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9085 | 3 | 234 | 3.40.50.1360 |
| 3lhiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8974 | 6 | 234 | 3.40.50.1360 |
| 3nwpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8932 | 3 | 234 | 3.40.50.1360 |
| 3lwdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8904 | 12 | 232 | 3.40.50.1360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520J0Y3-F1-model_v4 | 6-phosphogluconolactonase | 0.9929 | 107 | 234 |
GO:0005975
|
| AF-A0A520J0Y3-F1-model_v4 | 6-phosphogluconolactonase | 0.9852 | 107 | 234 |
GO:0005975
|
| AF-A0A520JB25-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9825 | 3 | 190 |
GO:0005975
GO:0006098 GO:0017057 |
| AF-A0A2D8AYU0-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9784 | 6 | 234 |
GO:0005975
GO:0006098 GO:0017057 |
| AF-A0A7G9KZA4-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9779 | 1 | 233 |
GO:0005975
GO:0006098 GO:0017057 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar