F476936
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 236 | 714 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100459999|Ga0075434_1004599992 |
| Length | 285 |
| Sequence | MIARLGRILRNQQGQVVTGRAAAARPPIKASTLRKDTWWALPLTVVLVLGSFIVYSTWAGLQNANYWAPPYLSPFYSPCLSAKCLHVTFGYGLPDISLPIIGILSPAFLILWGPGLFRLTCYYYRKAYYRSFWLAPPACAVPDAKRGYTGETRFPLIFQNLHRYAWYVAVIFIVLLTWDAVLAFRFPMPDGSHRLGIGVGTLVMWVNVILLAGYTFSCHSCRHVCGGHVDVFSRAKTRYRVWHFFTRLNENHPAFAWLSLFSVGLTDLYIRLVAMGVIRDLRIVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 182 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 234 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 0.42 |
| Rhizosphere | 99.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10017390 | 3300003203 | Bacteria | 2974 |
| 2 | JGI26129J50193_1000967 | 3300003349 | Bacteria | 1893 |
| 3 | Ga0065712_10178808 | 3300005290 | Bacteria | 1203 |
| 4 | Ga0065707_10134579 | 3300005295 | Bacteria | 1863 |
| 5 | Ga0070676_10001402 | 3300005328 | Bacteria | 12171 |
| 6 | Ga0070683_100234008 | 3300005329 | Bacteria | 1747 |
| 7 | Ga0070670_100001558 | 3300005331 | Bacteria | 18473 |
| 8 | Ga0068869_100000795 | 3300005334 | Bacteria | 18019 |
| 9 | Ga0068869_100046889 | 3300005334 | Bacteria | 3118 |
| 10 | Ga0068869_100114011 | 3300005334 | Bacteria | 2060 |
| 11 | Ga0068869_100546733 | 3300005334 | Bacteria | 972 |
| 12 | Ga0070680_100002409 | 3300005336 | Bacteria | 13849 |
| 13 | Ga0070680_100049260 | 3300005336 | Bacteria | 3434 |
| 14 | Ga0070680_100135883 | 3300005336 | Bacteria | 2060 |
| 15 | Ga0070682_100000179 | 3300005337 | Bacteria | 47429 |
| 16 | Ga0068868_100043820 | 3300005338 | Bacteria | 3496 |
| 17 | Ga0068868_100256546 | 3300005338 | Bacteria | 1473 |
| 18 | Ga0070660_100000476 | 3300005339 | Bacteria | 26750 |
| 19 | Ga0070689_100073029 | 3300005340 | Bacteria | 2682 |
| 20 | Ga0070691_10002169 | 3300005341 | Bacteria | 8686 |
| 21 | Ga0070691_10111549 | 3300005341 | Bacteria | 1369 |
| 22 | Ga0070661_100000876 | 3300005344 | Bacteria | 21630 |
| 23 | Ga0070692_10000828 | 3300005345 | Bacteria | 10344 |
| 24 | Ga0070692_10001115 | 3300005345 | Bacteria | 9386 |
| 25 | Ga0070692_10046023 | 3300005345 | Bacteria | 2253 |
| 26 | Ga0070692_10250019 | 3300005345 | Bacteria | 1061 |
| 27 | Ga0070669_100017830 | 3300005353 | Bacteria | 5067 |
| 28 | Ga0070669_100414852 | 3300005353 | Bacteria | 1104 |
| 29 | Ga0070673_100447972 | 3300005364 | Bacteria | 1161 |
| 30 | Ga0070688_100064606 | 3300005365 | Bacteria | 2323 |
| 31 | Ga0070659_100153974 | 3300005366 | Bacteria | 1876 |
| 32 | Ga0070701_10069613 | 3300005438 | Bacteria | 1877 |
| 33 | Ga0070705_100000333 | 3300005440 | Bacteria | 27695 |
| 34 | Ga0070705_100035395 | 3300005440 | Bacteria | 2799 |
| 35 | Ga0070705_100078316 | 3300005440 | Bacteria | 2021 |
| 36 | Ga0070705_100101787 | 3300005440 | Bacteria | 1815 |
| 37 | Ga0070705_100122966 | 3300005440 | Bacteria | 1679 |
| 38 | Ga0070705_100140294 | 3300005440 | Bacteria | 1590 |
| 39 | Ga0070700_100026807 | 3300005441 | Bacteria | 3408 |
| 40 | Ga0070700_100212381 | 3300005441 | Bacteria | 1366 |
| 41 | Ga0070700_100477935 | 3300005441 | Bacteria | 954 |
| 42 | Ga0070694_100022054 | 3300005444 | Bacteria | 4078 |
| 43 | Ga0070694_100075232 | 3300005444 | Bacteria | 2335 |
| 44 | Ga0070694_100182553 | 3300005444 | Bacteria | 1553 |
| 45 | Ga0070694_100248203 | 3300005444 | Bacteria | 1345 |
| 46 | Ga0070708_100006589 | 3300005445 | Bacteria | 9242 |
| 47 | Ga0070708_100016216 | 3300005445 | Bacteria | 6177 |
| 48 | Ga0070708_100055617 | 3300005445 | Bacteria | 3519 |
| 49 | Ga0070708_100075366 | 3300005445 | Bacteria | 3045 |
| 50 | Ga0070708_100159392 | 3300005445 | Bacteria | 2102 |
| 51 | Ga0070708_100186897 | 3300005445 | Bacteria | 1938 |
| 52 | Ga0070663_100226349 | 3300005455 | Bacteria | 1471 |
| 53 | Ga0070663_100480325 | 3300005455 | Bacteria | 1029 |
| 54 | Ga0070662_100027815 | 3300005457 | Bacteria | 3931 |
| 55 | Ga0070681_10004124 | 3300005458 | Bacteria | 13743 |
| 56 | Ga0068867_100000455 | 3300005459 | Bacteria | 27140 |
| 57 | Ga0068867_100194989 | 3300005459 | Bacteria | 1618 |
| 58 | Ga0068867_100547178 | 3300005459 | Bacteria | 1002 |
| 59 | Ga0070706_100047684 | 3300005467 | Bacteria | 3954 |
| 60 | Ga0070706_100062204 | 3300005467 | Bacteria | 3449 |
| 61 | Ga0070706_100077558 | 3300005467 | Bacteria | 3075 |
| 62 | Ga0070706_100116134 | 3300005467 | Bacteria | 2492 |
| 63 | Ga0070706_100117317 | 3300005467 | Bacteria | 2479 |
| 64 | Ga0070706_100224884 | 3300005467 | Bacteria | 1752 |
| 65 | Ga0070706_100603264 | 3300005467 | Bacteria | 1020 |
| 66 | Ga0070707_100000108 | 3300005468 | Bacteria | 76022 |
| 67 | Ga0070707_100017934 | 3300005468 | Bacteria | 6656 |
| 68 | Ga0070707_100103935 | 3300005468 | Bacteria | 2753 |
| 69 | Ga0070707_100113897 | 3300005468 | Bacteria | 2624 |
| 70 | Ga0070707_100261817 | 3300005468 | Bacteria | 1682 |
| 71 | Ga0070707_100593067 | 3300005468 | Bacteria | 1070 |
| 72 | Ga0070707_100603131 | 3300005468 | Bacteria | 1060 |
| 73 | Ga0070698_100000691 | 3300005471 | Bacteria | 36018 |
| 74 | Ga0070698_100011480 | 3300005471 | Bacteria | 9401 |
| 75 | Ga0070698_100014980 | 3300005471 | Bacteria | 8196 |
| 76 | Ga0070698_100094612 | 3300005471 | Bacteria | 2966 |
| 77 | Ga0070698_100161752 | 3300005471 | Bacteria | 2182 |
| 78 | Ga0070698_100258778 | 3300005471 | Bacteria | 1673 |
| 79 | Ga0070699_100003274 | 3300005518 | Bacteria | 14324 |
| 80 | Ga0070699_100013457 | 3300005518 | Bacteria | 7045 |
| 81 | Ga0070699_100013570 | 3300005518 | Bacteria | 7013 |
| 82 | Ga0070699_100015560 | 3300005518 | Bacteria | 6538 |
| 83 | Ga0070699_100020088 | 3300005518 | Bacteria | 5757 |
| 84 | Ga0070699_100061434 | 3300005518 | Bacteria | 3256 |
| 85 | Ga0070699_100081230 | 3300005518 | Bacteria | 2826 |
| 86 | Ga0070699_100224249 | 3300005518 | Bacteria | 1675 |
| 87 | Ga0070699_100230631 | 3300005518 | Bacteria | 1651 |
| 88 | Ga0070699_100279410 | 3300005518 | Bacteria | 1495 |
| 89 | Ga0070699_100302754 | 3300005518 | Bacteria | 1434 |
| 90 | Ga0070679_100007477 | 3300005530 | Bacteria | 10214 |
| 91 | Ga0070679_100203873 | 3300005530 | Bacteria | 1943 |
| 92 | Ga0070684_100164633 | 3300005535 | Bacteria | 2013 |
| 93 | Ga0070697_100023932 | 3300005536 | Bacteria | 4860 |
| 94 | Ga0070697_100065632 | 3300005536 | Bacteria | 2966 |
| 95 | Ga0070697_100093448 | 3300005536 | Bacteria | 2490 |
| 96 | Ga0070697_100124263 | 3300005536 | Bacteria | 2161 |
| 97 | Ga0070697_100285780 | 3300005536 | Bacteria | 1416 |
| 98 | Ga0070697_100349732 | 3300005536 | Bacteria | 1276 |
| 99 | Ga0070697_100449415 | 3300005536 | Bacteria | 1122 |
| 100 | Ga0068853_100191463 | 3300005539 | Bacteria | 1858 |
| 101 | Ga0070672_100287910 | 3300005543 | Bacteria | 1390 |
| 102 | Ga0070695_100003891 | 3300005545 | Bacteria | 8713 |
| 103 | Ga0070695_100061321 | 3300005545 | Bacteria | 2440 |
| 104 | Ga0070695_100082910 | 3300005545 | Bacteria | 2123 |
| 105 | Ga0070695_100276227 | 3300005545 | Unclassified | 1233 |
| 106 | Ga0070696_100036054 | 3300005546 | Bacteria | 3408 |
| 107 | Ga0070696_100108775 | 3300005546 | Bacteria | 1994 |
| 108 | Ga0070696_100272373 | 3300005546 | Bacteria | 1288 |
| 109 | Ga0070693_100009781 | 3300005547 | Bacteria | 4780 |
| 110 | Ga0070693_100338664 | 3300005547 | Bacteria | 1026 |
| 111 | Ga0070704_100015876 | 3300005549 | Bacteria | 4742 |
| 112 | Ga0070704_100046308 | 3300005549 | Bacteria | 3032 |
| 113 | Ga0070704_100047238 | 3300005549 | Bacteria | 3008 |
| 114 | Ga0070704_100103095 | 3300005549 | Bacteria | 2154 |
| 115 | Ga0068855_100000225 | 3300005563 | Bacteria | 72196 |
| 116 | Ga0070664_100017355 | 3300005564 | Bacteria | 5910 |
| 117 | Ga0068857_100237393 | 3300005577 | Bacteria | 1668 |
| 118 | Ga0068854_100013613 | 3300005578 | Bacteria | 5346 |
| 119 | Ga0068854_100484107 | 3300005578 | Bacteria | 1039 |
| 120 | Ga0068854_100511278 | 3300005578 | Bacteria | 1013 |
| 121 | Ga0068854_100626729 | 3300005578 | Bacteria | 921 |
| 122 | Ga0068856_100001169 | 3300005614 | Bacteria | 27611 |
| 123 | Ga0068852_100142485 | 3300005616 | Bacteria | 2220 |
| 124 | Ga0068859_100001393 | 3300005617 | Bacteria | 24544 |
| 125 | Ga0068859_100089345 | 3300005617 | Bacteria | 3131 |
| 126 | Ga0068864_100285188 | 3300005618 | Bacteria | 1542 |
| 127 | Ga0068866_10060874 | 3300005718 | Bacteria | 1959 |
| 128 | Ga0068866_10267607 | 3300005718 | Bacteria | 1053 |
| 129 | Ga0068861_100018775 | 3300005719 | Bacteria | 4930 |
| 130 | Ga0068870_10000139 | 3300005840 | Bacteria | 25224 |
| 131 | Ga0068863_100032824 | 3300005841 | Bacteria | 4947 |
| 132 | Ga0068863_100079836 | 3300005841 | Bacteria | 3098 |
| 133 | Ga0068858_100189302 | 3300005842 | Bacteria | 1944 |
| 134 | Ga0068860_100001109 | 3300005843 | Bacteria | 29627 |
| 135 | Ga0068860_100315180 | 3300005843 | Bacteria | 1534 |
| 136 | Ga0068862_100003750 | 3300005844 | Bacteria | 12958 |
| 137 | Ga0068862_100080533 | 3300005844 | Bacteria | 2824 |
| 138 | Ga0068862_100087038 | 3300005844 | Bacteria | 2717 |
| 139 | Ga0068862_100143465 | 3300005844 | Bacteria | 2121 |
| 140 | Ga0068862_100546214 | 3300005844 | Bacteria | 1106 |
| 141 | Ga0081455_10001810 | 3300005937 | Bacteria | 25776 |
| 142 | Ga0081538_10015371 | 3300005981 | Bacteria | 5929 |
| 143 | Ga0081540_1005034 | 3300005983 | Bacteria | 9916 |
| 144 | Ga0081539_10000005 | 3300005985 | Bacteria | 549026 |
| 145 | Ga0075432_10024663 | 3300006058 | Bacteria | 2062 |
| 146 | Ga0070715_10016204 | 3300006163 | Bacteria | 2796 |
| 147 | Ga0070716_100085712 | 3300006173 | Bacteria | 1893 |
| 148 | Ga0070712_100006589 | 3300006175 | Bacteria | 7212 |
| 149 | Ga0075367_10339685 | 3300006178 | Unclassified | 947 |
| 150 | Ga0068871_100259299 | 3300006358 | Bacteria | 1516 |
| 151 | Ga0075428_100000924 | 3300006844 | Bacteria | 31024 |
| 152 | Ga0075428_100001380 | 3300006844 | Bacteria | 25833 |
| 153 | Ga0075428_100023900 | 3300006844 | Bacteria | 6763 |
| 154 | Ga0075428_100030517 | 3300006844 | Bacteria | 5961 |
| 155 | Ga0075428_100054921 | 3300006844 | Bacteria | 4364 |
| 156 | Ga0075428_100182861 | 3300006844 | Bacteria | 2268 |
| 157 | Ga0075428_100197674 | 3300006844 | Bacteria | 2174 |
| 158 | Ga0075428_100224837 | 3300006844 | Bacteria | 2026 |
| 159 | Ga0075428_100624849 | 3300006844 | Bacteria | 1150 |
| 160 | Ga0075430_100000019 | 3300006846 | Bacteria | 86721 |
| 161 | Ga0075430_100000487 | 3300006846 | Bacteria | 29740 |
| 162 | Ga0075430_100016723 | 3300006846 | Bacteria | 6247 |
| 163 | Ga0075430_100046733 | 3300006846 | Bacteria | 3656 |
| 164 | Ga0075430_100061652 | 3300006846 | Bacteria | 3151 |
| 165 | Ga0075430_100147154 | 3300006846 | Bacteria | 1962 |
| 166 | Ga0075430_100212495 | 3300006846 | Bacteria | 1605 |
| 167 | Ga0075431_100000797 | 3300006847 | Bacteria | 27524 |
| 168 | Ga0075431_100002180 | 3300006847 | Bacteria | 18719 |
| 169 | Ga0075431_100002229 | 3300006847 | Bacteria | 18559 |
| 170 | Ga0075431_100008469 | 3300006847 | Bacteria | 10298 |
| 171 | Ga0075431_100011273 | 3300006847 | Bacteria | 9005 |
| 172 | Ga0075431_100023868 | 3300006847 | Bacteria | 6261 |
| 173 | Ga0075431_100072397 | 3300006847 | Bacteria | 3556 |
| 174 | Ga0075431_100168828 | 3300006847 | Bacteria | 2249 |
| 175 | Ga0075431_100340726 | 3300006847 | Bacteria | 1509 |
| 176 | Ga0075431_100503852 | 3300006847 | Bacteria | 1201 |
| 177 | Ga0075433_10006420 | 3300006852 | Bacteria | 9298 |
| 178 | Ga0075433_10032400 | 3300006852 | Bacteria | 4476 |
| 179 | Ga0075433_10056759 | 3300006852 | Bacteria | 3421 |
| 180 | Ga0075433_10062927 | 3300006852 | Bacteria | 3250 |
| 181 | Ga0075433_10082435 | 3300006852 | Bacteria | 2836 |
| 182 | Ga0075433_10166688 | 3300006852 | Bacteria | 1960 |
| 183 | Ga0075433_10281102 | 3300006852 | Bacteria | 1474 |
| 184 | Ga0075434_100022146 | 3300006871 | Bacteria | 6189 |
| 185 | Ga0075434_100031633 | 3300006871 | Bacteria | 5217 |
| 186 | Ga0075434_100033398 | 3300006871 | Bacteria | 5078 |
| 187 | Ga0075434_100087316 | 3300006871 | Bacteria | 3119 |
| 188 | Ga0075434_100156094 | 3300006871 | Bacteria | 2301 |
| 189 | Ga0075434_100163988 | 3300006871 | Bacteria | 2242 |
| 190 | Ga0075434_100167389 | 3300006871 | Bacteria | 2218 |
| 191 | Ga0075434_100223242 | 3300006871 | Bacteria | 1904 |
| 192 | Ga0075434_100232081 | 3300006871 | Bacteria | 1865 |
| 193 | Ga0075434_100459999 | 3300006871 | Bacteria | 1294 |
| 194 | Ga0075429_100000859 | 3300006880 | Bacteria | 23924 |
| 195 | Ga0075429_100010038 | 3300006880 | Bacteria | 8205 |
| 196 | Ga0075429_100011531 | 3300006880 | Bacteria | 7665 |
| 197 | Ga0075429_100021240 | 3300006880 | Bacteria | 5627 |
| 198 | Ga0075429_100027920 | 3300006880 | Bacteria | 4899 |
| 199 | Ga0075429_100030148 | 3300006880 | Bacteria | 4712 |
| 200 | Ga0075429_100144176 | 3300006880 | Bacteria | 2084 |
| 201 | Ga0075429_100424371 | 3300006880 | Bacteria | 1165 |
| 202 | Ga0075429_100611439 | 3300006880 | Bacteria | 955 |
| 203 | Ga0068865_100124729 | 3300006881 | Bacteria | 1920 |
| 204 | Ga0075436_100001157 | 3300006914 | Bacteria | 17854 |
| 205 | Ga0075436_100015235 | 3300006914 | Bacteria | 5266 |
| 206 | Ga0075436_100041000 | 3300006914 | Bacteria | 3195 |
| 207 | Ga0075436_100146490 | 3300006914 | Bacteria | 1661 |
| 208 | Ga0075436_100414469 | 3300006914 | Bacteria | 977 |
| 209 | Ga0097620_100001393 | 3300006931 | Bacteria | 24544 |
| 210 | Ga0097620_100089342 | 3300006931 | Bacteria | 3131 |
| 211 | Ga0075435_100000661 | 3300007076 | Bacteria | 21221 |
| 212 | Ga0075435_100015296 | 3300007076 | Bacteria | 5766 |
| 213 | Ga0075435_100057817 | 3300007076 | Bacteria | 3138 |
| 214 | Ga0075435_100485406 | 3300007076 | Bacteria | 1067 |
| 215 | Ga0099794_10007170 | 3300007265 | Bacteria | 4562 |
| 216 | Ga0099794_10016643 | 3300007265 | Bacteria | 3264 |
| 217 | Ga0099794_10033382 | 3300007265 | Bacteria | 2420 |
| 218 | Ga0099794_10119145 | 3300007265 | Bacteria | 1327 |
| 219 | Ga0111539_10000535 | 3300009094 | Bacteria | 48283 |
| 220 | Ga0111539_10018495 | 3300009094 | Bacteria | 8631 |
| 221 | Ga0111539_10082769 | 3300009094 | Bacteria | 3775 |
| 222 | Ga0111539_10114639 | 3300009094 | Bacteria | 3161 |
| 223 | Ga0111539_10192811 | 3300009094 | Bacteria | 2377 |
| 224 | Ga0111539_10249379 | 3300009094 | Bacteria | 2067 |
| 225 | Ga0111539_10481786 | 3300009094 | Bacteria | 1445 |
| 226 | Ga0114129_10000115 | 3300009147 | Bacteria | 80576 |
| 227 | Ga0114129_10000606 | 3300009147 | Bacteria | 44322 |
| 228 | Ga0114129_10001631 | 3300009147 | Bacteria | 30466 |
| 229 | Ga0114129_10008441 | 3300009147 | Bacteria | 14680 |
| 230 | Ga0114129_10009875 | 3300009147 | Bacteria | 13607 |
| 231 | Ga0114129_10012726 | 3300009147 | Bacteria | 11977 |
| 232 | Ga0114129_10036324 | 3300009147 | Bacteria | 6958 |
| 233 | Ga0114129_10079508 | 3300009147 | Bacteria | 4559 |
| 234 | Ga0114129_10102712 | 3300009147 | Bacteria | 3953 |
| 235 | Ga0114129_10102978 | 3300009147 | Bacteria | 3947 |
| 236 | Ga0114129_10114996 | 3300009147 | Bacteria | 3709 |
| 237 | Ga0114129_10119347 | 3300009147 | Bacteria | 3632 |
| 238 | Ga0114129_10225093 | 3300009147 | Bacteria | 2529 |
| 239 | Ga0114129_10273784 | 3300009147 | Bacteria | 2258 |
| 240 | Ga0114129_10529845 | 3300009147 | Bacteria | 1535 |
| 241 | Ga0114129_10563662 | 3300009147 | Bacteria | 1480 |
| 242 | Ga0114129_10734822 | 3300009147 | Bacteria | 1265 |
| 243 | Ga0114129_10738955 | 3300009147 | Bacteria | 1261 |
| 244 | Ga0114129_10753981 | 3300009147 | Bacteria | 1246 |
| 245 | Ga0114129_10919193 | 3300009147 | Bacteria | 1107 |
| 246 | Ga0105243_10007774 | 3300009148 | Bacteria | 8242 |
| 247 | Ga0105243_10275853 | 3300009148 | Bacteria | 1512 |
| 248 | Ga0105241_10001038 | 3300009174 | Bacteria | 21150 |
| 249 | Ga0105241_10133370 | 3300009174 | Bacteria | 2013 |
| 250 | Ga0105241_10212150 | 3300009174 | Bacteria | 1623 |
| 251 | Ga0105242_10016052 | 3300009176 | Bacteria | 5817 |
| 252 | Ga0105248_10472423 | 3300009177 | Bacteria | 1413 |
| 253 | Ga0105249_10082436 | 3300009553 | Bacteria | 2992 |
| 254 | Ga0105249_10227328 | 3300009553 | Bacteria | 1839 |
| 255 | Ga0105249_10779791 | 3300009553 | Bacteria | 1019 |
| 256 | Ga0105239_10016176 | 3300010375 | Bacteria | 8254 |
| 257 | Ga0105239_10383916 | 3300010375 | Bacteria | 1588 |
| 258 | Ga0105246_10170521 | 3300011119 | Bacteria | 1666 |
| 259 | Ga0157373_10000388 | 3300013100 | Bacteria | 35150 |
| 260 | Ga0157371_10107766 | 3300013102 | Bacteria | 1977 |
| 261 | Ga0157369_10232425 | 3300013105 | Bacteria | 1927 |
| 262 | Ga0157378_10339128 | 3300013297 | Bacteria | 1465 |
| 263 | Ga0163162_10015647 | 3300013306 | Bacteria | 7413 |
| 264 | Ga0163162_10017085 | 3300013306 | Bacteria | 7099 |
| 265 | Ga0163162_10316041 | 3300013306 | Bacteria | 1694 |
| 266 | Ga0163162_10361522 | 3300013306 | Bacteria | 1585 |
| 267 | Ga0163162_11141169 | 3300013306 | Bacteria | 884 |
| 268 | Ga0157372_10000105 | 3300013307 | Bacteria | 88007 |
| 269 | Ga0157372_10072881 | 3300013307 | Bacteria | 3870 |
| 270 | Ga0157380_10135536 | 3300014326 | Bacteria | 2107 |
| 271 | Ga0157379_10190827 | 3300014968 | Bacteria | 1851 |
| 272 | Ga0157379_10414095 | 3300014968 | Bacteria | 1240 |
| 273 | Ga0182007_10037705 | 3300015262 | Bacteria | 1622 |
| 274 | Ga0207653_10019880 | 3300025885 | Bacteria | 2120 |
| 275 | Ga0207653_10038407 | 3300025885 | Bacteria | 1564 |
| 276 | Ga0207642_10233978 | 3300025899 | Bacteria | 1034 |
| 277 | Ga0207688_10012816 | 3300025901 | Bacteria | 4558 |
| 278 | Ga0207645_10005499 | 3300025907 | Bacteria | 9176 |
| 279 | Ga0207643_10001465 | 3300025908 | Bacteria | 13545 |
| 280 | Ga0207684_10000115 | 3300025910 | Bacteria | 149762 |
| 281 | Ga0207684_10019692 | 3300025910 | Bacteria | 5772 |
| 282 | Ga0207684_10073541 | 3300025910 | Bacteria | 2903 |
| 283 | Ga0207684_10132276 | 3300025910 | Bacteria | 2141 |
| 284 | Ga0207684_10148413 | 3300025910 | Bacteria | 2017 |
| 285 | Ga0207684_10359491 | 3300025910 | Bacteria | 1253 |
| 286 | Ga0207654_10004154 | 3300025911 | Bacteria | 7301 |
| 287 | Ga0207654_10082136 | 3300025911 | Bacteria | 1942 |
| 288 | Ga0207707_10000352 | 3300025912 | Bacteria | 48248 |
| 289 | Ga0207671_10168526 | 3300025914 | Bacteria | 1699 |
| 290 | Ga0207693_10025215 | 3300025915 | Bacteria | 4715 |
| 291 | Ga0207663_10207634 | 3300025916 | Bacteria | 1417 |
| 292 | Ga0207660_10000334 | 3300025917 | Bacteria | 30356 |
| 293 | Ga0207660_10570966 | 3300025917 | Bacteria | 920 |
| 294 | Ga0207657_10002597 | 3300025919 | Bacteria | 19548 |
| 295 | Ga0207649_10006035 | 3300025920 | Bacteria | 6576 |
| 296 | Ga0207652_10000466 | 3300025921 | Bacteria | 41482 |
| 297 | Ga0207646_10000250 | 3300025922 | Bacteria | 73162 |
| 298 | Ga0207646_10003851 | 3300025922 | Bacteria | 16662 |
| 299 | Ga0207646_10008025 | 3300025922 | Bacteria | 10643 |
| 300 | Ga0207646_10028619 | 3300025922 | Bacteria | 5069 |
| 301 | Ga0207646_10084314 | 3300025922 | Bacteria | 2843 |
| 302 | Ga0207646_10108278 | 3300025922 | Bacteria | 2493 |
| 303 | Ga0207646_10196959 | 3300025922 | Bacteria | 1819 |
| 304 | Ga0207646_10283279 | 3300025922 | Bacteria | 1498 |
| 305 | Ga0207646_10590039 | 3300025922 | Bacteria | 998 |
| 306 | Ga0207681_10013659 | 3300025923 | Bacteria | 5028 |
| 307 | Ga0207681_10166559 | 3300025923 | Bacteria | 1666 |
| 308 | Ga0207681_10420961 | 3300025923 | Bacteria | 1082 |
| 309 | Ga0207694_10201692 | 3300025924 | Bacteria | 1619 |
| 310 | Ga0207650_10025156 | 3300025925 | Bacteria | 4239 |
| 311 | Ga0207659_10148540 | 3300025926 | Bacteria | 1828 |
| 312 | Ga0207690_10041224 | 3300025932 | Bacteria | 3024 |
| 313 | Ga0207706_10024583 | 3300025933 | Bacteria | 5400 |
| 314 | Ga0207706_10080188 | 3300025933 | Bacteria | 2870 |
| 315 | Ga0207706_10131427 | 3300025933 | Bacteria | 2202 |
| 316 | Ga0207706_10468686 | 3300025933 | Bacteria | 1089 |
| 317 | Ga0207709_10003271 | 3300025935 | Bacteria | 9720 |
| 318 | Ga0207709_10071982 | 3300025935 | Bacteria | 2197 |
| 319 | Ga0207670_10088095 | 3300025936 | Bacteria | 2188 |
| 320 | Ga0207670_10320547 | 3300025936 | Bacteria | 1219 |
| 321 | Ga0207704_10160750 | 3300025938 | Bacteria | 1598 |
| 322 | Ga0207665_10114297 | 3300025939 | Bacteria | 1900 |
| 323 | Ga0207665_10165423 | 3300025939 | Bacteria | 1594 |
| 324 | Ga0207691_10203962 | 3300025940 | Bacteria | 1720 |
| 325 | Ga0207711_10418118 | 3300025941 | Bacteria | 1247 |
| 326 | Ga0207689_10003685 | 3300025942 | Bacteria | 13959 |
| 327 | Ga0207689_10074531 | 3300025942 | Bacteria | 2789 |
| 328 | Ga0207661_10148620 | 3300025944 | Bacteria | 2024 |
| 329 | Ga0207679_10000878 | 3300025945 | Bacteria | 19200 |
| 330 | Ga0207667_10000497 | 3300025949 | Bacteria | 51927 |
| 331 | Ga0207712_10347335 | 3300025961 | Bacteria | 1232 |
| 332 | Ga0207712_10547631 | 3300025961 | Bacteria | 995 |
| 333 | Ga0207640_10088641 | 3300025981 | Bacteria | 2136 |
| 334 | Ga0207640_10100394 | 3300025981 | Bacteria | 2027 |
| 335 | Ga0207640_10476418 | 3300025981 | Bacteria | 1034 |
| 336 | Ga0207658_10165220 | 3300025986 | Bacteria | 1818 |
| 337 | Ga0207677_10228346 | 3300026023 | Bacteria | 1498 |
| 338 | Ga0207677_10422300 | 3300026023 | Bacteria | 1136 |
| 339 | Ga0207703_10019303 | 3300026035 | Bacteria | 5325 |
| 340 | Ga0207703_10318461 | 3300026035 | Bacteria | 1424 |
| 341 | Ga0207639_10002384 | 3300026041 | Bacteria | 12612 |
| 342 | Ga0207678_10013961 | 3300026067 | Bacteria | 7060 |
| 343 | Ga0207678_10253752 | 3300026067 | Bacteria | 1507 |
| 344 | Ga0207708_10135745 | 3300026075 | Bacteria | 1927 |
| 345 | Ga0207708_10248471 | 3300026075 | Bacteria | 1433 |
| 346 | Ga0207708_10396790 | 3300026075 | Bacteria | 1140 |
| 347 | Ga0207708_10456647 | 3300026075 | Bacteria | 1065 |
| 348 | Ga0207708_10570979 | 3300026075 | Bacteria | 956 |
| 349 | Ga0207702_10008955 | 3300026078 | Bacteria | 8434 |
| 350 | Ga0207641_10071148 | 3300026088 | Bacteria | 2991 |
| 351 | Ga0207641_10082607 | 3300026088 | Bacteria | 2792 |
| 352 | Ga0207648_10015946 | 3300026089 | Bacteria | 6885 |
| 353 | Ga0207648_10153126 | 3300026089 | Bacteria | 2035 |
| 354 | Ga0207648_10202775 | 3300026089 | Bacteria | 1759 |
| 355 | Ga0207648_10295593 | 3300026089 | Bacteria | 1451 |
| 356 | Ga0207648_10752173 | 3300026089 | Bacteria | 905 |
| 357 | Ga0207674_10000550 | 3300026116 | Bacteria | 49205 |
| 358 | Ga0207675_100002639 | 3300026118 | Bacteria | 17699 |
| 359 | Ga0207675_100005709 | 3300026118 | Bacteria | 11909 |
| 360 | Ga0207675_100132891 | 3300026118 | Bacteria | 2360 |
| 361 | Ga0207698_10116523 | 3300026142 | Bacteria | 2252 |
| 362 | Ga0209981_1000490 | 3300027378 | Bacteria | 5020 |
| 363 | Ga0209996_1000338 | 3300027395 | Bacteria | 5808 |
| 364 | Ga0210000_1017209 | 3300027462 | Bacteria | 1095 |
| 365 | Ga0209995_1002164 | 3300027471 | Bacteria | 3084 |
| 366 | Ga0209968_1000579 | 3300027526 | Bacteria | 5659 |
| 367 | Ga0209999_1000243 | 3300027543 | Bacteria | 7873 |
| 368 | Ga0209982_1001041 | 3300027552 | Bacteria | 3693 |
| 369 | Ga0210002_1017292 | 3300027617 | Bacteria | 1147 |
| 370 | Ga0209983_1000034 | 3300027665 | Bacteria | 19527 |
| 371 | Ga0209588_1017370 | 3300027671 | Bacteria | 2230 |
| 372 | Ga0209971_1000028 | 3300027682 | Bacteria | 53458 |
| 373 | Ga0209971_1005708 | 3300027682 | Bacteria | 2948 |
| 374 | Ga0209966_1000073 | 3300027695 | Bacteria | 44067 |
| 375 | Ga0209966_1009155 | 3300027695 | Bacteria | 1764 |
| 376 | Ga0209998_10000001 | 3300027717 | Bacteria | 203589 |
| 377 | Ga0209974_10000369 | 3300027876 | Bacteria | 14852 |
| 378 | Ga0209974_10066276 | 3300027876 | Bacteria | 1227 |
| 379 | Ga0207428_10000176 | 3300027907 | Bacteria | 89634 |
| 380 | Ga0207428_10000394 | 3300027907 | Bacteria | 54660 |
| 381 | Ga0207428_10123151 | 3300027907 | Bacteria | 1987 |
| 382 | Ga0207428_10141454 | 3300027907 | Bacteria | 1836 |
| 383 | Ga0268265_10002923 | 3300028380 | Bacteria | 12524 |
| 384 | Ga0268265_10024098 | 3300028380 | Bacteria | 4300 |
| 385 | Ga0268265_10088185 | 3300028380 | Bacteria | 2471 |
| 386 | Ga0268265_10268221 | 3300028380 | Bacteria | 1521 |
| 387 | Ga0268264_10031393 | 3300028381 | Bacteria | 4356 |
| 388 | Ga0268264_10155527 | 3300028381 | Bacteria | 2054 |
| 389 | Ga0268264_10216801 | 3300028381 | Bacteria | 1760 |
| 390 | Ga0307408_100034524 | 3300031548 | Bacteria | 3543 |
| 391 | Ga0307408_100048113 | 3300031548 | Bacteria | 3057 |
| 392 | Ga0307408_100145291 | 3300031548 | Bacteria | 1866 |
| 393 | Ga0307408_100353624 | 3300031548 | Bacteria | 1247 |
| 394 | Ga0307405_10240301 | 3300031731 | Bacteria | 1341 |
| 395 | Ga0307410_10059238 | 3300031852 | Bacteria | 2614 |
| 396 | Ga0307410_10193742 | 3300031852 | Bacteria | 1547 |
| 397 | Ga0307416_100599922 | 3300032002 | Bacteria | 1181 |
| 398 | Ga0307411_10063789 | 3300032005 | Bacteria | 2464 |
| 399 | Ga0307411_10334865 | 3300032005 | Bacteria | 1228 |
| 400 | Ga0373959_0013857 | 3300034820 | Bacteria | 1460 |
| 401 | Ga0373940_0017681 | 3300035088 | Bacteria | 1779 |
| 402 | Ga0373949_0043019 | 3300035090 | Bacteria | 1116 |
| 403 | Ga0373951_0013500 | 3300035091 | Bacteria | 1836 |
| 404 | Ga0373932_0003143 | 3300035112 | Bacteria | 4023 |
| 405 | Ga0373932_0026642 | 3300035112 | Bacteria | 1574 |
| 406 | Ga0373939_0007077 | 3300035114 | Bacteria | 2716 |
| 407 | Ga0373939_0039678 | 3300035114 | Bacteria | 1410 |
| 408 | Ga0373960_0032466 | 3300035121 | Bacteria | 1466 |
| 409 | Ga0373931_0008836 | 3300035691 | Bacteria | 4795 |
| 410 | Ga0395899_0005401 | 3300037312 | Bacteria | 9925 |
| 411 | Ga0395900_0062032 | 3300037418 | Bacteria | 3843 |
| 412 | Ga0395900_0333236 | 3300037418 | Bacteria | 1495 |
| 413 | Ga0395898_0079077 | 3300037466 | Bacteria | 3172 |
| 414 | Ga0395905_0139761 | 3300037471 | Bacteria | 2279 |
| 415 | Ga0395901_0029677 | 3300038443 | Bacteria | 5631 |
| 416 | Ga0439448_0009418 | 3300042005 | Bacteria | 2879 |
| 417 | Ga0439455_0013689 | 3300042012 | Bacteria | 1842 |
| 418 | Ga0439458_0002296 | 3300042157 | Bacteria | 4694 |
| 419 | Ga0439435_0042049 | 3300042436 | Bacteria | 1282 |
| 420 | Ga0439460_0058949 | 3300042461 | Bacteria | 1168 |
| 421 | Ga0451577_0005206 | 3300042876 | Bacteria | 13385 |
| 422 | Ga0451577_0010038 | 3300042876 | Bacteria | 9071 |
| 423 | Ga0451577_0025265 | 3300042876 | Bacteria | 5391 |
| 424 | Ga0451577_0035839 | 3300042876 | Bacteria | 4469 |
| 425 | Ga0451577_0250202 | 3300042876 | Bacteria | 1604 |
| 426 | Ga0453683_0003008 | 3300044673 | Bacteria | 12624 |
| 427 | Ga0453683_0005950 | 3300044673 | Bacteria | 8409 |
| 428 | Ga0453683_0013136 | 3300044673 | Bacteria | 5414 |
| 429 | Ga0453683_0060352 | 3300044673 | Bacteria | 2371 |
| 430 | Ga0453684_0032377 | 3300044712 | Bacteria | 7318 |
| 431 | Ga0453684_0185691 | 3300044712 | Bacteria | 2437 |
| 432 | Ga0453684_0435913 | 3300044712 | Bacteria | 1461 |
| 433 | Ga0451576_0024239 | 3300045051 | Bacteria | 6555 |
| 434 | Ga0451576_0026201 | 3300045051 | Bacteria | 6272 |
| 435 | Ga0451576_0028871 | 3300045051 | Bacteria | 5941 |
| 436 | Ga0451576_0036861 | 3300045051 | Bacteria | 5181 |
| 437 | Ga0451576_0049195 | 3300045051 | Bacteria | 4424 |
| 438 | Ga0451576_0263638 | 3300045051 | Bacteria | 1801 |
| 439 | Ga0451576_0278038 | 3300045051 | Bacteria | 1750 |
| 440 | Ga0451576_0599263 | 3300045051 | Bacteria | 1158 |
| 441 | Ga0495580_0029596 | 3300046472 | Bacteria | 3973 |
| 442 | Ga0495580_0224360 | 3300046472 | Bacteria | 1291 |
| 443 | Ga0495584_0041628 | 3300046491 | Bacteria | 2319 |
| 444 | Ga0495584_0213351 | 3300046491 | Bacteria | 981 |
| 445 | Ga0495659_0061095 | 3300046664 | Bacteria | 1392 |
| 446 | Ga0495669_0032522 | 3300046684 | Bacteria | 2293 |
| 447 | Ga0495669_0185321 | 3300046684 | Bacteria | 992 |
| 448 | Ga0496102_0001871 | 3300048905 | Bacteria | 18136 |
| 449 | Ga0496108_0397804 | 3300048911 | Bacteria | 1203 |
| 450 | Ga0496110_0210918 | 3300048913 | Bacteria | 1766 |
| 451 | Ga0501031_0003020 | 3300049568 | Bacteria | 10764 |
| 452 | Ga0501031_0090122 | 3300049568 | Bacteria | 2000 |
| 453 | Ga0501033_0008980 | 3300049570 | Bacteria | 7718 |
| 454 | Ga0501033_0082046 | 3300049570 | Bacteria | 2365 |
| 455 | Ga0501033_0204541 | 3300049570 | Bacteria | 1409 |
| 456 | Ga0501033_0231964 | 3300049570 | Bacteria | 1311 |
| 457 | Ga0501036_0012481 | 3300049572 | Bacteria | 7043 |
| 458 | Ga0501036_0025187 | 3300049572 | Bacteria | 5019 |
| 459 | Ga0501036_0207057 | 3300049572 | Bacteria | 1649 |
| 460 | Ga0501036_0306586 | 3300049572 | Bacteria | 1328 |
| 461 | Ga0501037_0064932 | 3300049573 | Bacteria | 2659 |
| 462 | Ga0501038_0000777 | 3300049574 | Bacteria | 28251 |
| 463 | Ga0501038_0035789 | 3300049574 | Bacteria | 4358 |
| 464 | Ga0501038_0110847 | 3300049574 | Bacteria | 2274 |
| 465 | Ga0501038_0197507 | 3300049574 | Bacteria | 1616 |
| 466 | Ga0501039_0001226 | 3300049575 | Bacteria | 18831 |
| 467 | Ga0501039_0006761 | 3300049575 | Bacteria | 8728 |
| 468 | Ga0501039_0147603 | 3300049575 | Bacteria | 1848 |
| 469 | Ga0501039_0164062 | 3300049575 | Bacteria | 1747 |
| 470 | Ga0501039_0168675 | 3300049575 | Bacteria | 1721 |
| 471 | Ga0501040_0001715 | 3300049576 | Bacteria | 14046 |
| 472 | Ga0501040_0006783 | 3300049576 | Bacteria | 7424 |
| 473 | Ga0501040_0016619 | 3300049576 | Bacteria | 4876 |
| 474 | Ga0501040_0019396 | 3300049576 | Bacteria | 4523 |
| 475 | Ga0501040_0061962 | 3300049576 | Bacteria | 2573 |
| 476 | Ga0501040_0067285 | 3300049576 | Bacteria | 2469 |
| 477 | Ga0501040_0111631 | 3300049576 | Bacteria | 1912 |
| 478 | Ga0501040_0113952 | 3300049576 | Bacteria | 1892 |
| 479 | Ga0501040_0326956 | 3300049576 | Bacteria | 1097 |
| 480 | Ga0501041_0000102 | 3300049577 | Bacteria | 35437 |
| 481 | Ga0501041_0009513 | 3300049577 | Bacteria | 5729 |
| 482 | Ga0501041_0031877 | 3300049577 | Bacteria | 3186 |
| 483 | Ga0501041_0041434 | 3300049577 | Bacteria | 2797 |
| 484 | Ga0501041_0047070 | 3300049577 | Bacteria | 2625 |
| 485 | Ga0501041_0047877 | 3300049577 | Bacteria | 2603 |
| 486 | Ga0501041_0075614 | 3300049577 | Bacteria | 2071 |
| 487 | Ga0501041_0115390 | 3300049577 | Bacteria | 1667 |
| 488 | Ga0501041_0170777 | 3300049577 | Bacteria | 1361 |
| 489 | Ga0501042_0000777 | 3300049578 | Bacteria | 17428 |
| 490 | Ga0501042_0007483 | 3300049578 | Bacteria | 7156 |
| 491 | Ga0501042_0007739 | 3300049578 | Bacteria | 7058 |
| 492 | Ga0501042_0030821 | 3300049578 | Bacteria | 3792 |
| 493 | Ga0501042_0126960 | 3300049578 | Bacteria | 1837 |
| 494 | Ga0501042_0160808 | 3300049578 | Bacteria | 1620 |
| 495 | Ga0501042_0171228 | 3300049578 | Bacteria | 1566 |
| 496 | Ga0501042_0178235 | 3300049578 | Bacteria | 1533 |
| 497 | Ga0501042_0291500 | 3300049578 | Bacteria | 1179 |
| 498 | Ga0501042_0427570 | 3300049578 | Bacteria | 960 |
| 499 | Ga0501043_0029257 | 3300049579 | Bacteria | 4327 |
| 500 | Ga0501043_0180607 | 3300049579 | Bacteria | 1644 |
| 501 | Ga0501046_0000609 | 3300049580 | Bacteria | 35206 |
| 502 | Ga0501046_0002061 | 3300049580 | Bacteria | 19077 |
| 503 | Ga0501046_0074003 | 3300049580 | Bacteria | 2643 |
| 504 | Ga0501047_0056714 | 3300049581 | Bacteria | 3789 |
| 505 | Ga0501048_0009507 | 3300049582 | Bacteria | 7297 |
| 506 | Ga0501048_0018520 | 3300049582 | Bacteria | 5118 |
| 507 | Ga0501048_0021144 | 3300049582 | Bacteria | 4765 |
| 508 | Ga0501048_0058521 | 3300049582 | Bacteria | 2731 |
| 509 | Ga0501048_0076147 | 3300049582 | Bacteria | 2368 |
| 510 | Ga0501048_0095448 | 3300049582 | Bacteria | 2097 |
| 511 | Ga0501067_0048491 | 3300049583 | Bacteria | 2355 |
| 512 | Ga0501068_0019384 | 3300049584 | Bacteria | 3950 |
| 513 | Ga0501068_0030991 | 3300049584 | Bacteria | 3175 |
| 514 | Ga0501068_0047035 | 3300049584 | Bacteria | 2602 |
| 515 | Ga0501068_0064635 | 3300049584 | Bacteria | 2227 |
| 516 | Ga0501068_0087739 | 3300049584 | Bacteria | 1916 |
| 517 | Ga0501068_0167374 | 3300049584 | Bacteria | 1386 |
| 518 | Ga0501069_0007927 | 3300049585 | Bacteria | 5578 |
| 519 | Ga0501069_0089197 | 3300049585 | Bacteria | 1743 |
| 520 | Ga0501070_0070558 | 3300049586 | Bacteria | 2893 |
| 521 | Ga0501071_0000736 | 3300049587 | Bacteria | 17318 |
| 522 | Ga0501071_0006665 | 3300049587 | Bacteria | 7504 |
| 523 | Ga0501071_0124817 | 3300049587 | Bacteria | 1910 |
| 524 | Ga0501071_0157789 | 3300049587 | Bacteria | 1695 |
| 525 | Ga0501072_0002055 | 3300049588 | Bacteria | 14964 |
| 526 | Ga0501072_0015809 | 3300049588 | Bacteria | 5786 |
| 527 | Ga0501072_0025773 | 3300049588 | Bacteria | 4581 |
| 528 | Ga0501072_0059434 | 3300049588 | Bacteria | 3014 |
| 529 | Ga0501072_0116890 | 3300049588 | Bacteria | 2124 |
| 530 | Ga0501072_0124331 | 3300049588 | Bacteria | 2055 |
| 531 | Ga0501074_0005624 | 3300049590 | Bacteria | 9026 |
| 532 | Ga0501074_0019321 | 3300049590 | Bacteria | 4950 |
| 533 | Ga0501074_0021260 | 3300049590 | Bacteria | 4712 |
| 534 | Ga0501074_0102039 | 3300049590 | Bacteria | 2054 |
| 535 | Ga0501074_0182597 | 3300049590 | Bacteria | 1496 |
| 536 | Ga0501075_0000122 | 3300049591 | Bacteria | 37780 |
| 537 | Ga0501075_0000396 | 3300049591 | Bacteria | 25290 |
| 538 | Ga0501075_0014948 | 3300049591 | Bacteria | 5567 |
| 539 | Ga0501075_0026576 | 3300049591 | Bacteria | 4263 |
| 540 | Ga0501075_0062305 | 3300049591 | Bacteria | 2811 |
| 541 | Ga0501075_0076372 | 3300049591 | Bacteria | 2534 |
| 542 | Ga0501075_0097421 | 3300049591 | Bacteria | 2232 |
| 543 | Ga0501075_0121655 | 3300049591 | Bacteria | 1986 |
| 544 | Ga0501075_0205952 | 3300049591 | Bacteria | 1500 |
| 545 | Ga0501076_0000012 | 3300049592 | Bacteria | 113396 |
| 546 | Ga0501076_0001680 | 3300049592 | Bacteria | 14960 |
| 547 | Ga0501076_0002878 | 3300049592 | Bacteria | 11918 |
| 548 | Ga0501076_0021226 | 3300049592 | Bacteria | 4980 |
| 549 | Ga0501076_0024534 | 3300049592 | Bacteria | 4661 |
| 550 | Ga0501076_0027487 | 3300049592 | Bacteria | 4411 |
| 551 | Ga0501076_0065644 | 3300049592 | Bacteria | 2895 |
| 552 | Ga0501076_0110518 | 3300049592 | Bacteria | 2222 |
| 553 | Ga0501076_0130234 | 3300049592 | Bacteria | 2040 |
| 554 | Ga0501076_0332088 | 3300049592 | Bacteria | 1247 |
| 555 | Ga0501077_0000286 | 3300049593 | Bacteria | 30007 |
| 556 | Ga0501077_0009924 | 3300049593 | Bacteria | 5926 |
| 557 | Ga0501077_0009995 | 3300049593 | Bacteria | 5905 |
| 558 | Ga0501077_0018034 | 3300049593 | Bacteria | 4461 |
| 559 | Ga0501077_0045440 | 3300049593 | Bacteria | 2790 |
| 560 | Ga0501077_0046484 | 3300049593 | Bacteria | 2757 |
| 561 | Ga0501077_0063696 | 3300049593 | Bacteria | 2339 |
| 562 | Ga0501077_0092273 | 3300049593 | Bacteria | 1919 |
| 563 | Ga0501077_0118791 | 3300049593 | Bacteria | 1675 |
| 564 | Ga0501077_0121342 | 3300049593 | Bacteria | 1657 |
| 565 | Ga0501079_0000134 | 3300049741 | Bacteria | 40016 |
| 566 | Ga0501079_0001185 | 3300049741 | Bacteria | 18261 |
| 567 | Ga0501079_0008164 | 3300049741 | Bacteria | 7935 |
| 568 | Ga0501079_0011862 | 3300049741 | Bacteria | 6649 |
| 569 | Ga0501079_0017090 | 3300049741 | Bacteria | 5540 |
| 570 | Ga0501079_0018925 | 3300049741 | Bacteria | 5262 |
| 571 | Ga0501079_0041859 | 3300049741 | Bacteria | 3537 |
| 572 | Ga0501079_0059765 | 3300049741 | Bacteria | 2940 |
| 573 | Ga0501079_0115618 | 3300049741 | Bacteria | 2085 |
| 574 | Ga0501079_0333676 | 3300049741 | Bacteria | 1188 |
| 575 | Ga0501080_0000292 | 3300049742 | Bacteria | 38028 |
| 576 | Ga0501080_0059941 | 3300049742 | Bacteria | 3542 |
| 577 | Ga0501080_0113479 | 3300049742 | Bacteria | 2512 |
| 578 | Ga0501080_0122207 | 3300049742 | Bacteria | 2412 |
| 579 | Ga0501080_0138368 | 3300049742 | Bacteria | 2252 |
| 580 | Ga0501080_0312189 | 3300049742 | Bacteria | 1425 |
| 581 | Ga0501081_0001033 | 3300049743 | Bacteria | 16654 |
| 582 | Ga0501081_0001499 | 3300049743 | Bacteria | 14316 |
| 583 | Ga0501081_0003182 | 3300049743 | Bacteria | 10436 |
| 584 | Ga0501081_0006424 | 3300049743 | Bacteria | 7628 |
| 585 | Ga0501081_0008697 | 3300049743 | Bacteria | 6598 |
| 586 | Ga0501081_0010620 | 3300049743 | Bacteria | 6013 |
| 587 | Ga0501081_0016788 | 3300049743 | Bacteria | 4840 |
| 588 | Ga0501081_0021956 | 3300049743 | Bacteria | 4265 |
| 589 | Ga0501081_0036313 | 3300049743 | Bacteria | 3360 |
| 590 | Ga0501081_0049117 | 3300049743 | Bacteria | 2904 |
| 591 | Ga0501081_0112229 | 3300049743 | Bacteria | 1935 |
| 592 | Ga0501081_0197000 | 3300049743 | Bacteria | 1460 |
| 593 | Ga0501081_0422390 | 3300049743 | Bacteria | 988 |
| 594 | Ga0501083_0031778 | 3300049744 | Bacteria | 3623 |
| 595 | Ga0501083_0103576 | 3300049744 | Bacteria | 1875 |
| 596 | Ga0501083_0113204 | 3300049744 | Bacteria | 1783 |
| 597 | Ga0501035_0006607 | 3300049822 | Bacteria | 10855 |
| 598 | Ga0501035_0048808 | 3300049822 | Bacteria | 3795 |
| 599 | Ga0501035_0415821 | 3300049822 | Bacteria | 1117 |
| 600 | Ga0501035_0451103 | 3300049822 | Bacteria | 1064 |
| 601 | Ga0501045_0002290 | 3300049824 | Bacteria | 12977 |
| 602 | Ga0501045_0024468 | 3300049824 | Bacteria | 4336 |
| 603 | Ga0501045_0062629 | 3300049824 | Bacteria | 2730 |
| 604 | Ga0501045_0073786 | 3300049824 | Bacteria | 2513 |
| 605 | nmdc:mga05p37_141781_c1 | 3300050507 | Bacteria | 2944 |
| 606 | nmdc:mga05p37_14582_c1 | 3300050507 | Bacteria | 9438 |
| 607 | nmdc:mga05p37_196355_c1 | 3300050507 | Bacteria | 2447 |
| 608 | nmdc:mga05p37_21565_c1 | 3300050507 | Bacteria | 7806 |
| 609 | nmdc:mga05p37_23238_c1 | 3300050507 | Bacteria | 7520 |
| 610 | nmdc:mga05p37_238148_c1 | 3300050507 | Bacteria | 2190 |
| 611 | nmdc:mga05p37_28205_c1 | 3300050507 | Bacteria | 6844 |
| 612 | nmdc:mga05p37_300449_c1 | 3300050507 | Bacteria | 1908 |
| 613 | nmdc:mga05p37_331825_c1 | 3300050507 | Bacteria | 1796 |
| 614 | nmdc:mga05p37_35596_c1 | 3300050507 | Bacteria | 6106 |
| 615 | nmdc:mga05p37_4063_c1 | 3300050507 | Bacteria | 17103 |
| 616 | nmdc:mga05p37_407123_c1 | 3300050507 | Unclassified | 1587 |
| 617 | nmdc:mga05p37_49894_c1 | 3300050507 | Bacteria | 5148 |
| 618 | nmdc:mga05p37_743528_c1 | 3300050507 | Bacteria | 1082 |
| 619 | nmdc:mga05p37_85453_c1 | 3300050507 | Bacteria | 3888 |
| 620 | nmdc:mga05p37_89_c1 | 3300050507 | Bacteria | 81482 |
| 621 | nmdc:mga09592_1406_c1 | 3300050508 | Bacteria | 19268 |
| 622 | nmdc:mga09592_144514_c1 | 3300050508 | Bacteria | 2051 |
| 623 | nmdc:mga09592_21339_c1 | 3300050508 | Bacteria | 5338 |
| 624 | nmdc:mga09592_310142_c1 | 3300050508 | Bacteria | 1367 |
| 625 | nmdc:mga09592_6345_c1 | 3300050508 | Bacteria | 9637 |
| 626 | nmdc:mga09592_837_c1 | 3300050508 | Bacteria | 23885 |
| 627 | nmdc:mga0qj67_167798_c1 | 3300050509 | Bacteria | 1782 |
| 628 | nmdc:mga0qj67_22992_c1 | 3300050509 | Bacteria | 4790 |
| 629 | nmdc:mga0qj67_272243_c1 | 3300050509 | Bacteria | 1373 |
| 630 | nmdc:mga0qj67_343_c1 | 3300050509 | Bacteria | 32121 |
| 631 | nmdc:mga0qj67_43339_c1 | 3300050509 | Bacteria | 3544 |
| 632 | nmdc:mga0qj67_798_c1 | 3300050509 | Bacteria | 21472 |
| 633 | nmdc:mga06r32_10348_c1 | 3300050510 | Bacteria | 8414 |
| 634 | nmdc:mga06r32_14068_c1 | 3300050510 | Bacteria | 7257 |
| 635 | nmdc:mga06r32_176697_c1 | 3300050510 | Bacteria | 2120 |
| 636 | nmdc:mga06r32_204473_c1 | 3300050510 | Bacteria | 1962 |
| 637 | nmdc:mga06r32_32294_c1 | 3300050510 | Bacteria | 4924 |
| 638 | nmdc:mga06r32_460165_c1 | 3300050510 | Bacteria | 1251 |
| 639 | nmdc:mga06r32_4631_c1 | 3300050510 | Bacteria | 12337 |
| 640 | nmdc:mga06r32_469340_c1 | 3300050510 | Bacteria | 1237 |
| 641 | nmdc:mga06r32_790916_c1 | 3300050510 | Bacteria | 910 |
| 642 | nmdc:mga06r32_87705_c1 | 3300050510 | Bacteria | 3037 |
| 643 | nmdc:mga08y16_1016574_c1 | 3300050511 | Bacteria | 808 |
| 644 | nmdc:mga08y16_108945_c1 | 3300050511 | Bacteria | 2884 |
| 645 | nmdc:mga08y16_1417_c1 | 3300050511 | Bacteria | 24061 |
| 646 | nmdc:mga08y16_158513_c1 | 3300050511 | Bacteria | 2352 |
| 647 | nmdc:mga08y16_163309_c1 | 3300050511 | Bacteria | 2314 |
| 648 | nmdc:mga08y16_2945_c1 | 3300050511 | Bacteria | 17531 |
| 649 | nmdc:mga08y16_420122_c1 | 3300050511 | Bacteria | 1366 |
| 650 | nmdc:mga08y16_90439_c1 | 3300050511 | Bacteria | 3191 |
| 651 | nmdc:mga0n895_176870_c1 | 3300050512 | Bacteria | 2165 |
| 652 | nmdc:mga0n895_203_c1 | 3300050512 | Bacteria | 21253 |
| 653 | nmdc:mga0n895_271662_c1 | 3300050512 | Bacteria | 1720 |
| 654 | nmdc:mga0n895_35010_c1 | 3300050512 | Bacteria | 4838 |
| 655 | nmdc:mga0n895_357894_c1 | 3300050512 | Bacteria | 1478 |
| 656 | nmdc:mga0n895_41940_c1 | 3300050512 | Bacteria | 4451 |
| 657 | nmdc:mga0n895_43098_c1 | 3300050512 | Bacteria | 4396 |
| 658 | nmdc:mga0n895_61867_c1 | 3300050512 | Bacteria | 3698 |
| 659 | nmdc:mga0n895_657044_c1 | 3300050512 | Unclassified | 1047 |
| 660 | nmdc:mga0n895_883841_c1 | 3300050512 | Bacteria | 880 |
| 661 | nmdc:mga0n895_88977_c1 | 3300050512 | Bacteria | 3088 |
| 662 | nmdc:mga0rr50_694_c1 | 3300050513 | Bacteria | 18015 |
| 663 | nmdc:mga0rr50_88479_c1 | 3300050513 | Bacteria | 2406 |
| 664 | nmdc:mga08x19_153171_c1 | 3300050514 | Bacteria | 1562 |
| 665 | nmdc:mga08x19_29864_c1 | 3300050514 | Bacteria | 3421 |
| 666 | nmdc:mga08x19_397209_c1 | 3300050514 | Bacteria | 967 |
| 667 | nmdc:mga08x19_4220_c1 | 3300050514 | Bacteria | 8518 |
| 668 | nmdc:mga08x19_470_c1 | 3300050514 | Bacteria | 27216 |
| 669 | nmdc:mga08x19_7471_c1 | 3300050514 | Bacteria | 6491 |
| 670 | nmdc:mga0a205_12060_c1 | 3300050515 | Bacteria | 7985 |
| 671 | nmdc:mga0a205_123700_c1 | 3300050515 | Bacteria | 2487 |
| 672 | nmdc:mga0a205_15170_c1 | 3300050515 | Bacteria | 7197 |
| 673 | nmdc:mga0a205_156982_c1 | 3300050515 | Bacteria | 2173 |
| 674 | nmdc:mga0a205_205119_c1 | 3300050515 | Bacteria | 1861 |
| 675 | nmdc:mga0a205_22996_c1 | 3300050515 | Bacteria | 5910 |
| 676 | nmdc:mga0a205_23223_c1 | 3300050515 | Bacteria | 2949 |
| 677 | nmdc:mga0a205_24042_c1 | 3300050515 | Bacteria | 5786 |
| 678 | nmdc:mga0a205_420270_c1 | 3300050515 | Bacteria | 1199 |
| 679 | nmdc:mga0a205_5896_c1 | 3300050515 | Bacteria | 11035 |
| 680 | nmdc:mga0a205_66914_c2 | 3300050515 | Bacteria | 2986 |
| 681 | nmdc:mga0a205_76617_c1 | 3300050515 | Bacteria | 3232 |
| 682 | Ga0501084_0000300 | 3300054114 | Bacteria | 37454 |
| 683 | Ga0501084_0001169 | 3300054114 | Bacteria | 20453 |
| 684 | Ga0501084_0001730 | 3300054114 | Bacteria | 17322 |
| 685 | Ga0501084_0015809 | 3300054114 | Bacteria | 6259 |
| 686 | Ga0501084_0024553 | 3300054114 | Bacteria | 5029 |
| 687 | Ga0501084_0036762 | 3300054114 | Bacteria | 4092 |
| 688 | Ga0501084_0053423 | 3300054114 | Bacteria | 3380 |
| 689 | Ga0501084_0055736 | 3300054114 | Bacteria | 3307 |
| 690 | Ga0501084_0097754 | 3300054114 | Bacteria | 2465 |
| 691 | Ga0501084_0199873 | 3300054114 | Bacteria | 1686 |
| 692 | Ga0501084_0312606 | 3300054114 | Bacteria | 1327 |
| 693 | Ga0501084_0319994 | 3300054114 | Bacteria | 1310 |
| 694 | Ga0590071_010281 | 3300059421 | Bacteria | 2193 |
| 695 | Ga0590075_007138 | 3300059424 | Bacteria | 2650 |
| 696 | Ga0501082_0002631 | 3300060353 | Bacteria | 15690 |
| 697 | Ga0501082_0009410 | 3300060353 | Bacteria | 8414 |
| 698 | Ga0501082_0016940 | 3300060353 | Bacteria | 6274 |
| 699 | Ga0501082_0026089 | 3300060353 | Bacteria | 5037 |
| 700 | Ga0501082_0056973 | 3300060353 | Bacteria | 3367 |
| 701 | Ga0501082_0064057 | 3300060353 | Bacteria | 3166 |
| 702 | Ga0501082_0282495 | 3300060353 | Bacteria | 1445 |
| 703 | Ga0501082_0351825 | 3300060353 | Bacteria | 1284 |
| 704 | Ga0530510_0000015 | 3300061734 | Bacteria | 104554 |
| 705 | Ga0530510_0001748 | 3300061734 | Bacteria | 14807 |
| 706 | Ga0530510_0015625 | 3300061734 | Bacteria | 5364 |
| 707 | Ga0530510_0046999 | 3300061734 | Bacteria | 3118 |
| 708 | Ga0530510_0063379 | 3300061734 | Bacteria | 2676 |
| 709 | Ga0530510_0136055 | 3300061734 | Bacteria | 1809 |
| 710 | Ga0530510_0179918 | 3300061734 | Bacteria | 1568 |
| 711 | Ga0530510_0188761 | 3300061734 | Bacteria | 1529 |
| 712 | Ga0530510_0221293 | 3300061734 | Bacteria | 1407 |
| 713 | Ga0530510_0236658 | 3300061734 | Bacteria | 1359 |
| 714 | Ga0530510_0283842 | 3300061734 | Bacteria | 1237 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10383916 | Ga0105239_103839162 | 230 |
| 2 | 3300013306 | Ga0163162_11141169 | Ga0163162_111411691 | 230 |
| 3 | 3300048913 | Ga0496110_0210918 | Ga0496110_0210918_775_1470 | 230 |
| 4 | 3300005334 | Ga0068869_100546733 | Ga0068869_1005467332 | 232 |
| 5 | 3300005338 | Ga0068868_100256546 | Ga0068868_1002565462 | 232 |
| 6 | 3300005545 | Ga0070695_100276227 | Ga0070695_1002762272 | 232 |
| 7 | 3300005578 | Ga0068854_100484107 | Ga0068854_1004841071 | 232 |
| 8 | 3300025923 | Ga0207681_10420961 | Ga0207681_104209611 | 232 |
| 9 | 3300025981 | Ga0207640_10100394 | Ga0207640_101003941 | 232 |
| 10 | 3300026023 | Ga0207677_10228346 | Ga0207677_102283462 | 232 |
| 11 | 3300045051 | Ga0451576_0599263 | Ga0451576_0599263_409_1131 | 232 |
| 12 | 3300050511 | nmdc:mga08y16_90439_c1 | nmdc:mga08y16_90439_c1_782_1582 | 232 |
| 13 | 3300050515 | nmdc:mga0a205_22996_c1 | nmdc:mga0a205_22996_c1_3517_4317 | 232 |
| 14 | 3300050511 | nmdc:mga08y16_1016574_c1 | nmdc:mga08y16_1016574_c1_32_769 | 234 |
| 15 | 3300049576 | Ga0501040_0006783 | Ga0501040_0006783_6003_6824 | 239 |
| 16 | 3300049577 | Ga0501041_0041434 | Ga0501041_0041434_1028_1849 | 239 |
| 17 | 3300049578 | Ga0501042_0007739 | Ga0501042_0007739_1358_2179 | 239 |
| 18 | 3300049580 | Ga0501046_0002061 | Ga0501046_0002061_731_1552 | 239 |
| 19 | 3300049581 | Ga0501047_0056714 | Ga0501047_0056714_2750_3571 | 239 |
| 20 | 3300049582 | Ga0501048_0058521 | Ga0501048_0058521_892_1713 | 239 |
| 21 | 3300049584 | Ga0501068_0064635 | Ga0501068_0064635_921_1742 | 239 |
| 22 | 3300049588 | Ga0501072_0116890 | Ga0501072_0116890_480_1301 | 239 |
| 23 | 3300049590 | Ga0501074_0019321 | Ga0501074_0019321_2177_2998 | 239 |
| 24 | 3300049591 | Ga0501075_0097421 | Ga0501075_0097421_290_1111 | 239 |
| 25 | 3300049592 | Ga0501076_0021226 | Ga0501076_0021226_2103_2924 | 239 |
| 26 | 3300049741 | Ga0501079_0001185 | Ga0501079_0001185_16397_17218 | 239 |
| 27 | 3300049743 | Ga0501081_0016788 | Ga0501081_0016788_957_1778 | 239 |
| 28 | 3300049744 | Ga0501083_0031778 | Ga0501083_0031778_1109_1930 | 239 |
| 29 | 3300049822 | Ga0501035_0451103 | Ga0501035_0451103_159_980 | 239 |
| 30 | 3300054114 | Ga0501084_0000300 | Ga0501084_0000300_36127_36948 | 239 |
| 31 | 3300060353 | Ga0501082_0064057 | Ga0501082_0064057_989_1810 | 239 |
| 32 | 3300061734 | Ga0530510_0046999 | Ga0530510_0046999_188_1009 | 239 |
| 33 | 3300006178 | Ga0075367_10339685 | Ga0075367_103396852 | 240 |
| 34 | 3300014968 | Ga0157379_10190827 | Ga0157379_101908272 | 240 |
| 35 | 3300046684 | Ga0495669_0185321 | Ga0495669_0185321_19_744 | 240 |
| 36 | 3300049575 | Ga0501039_0147603 | Ga0501039_0147603_75_842 | 240 |
| 37 | 3300049577 | Ga0501041_0047877 | Ga0501041_0047877_38_805 | 240 |
| 38 | 3300049582 | Ga0501048_0095448 | Ga0501048_0095448_399_1166 | 240 |
| 39 | 3300049584 | Ga0501068_0019384 | Ga0501068_0019384_1291_2058 | 240 |
| 40 | 3300049591 | Ga0501075_0205952 | Ga0501075_0205952_347_1114 | 240 |
| 41 | 3300049592 | Ga0501076_0027487 | Ga0501076_0027487_2572_3339 | 240 |
| 42 | 3300049593 | Ga0501077_0063696 | Ga0501077_0063696_1413_2180 | 240 |
| 43 | 3300049741 | Ga0501079_0059765 | Ga0501079_0059765_1998_2765 | 240 |
| 44 | 3300049743 | Ga0501081_0049117 | Ga0501081_0049117_2122_2889 | 240 |
| 45 | 3300049822 | Ga0501035_0415821 | Ga0501035_0415821_12_779 | 240 |
| 46 | 3300054114 | Ga0501084_0319994 | Ga0501084_0319994_440_1207 | 240 |
| 47 | 3300060353 | Ga0501082_0026089 | Ga0501082_0026089_3008_3775 | 240 |
| 48 | 3300005467 | Ga0070706_100062204 | Ga0070706_1000622042 | 241 |
| 49 | 3300005468 | Ga0070707_100000108 | Ga0070707_10000010827 | 241 |
| 50 | 3300005719 | Ga0068861_100018775 | Ga0068861_1000187752 | 241 |
| 51 | 3300006852 | Ga0075433_10032400 | Ga0075433_100324005 | 241 |
| 52 | 3300006871 | Ga0075434_100163988 | Ga0075434_1001639882 | 241 |
| 53 | 3300006914 | Ga0075436_100146490 | Ga0075436_1001464902 | 241 |
| 54 | 3300009147 | Ga0114129_10012726 | Ga0114129_100127262 | 241 |
| 55 | 3300010375 | Ga0105239_10016176 | Ga0105239_100161766 | 241 |
| 56 | 3300013306 | Ga0163162_10017085 | Ga0163162_100170857 | 241 |
| 57 | 3300026118 | Ga0207675_100002639 | Ga0207675_10000263912 | 241 |
| 58 | 3300050507 | nmdc:mga05p37_407123_c1 | nmdc:mga05p37_407123_c1_313_1077 | 241 |
| 59 | 3300050512 | nmdc:mga0n895_657044_c1 | nmdc:mga0n895_657044_c1_121_885 | 241 |
| 60 | 3300050515 | nmdc:mga0a205_15170_c1 | nmdc:mga0a205_15170_c1_4883_5647 | 241 |
| 61 | 3300050515 | nmdc:mga0a205_76617_c1 | nmdc:mga0a205_76617_c1_12_737 | 241 |
| 62 | 3300049578 | Ga0501042_0427570 | Ga0501042_0427570_209_943 | 244 |
| 63 | 3300054114 | Ga0501084_0312606 | Ga0501084_0312606_579_1313 | 244 |
| 64 | 3300005295 | Ga0065707_10134579 | Ga0065707_101345792 | 245 |
| 65 | 3300005345 | Ga0070692_10250019 | Ga0070692_102500192 | 245 |
| 66 | 3300006844 | Ga0075428_100023900 | Ga0075428_1000239003 | 245 |
| 67 | 3300006852 | Ga0075433_10056759 | Ga0075433_100567594 | 245 |
| 68 | 3300006871 | Ga0075434_100167389 | Ga0075434_1001673892 | 245 |
| 69 | 3300006880 | Ga0075429_100011531 | Ga0075429_1000115314 | 245 |
| 70 | 3300009094 | Ga0111539_10018495 | Ga0111539_100184953 | 245 |
| 71 | 3300009147 | Ga0114129_10102978 | Ga0114129_101029783 | 245 |
| 72 | 3300025933 | Ga0207706_10131427 | Ga0207706_101314272 | 245 |
| 73 | 3300027462 | Ga0210000_1017209 | Ga0210000_10172092 | 245 |
| 74 | 3300027907 | Ga0207428_10141454 | Ga0207428_101414543 | 245 |
| 75 | 3300050507 | nmdc:mga05p37_49894_c1 | nmdc:mga05p37_49894_c1_332_1126 | 245 |
| 76 | 3300050510 | nmdc:mga06r32_460165_c1 | nmdc:mga06r32_460165_c1_363_1157 | 245 |
| 77 | 3300050511 | nmdc:mga08y16_158513_c1 | nmdc:mga08y16_158513_c1_973_1767 | 245 |
| 78 | 3300050512 | nmdc:mga0n895_176870_c1 | nmdc:mga0n895_176870_c1_778_1578 | 245 |
| 79 | 3300050515 | nmdc:mga0a205_12060_c1 | nmdc:mga0a205_12060_c1_2014_2814 | 245 |
| 80 | 3300050515 | nmdc:mga0a205_23223_c1 | nmdc:mga0a205_23223_c1_1691_2485 | 245 |
| 81 | 3300005336 | Ga0070680_100135883 | Ga0070680_1001358832 | 247 |
| 82 | 3300005535 | Ga0070684_100164633 | Ga0070684_1001646332 | 247 |
| 83 | 3300005578 | Ga0068854_100626729 | Ga0068854_1006267291 | 247 |
| 84 | 3300005844 | Ga0068862_100087038 | Ga0068862_1000870381 | 247 |
| 85 | 3300006852 | Ga0075433_10082435 | Ga0075433_100824352 | 247 |
| 86 | 3300009094 | Ga0111539_10000535 | Ga0111539_100005352 | 247 |
| 87 | 3300009094 | Ga0111539_10114639 | Ga0111539_101146392 | 247 |
| 88 | 3300009147 | Ga0114129_10225093 | Ga0114129_102250933 | 247 |
| 89 | 3300027907 | Ga0207428_10000394 | Ga0207428_100003947 | 247 |
| 90 | 3300028380 | Ga0268265_10024098 | Ga0268265_100240982 | 247 |
| 91 | 3300042876 | Ga0451577_0025265 | Ga0451577_0025265_476_1276 | 247 |
| 92 | 3300044673 | Ga0453683_0005950 | Ga0453683_0005950_4752_5552 | 247 |
| 93 | 3300044712 | Ga0453684_0032377 | Ga0453684_0032377_4897_5697 | 247 |
| 94 | 3300045051 | Ga0451576_0049195 | Ga0451576_0049195_2963_3763 | 247 |
| 95 | 3300050511 | nmdc:mga08y16_1417_c1 | nmdc:mga08y16_1417_c1_5813_6613 | 247 |
| 96 | 3300050512 | nmdc:mga0n895_35010_c1 | nmdc:mga0n895_35010_c1_1960_2760 | 247 |
| 97 | 3300050515 | nmdc:mga0a205_24042_c1 | nmdc:mga0a205_24042_c1_3289_4089 | 247 |
| 98 | 3300034820 | Ga0373959_0013857 | Ga0373959_0013857_29_838 | 248 |
| 99 | 3300061734 | Ga0530510_0283842 | Ga0530510_0283842_187_954 | 248 |
| 100 | 3300049743 | Ga0501081_0197000 | Ga0501081_0197000_467_1318 | 249 |
| 101 | 3300005445 | Ga0070708_100186897 | Ga0070708_1001868972 | 250 |
| 102 | 3300006852 | Ga0075433_10062927 | Ga0075433_100629272 | 250 |
| 103 | 3300009553 | Ga0105249_10227328 | Ga0105249_102273283 | 250 |
| 104 | 3300005983 | Ga0081540_1005034 | Ga0081540_10050344 | 251 |
| 105 | 3300049568 | Ga0501031_0090122 | Ga0501031_0090122_48_857 | 251 |
| 106 | 3300009147 | Ga0114129_10000606 | Ga0114129_1000060611 | 252 |
| 107 | 3300050507 | nmdc:mga05p37_4063_c1 | nmdc:mga05p37_4063_c1_10076_10909 | 252 |
| 108 | 3300044673 | Ga0453683_0060352 | Ga0453683_0060352_511_1314 | 253 |
| 109 | 3300049576 | Ga0501040_0326956 | Ga0501040_0326956_133_951 | 253 |
| 110 | 3300005334 | Ga0068869_100046889 | Ga0068869_1000468892 | 254 |
| 111 | 3300005345 | Ga0070692_10046023 | Ga0070692_100460232 | 254 |
| 112 | 3300005364 | Ga0070673_100447972 | Ga0070673_1004479722 | 254 |
| 113 | 3300005365 | Ga0070688_100064606 | Ga0070688_1000646062 | 254 |
| 114 | 3300005441 | Ga0070700_100477935 | Ga0070700_1004779351 | 254 |
| 115 | 3300005444 | Ga0070694_100075232 | Ga0070694_1000752322 | 254 |
| 116 | 3300005455 | Ga0070663_100480325 | Ga0070663_1004803251 | 254 |
| 117 | 3300005545 | Ga0070695_100082910 | Ga0070695_1000829102 | 254 |
| 118 | 3300005547 | Ga0070693_100338664 | Ga0070693_1003386641 | 254 |
| 119 | 3300005578 | Ga0068854_100511278 | Ga0068854_1005112781 | 254 |
| 120 | 3300005718 | Ga0068866_10267607 | Ga0068866_102676072 | 254 |
| 121 | 3300005844 | Ga0068862_100143465 | Ga0068862_1001434652 | 254 |
| 122 | 3300009094 | Ga0111539_10249379 | Ga0111539_102493792 | 254 |
| 123 | 3300009148 | Ga0105243_10275853 | Ga0105243_102758532 | 254 |
| 124 | 3300009553 | Ga0105249_10082436 | Ga0105249_100824362 | 254 |
| 125 | 3300013306 | Ga0163162_10361522 | Ga0163162_103615222 | 254 |
| 126 | 3300014326 | Ga0157380_10135536 | Ga0157380_101355361 | 254 |
| 127 | 3300014968 | Ga0157379_10414095 | Ga0157379_104140952 | 254 |
| 128 | 3300025899 | Ga0207642_10233978 | Ga0207642_102339782 | 254 |
| 129 | 3300025933 | Ga0207706_10468686 | Ga0207706_104686862 | 254 |
| 130 | 3300025935 | Ga0207709_10071982 | Ga0207709_100719822 | 254 |
| 131 | 3300025942 | Ga0207689_10074531 | Ga0207689_100745312 | 254 |
| 132 | 3300025961 | Ga0207712_10347335 | Ga0207712_103473352 | 254 |
| 133 | 3300025961 | Ga0207712_10547631 | Ga0207712_105476311 | 254 |
| 134 | 3300025981 | Ga0207640_10476418 | Ga0207640_104764181 | 254 |
| 135 | 3300025986 | Ga0207658_10165220 | Ga0207658_101652202 | 254 |
| 136 | 3300026035 | Ga0207703_10318461 | Ga0207703_103184612 | 254 |
| 137 | 3300026067 | Ga0207678_10253752 | Ga0207678_102537521 | 254 |
| 138 | 3300026075 | Ga0207708_10396790 | Ga0207708_103967902 | 254 |
| 139 | 3300026075 | Ga0207708_10456647 | Ga0207708_104566471 | 254 |
| 140 | 3300028380 | Ga0268265_10088185 | Ga0268265_100881853 | 254 |
| 141 | 3300042436 | Ga0439435_0042049 | Ga0439435_0042049_253_1098 | 254 |
| 142 | 3300049576 | Ga0501040_0061962 | Ga0501040_0061962_1556_2410 | 254 |
| 143 | 3300049577 | Ga0501041_0047070 | Ga0501041_0047070_819_1673 | 254 |
| 144 | 3300049578 | Ga0501042_0171228 | Ga0501042_0171228_686_1540 | 254 |
| 145 | 3300049593 | Ga0501077_0046484 | Ga0501077_0046484_381_1235 | 254 |
| 146 | 3300049741 | Ga0501079_0115618 | Ga0501079_0115618_973_1827 | 254 |
| 147 | 3300049742 | Ga0501080_0138368 | Ga0501080_0138368_512_1366 | 254 |
| 148 | 3300049743 | Ga0501081_0010620 | Ga0501081_0010620_4512_5366 | 254 |
| 149 | 3300054114 | Ga0501084_0036762 | Ga0501084_0036762_2151_3005 | 254 |
| 150 | 3300060353 | Ga0501082_0016940 | Ga0501082_0016940_1836_2690 | 254 |
| 151 | 3300005445 | Ga0070708_100075366 | Ga0070708_1000753662 | 255 |
| 152 | 3300005468 | Ga0070707_100017934 | Ga0070707_1000179346 | 255 |
| 153 | 3300005471 | Ga0070698_100000691 | Ga0070698_10000069119 | 255 |
| 154 | 3300005518 | Ga0070699_100013570 | Ga0070699_1000135706 | 255 |
| 155 | 3300005536 | Ga0070697_100124263 | Ga0070697_1001242631 | 255 |
| 156 | 3300025922 | Ga0207646_10000250 | Ga0207646_1000025039 | 255 |
| 157 | 3300042876 | Ga0451577_0010038 | Ga0451577_0010038_1134_1952 | 255 |
| 158 | 3300044673 | Ga0453683_0013136 | Ga0453683_0013136_766_1584 | 255 |
| 159 | 3300045051 | Ga0451576_0036861 | Ga0451576_0036861_1469_2287 | 255 |
| 160 | 3300049578 | Ga0501042_0291500 | Ga0501042_0291500_35_829 | 255 |
| 161 | 3300005334 | Ga0068869_100114011 | Ga0068869_1001140112 | 256 |
| 162 | 3300005345 | Ga0070692_10001115 | Ga0070692_100011157 | 256 |
| 163 | 3300005353 | Ga0070669_100414852 | Ga0070669_1004148522 | 256 |
| 164 | 3300005438 | Ga0070701_10069613 | Ga0070701_100696132 | 256 |
| 165 | 3300005440 | Ga0070705_100035395 | Ga0070705_1000353952 | 256 |
| 166 | 3300005440 | Ga0070705_100140294 | Ga0070705_1001402942 | 256 |
| 167 | 3300005441 | Ga0070700_100026807 | Ga0070700_1000268072 | 256 |
| 168 | 3300005444 | Ga0070694_100248203 | Ga0070694_1002482032 | 256 |
| 169 | 3300005459 | Ga0068867_100547178 | Ga0068867_1005471782 | 256 |
| 170 | 3300005471 | Ga0070698_100258778 | Ga0070698_1002587782 | 256 |
| 171 | 3300005518 | Ga0070699_100061434 | Ga0070699_1000614341 | 256 |
| 172 | 3300005536 | Ga0070697_100285780 | Ga0070697_1002857802 | 256 |
| 173 | 3300005546 | Ga0070696_100036054 | Ga0070696_1000360543 | 256 |
| 174 | 3300005549 | Ga0070704_100046308 | Ga0070704_1000463082 | 256 |
| 175 | 3300005841 | Ga0068863_100032824 | Ga0068863_1000328244 | 256 |
| 176 | 3300005981 | Ga0081538_10015371 | Ga0081538_100153715 | 256 |
| 177 | 3300006163 | Ga0070715_10016204 | Ga0070715_100162042 | 256 |
| 178 | 3300006175 | Ga0070712_100006589 | Ga0070712_1000065894 | 256 |
| 179 | 3300006847 | Ga0075431_100023868 | Ga0075431_1000238682 | 256 |
| 180 | 3300006871 | Ga0075434_100087316 | Ga0075434_1000873162 | 256 |
| 181 | 3300006914 | Ga0075436_100041000 | Ga0075436_1000410002 | 256 |
| 182 | 3300007076 | Ga0075435_100000661 | Ga0075435_10000066114 | 256 |
| 183 | 3300009147 | Ga0114129_10079508 | Ga0114129_100795085 | 256 |
| 184 | 3300009148 | Ga0105243_10007774 | Ga0105243_100077747 | 256 |
| 185 | 3300009174 | Ga0105241_10133370 | Ga0105241_101333702 | 256 |
| 186 | 3300009176 | Ga0105242_10016052 | Ga0105242_100160523 | 256 |
| 187 | 3300009177 | Ga0105248_10472423 | Ga0105248_104724232 | 256 |
| 188 | 3300009553 | Ga0105249_10779791 | Ga0105249_107797912 | 256 |
| 189 | 3300013306 | Ga0163162_10316041 | Ga0163162_103160412 | 256 |
| 190 | 3300025911 | Ga0207654_10082136 | Ga0207654_100821362 | 256 |
| 191 | 3300025915 | Ga0207693_10025215 | Ga0207693_100252154 | 256 |
| 192 | 3300025935 | Ga0207709_10003271 | Ga0207709_100032714 | 256 |
| 193 | 3300025941 | Ga0207711_10418118 | Ga0207711_104181182 | 256 |
| 194 | 3300026075 | Ga0207708_10135745 | Ga0207708_101357452 | 256 |
| 195 | 3300026089 | Ga0207648_10752173 | Ga0207648_107521731 | 256 |
| 196 | 3300028381 | Ga0268264_10155527 | Ga0268264_101555273 | 256 |
| 197 | 3300028381 | Ga0268264_10216801 | Ga0268264_102168012 | 256 |
| 198 | 3300042461 | Ga0439460_0058949 | Ga0439460_0058949_212_1009 | 256 |
| 199 | 3300044673 | Ga0453683_0003008 | Ga0453683_0003008_6463_7281 | 256 |
| 200 | 3300050507 | nmdc:mga05p37_141781_c1 | nmdc:mga05p37_141781_c1_1852_2640 | 256 |
| 201 | 3300050508 | nmdc:mga09592_21339_c1 | nmdc:mga09592_21339_c1_3475_4263 | 256 |
| 202 | 3300050510 | nmdc:mga06r32_14068_c1 | nmdc:mga06r32_14068_c1_5037_5834 | 256 |
| 203 | 3300050512 | nmdc:mga0n895_271662_c1 | nmdc:mga0n895_271662_c1_247_1044 | 256 |
| 204 | 3300050512 | nmdc:mga0n895_883841_c1 | nmdc:mga0n895_883841_c1_73_870 | 256 |
| 205 | 3300050514 | nmdc:mga08x19_7471_c1 | nmdc:mga08x19_7471_c1_2598_3395 | 256 |
| 206 | 3300005445 | Ga0070708_100006589 | Ga0070708_1000065892 | 257 |
| 207 | 3300005467 | Ga0070706_100117317 | Ga0070706_1001173172 | 257 |
| 208 | 3300006871 | Ga0075434_100223242 | Ga0075434_1002232422 | 257 |
| 209 | 3300025910 | Ga0207684_10148413 | Ga0207684_101484132 | 257 |
| 210 | 3300049743 | Ga0501081_0422390 | Ga0501081_0422390_49_885 | 257 |
| 211 | 3300050512 | nmdc:mga0n895_357894_c1 | nmdc:mga0n895_357894_c1_246_1091 | 257 |
| 212 | 3300050513 | nmdc:mga0rr50_88479_c1 | nmdc:mga0rr50_88479_c1_1446_2291 | 257 |
| 213 | 3300060353 | Ga0501082_0282495 | Ga0501082_0282495_529_1332 | 257 |
| 214 | 3300005518 | Ga0070699_100081230 | Ga0070699_1000812301 | 258 |
| 215 | 3300025922 | Ga0207646_10196959 | Ga0207646_101969592 | 258 |
| 216 | 3300049591 | Ga0501075_0026576 | Ga0501075_0026576_2278_3084 | 258 |
| 217 | 3300049593 | Ga0501077_0121342 | Ga0501077_0121342_742_1548 | 258 |
| 218 | 3300009147 | Ga0114129_10273784 | Ga0114129_102737843 | 259 |
| 219 | 3300049568 | Ga0501031_0003020 | Ga0501031_0003020_11_823 | 259 |
| 220 | 3300005290 | Ga0065712_10178808 | Ga0065712_101788082 | 260 |
| 221 | 3300005328 | Ga0070676_10001402 | Ga0070676_100014022 | 260 |
| 222 | 3300005329 | Ga0070683_100234008 | Ga0070683_1002340082 | 260 |
| 223 | 3300005331 | Ga0070670_100001558 | Ga0070670_1000015582 | 260 |
| 224 | 3300005334 | Ga0068869_100000795 | Ga0068869_1000007955 | 260 |
| 225 | 3300005336 | Ga0070680_100002409 | Ga0070680_10000240912 | 260 |
| 226 | 3300005337 | Ga0070682_100000179 | Ga0070682_10000017929 | 260 |
| 227 | 3300005338 | Ga0068868_100043820 | Ga0068868_1000438202 | 260 |
| 228 | 3300005339 | Ga0070660_100000476 | Ga0070660_10000047614 | 260 |
| 229 | 3300005340 | Ga0070689_100073029 | Ga0070689_1000730293 | 260 |
| 230 | 3300005341 | Ga0070691_10002169 | Ga0070691_100021691 | 260 |
| 231 | 3300005344 | Ga0070661_100000876 | Ga0070661_1000008764 | 260 |
| 232 | 3300005345 | Ga0070692_10000828 | Ga0070692_100008284 | 260 |
| 233 | 3300005353 | Ga0070669_100017830 | Ga0070669_1000178304 | 260 |
| 234 | 3300005366 | Ga0070659_100153974 | Ga0070659_1001539742 | 260 |
| 235 | 3300005440 | Ga0070705_100000333 | Ga0070705_1000003336 | 260 |
| 236 | 3300005440 | Ga0070705_100078316 | Ga0070705_1000783161 | 260 |
| 237 | 3300005441 | Ga0070700_100212381 | Ga0070700_1002123812 | 260 |
| 238 | 3300005444 | Ga0070694_100022054 | Ga0070694_1000220545 | 260 |
| 239 | 3300005455 | Ga0070663_100226349 | Ga0070663_1002263492 | 260 |
| 240 | 3300005457 | Ga0070662_100027815 | Ga0070662_1000278152 | 260 |
| 241 | 3300005458 | Ga0070681_10004124 | Ga0070681_100041242 | 260 |
| 242 | 3300005459 | Ga0068867_100000455 | Ga0068867_10000045514 | 260 |
| 243 | 3300005467 | Ga0070706_100116134 | Ga0070706_1001161342 | 260 |
| 244 | 3300005468 | Ga0070707_100261817 | Ga0070707_1002618172 | 260 |
| 245 | 3300005468 | Ga0070707_100603131 | Ga0070707_1006031312 | 260 |
| 246 | 3300005471 | Ga0070698_100011480 | Ga0070698_1000114806 | 260 |
| 247 | 3300005518 | Ga0070699_100003274 | Ga0070699_1000032742 | 260 |
| 248 | 3300005518 | Ga0070699_100224249 | Ga0070699_1002242491 | 260 |
| 249 | 3300005530 | Ga0070679_100007477 | Ga0070679_1000074772 | 260 |
| 250 | 3300005536 | Ga0070697_100093448 | Ga0070697_1000934482 | 260 |
| 251 | 3300005539 | Ga0068853_100191463 | Ga0068853_1001914632 | 260 |
| 252 | 3300005543 | Ga0070672_100287910 | Ga0070672_1002879102 | 260 |
| 253 | 3300005545 | Ga0070695_100061321 | Ga0070695_1000613213 | 260 |
| 254 | 3300005547 | Ga0070693_100009781 | Ga0070693_1000097814 | 260 |
| 255 | 3300005563 | Ga0068855_100000225 | Ga0068855_10000022558 | 260 |
| 256 | 3300005564 | Ga0070664_100017355 | Ga0070664_1000173554 | 260 |
| 257 | 3300005577 | Ga0068857_100237393 | Ga0068857_1002373932 | 260 |
| 258 | 3300005614 | Ga0068856_100001169 | Ga0068856_10000116914 | 260 |
| 259 | 3300005616 | Ga0068852_100142485 | Ga0068852_1001424852 | 260 |
| 260 | 3300005617 | Ga0068859_100001393 | Ga0068859_1000013936 | 260 |
| 261 | 3300005618 | Ga0068864_100285188 | Ga0068864_1002851882 | 260 |
| 262 | 3300005840 | Ga0068870_10000139 | Ga0068870_1000013921 | 260 |
| 263 | 3300005841 | Ga0068863_100079836 | Ga0068863_1000798362 | 260 |
| 264 | 3300005842 | Ga0068858_100189302 | Ga0068858_1001893022 | 260 |
| 265 | 3300005843 | Ga0068860_100001109 | Ga0068860_10000110914 | 260 |
| 266 | 3300005844 | Ga0068862_100003750 | Ga0068862_10000375015 | 260 |
| 267 | 3300006173 | Ga0070716_100085712 | Ga0070716_1000857122 | 260 |
| 268 | 3300006358 | Ga0068871_100259299 | Ga0068871_1002592992 | 260 |
| 269 | 3300006880 | Ga0075429_100611439 | Ga0075429_1006114392 | 260 |
| 270 | 3300006881 | Ga0068865_100124729 | Ga0068865_1001247293 | 260 |
| 271 | 3300006931 | Ga0097620_100001393 | Ga0097620_10000139317 | 260 |
| 272 | 3300007265 | Ga0099794_10007170 | Ga0099794_100071704 | 260 |
| 273 | 3300007265 | Ga0099794_10033382 | Ga0099794_100333822 | 260 |
| 274 | 3300009147 | Ga0114129_10734822 | Ga0114129_107348222 | 260 |
| 275 | 3300009174 | Ga0105241_10001038 | Ga0105241_100010382 | 260 |
| 276 | 3300011119 | Ga0105246_10170521 | Ga0105246_101705212 | 260 |
| 277 | 3300013100 | Ga0157373_10000388 | Ga0157373_1000038812 | 260 |
| 278 | 3300013102 | Ga0157371_10107766 | Ga0157371_101077662 | 260 |
| 279 | 3300013105 | Ga0157369_10232425 | Ga0157369_102324253 | 260 |
| 280 | 3300013307 | Ga0157372_10000105 | Ga0157372_1000010559 | 260 |
| 281 | 3300015262 | Ga0182007_10037705 | Ga0182007_100377052 | 260 |
| 282 | 3300025885 | Ga0207653_10019880 | Ga0207653_100198803 | 260 |
| 283 | 3300025901 | Ga0207688_10012816 | Ga0207688_100128164 | 260 |
| 284 | 3300025907 | Ga0207645_10005499 | Ga0207645_100054998 | 260 |
| 285 | 3300025908 | Ga0207643_10001465 | Ga0207643_100014652 | 260 |
| 286 | 3300025910 | Ga0207684_10132276 | Ga0207684_101322762 | 260 |
| 287 | 3300025910 | Ga0207684_10359491 | Ga0207684_103594912 | 260 |
| 288 | 3300025911 | Ga0207654_10004154 | Ga0207654_100041542 | 260 |
| 289 | 3300025912 | Ga0207707_10000352 | Ga0207707_100003529 | 260 |
| 290 | 3300025914 | Ga0207671_10168526 | Ga0207671_101685262 | 260 |
| 291 | 3300025916 | Ga0207663_10207634 | Ga0207663_102076342 | 260 |
| 292 | 3300025917 | Ga0207660_10000334 | Ga0207660_1000033419 | 260 |
| 293 | 3300025919 | Ga0207657_10002597 | Ga0207657_100025974 | 260 |
| 294 | 3300025920 | Ga0207649_10006035 | Ga0207649_100060352 | 260 |
| 295 | 3300025921 | Ga0207652_10000466 | Ga0207652_1000046621 | 260 |
| 296 | 3300025922 | Ga0207646_10084314 | Ga0207646_100843143 | 260 |
| 297 | 3300025922 | Ga0207646_10283279 | Ga0207646_102832792 | 260 |
| 298 | 3300025922 | Ga0207646_10590039 | Ga0207646_105900391 | 260 |
| 299 | 3300025923 | Ga0207681_10013659 | Ga0207681_100136594 | 260 |
| 300 | 3300025924 | Ga0207694_10201692 | Ga0207694_102016922 | 260 |
| 301 | 3300025925 | Ga0207650_10025156 | Ga0207650_100251563 | 260 |
| 302 | 3300025926 | Ga0207659_10148540 | Ga0207659_101485402 | 260 |
| 303 | 3300025932 | Ga0207690_10041224 | Ga0207690_100412242 | 260 |
| 304 | 3300025933 | Ga0207706_10024583 | Ga0207706_100245836 | 260 |
| 305 | 3300025936 | Ga0207670_10088095 | Ga0207670_100880952 | 260 |
| 306 | 3300025938 | Ga0207704_10160750 | Ga0207704_101607502 | 260 |
| 307 | 3300025939 | Ga0207665_10114297 | Ga0207665_101142972 | 260 |
| 308 | 3300025940 | Ga0207691_10203962 | Ga0207691_102039622 | 260 |
| 309 | 3300025942 | Ga0207689_10003685 | Ga0207689_100036855 | 260 |
| 310 | 3300025944 | Ga0207661_10148620 | Ga0207661_101486202 | 260 |
| 311 | 3300025945 | Ga0207679_10000878 | Ga0207679_100008787 | 260 |
| 312 | 3300025949 | Ga0207667_10000497 | Ga0207667_1000049721 | 260 |
| 313 | 3300025981 | Ga0207640_10088641 | Ga0207640_100886412 | 260 |
| 314 | 3300026023 | Ga0207677_10422300 | Ga0207677_104223002 | 260 |
| 315 | 3300026035 | Ga0207703_10019303 | Ga0207703_100193033 | 260 |
| 316 | 3300026041 | Ga0207639_10002384 | Ga0207639_1000238415 | 260 |
| 317 | 3300026067 | Ga0207678_10013961 | Ga0207678_100139613 | 260 |
| 318 | 3300026075 | Ga0207708_10248471 | Ga0207708_102484712 | 260 |
| 319 | 3300026078 | Ga0207702_10008955 | Ga0207702_100089552 | 260 |
| 320 | 3300026088 | Ga0207641_10071148 | Ga0207641_100711482 | 260 |
| 321 | 3300026089 | Ga0207648_10015946 | Ga0207648_100159462 | 260 |
| 322 | 3300026116 | Ga0207674_10000550 | Ga0207674_100005504 | 260 |
| 323 | 3300026118 | Ga0207675_100005709 | Ga0207675_10000570911 | 260 |
| 324 | 3300026142 | Ga0207698_10116523 | Ga0207698_101165232 | 260 |
| 325 | 3300028380 | Ga0268265_10002923 | Ga0268265_1000292315 | 260 |
| 326 | 3300028381 | Ga0268264_10031393 | Ga0268264_100313936 | 260 |
| 327 | 3300035088 | Ga0373940_0017681 | Ga0373940_0017681_12_824 | 260 |
| 328 | 3300035090 | Ga0373949_0043019 | Ga0373949_0043019_222_1034 | 260 |
| 329 | 3300035091 | Ga0373951_0013500 | Ga0373951_0013500_399_1211 | 260 |
| 330 | 3300035121 | Ga0373960_0032466 | Ga0373960_0032466_344_1156 | 260 |
| 331 | 3300042005 | Ga0439448_0009418 | Ga0439448_0009418_888_1700 | 260 |
| 332 | 3300042157 | Ga0439458_0002296 | Ga0439458_0002296_243_1055 | 260 |
| 333 | 3300042876 | Ga0451577_0005206 | Ga0451577_0005206_478_1290 | 260 |
| 334 | 3300042876 | Ga0451577_0035839 | Ga0451577_0035839_278_1090 | 260 |
| 335 | 3300044712 | Ga0453684_0185691 | Ga0453684_0185691_924_1736 | 260 |
| 336 | 3300045051 | Ga0451576_0028871 | Ga0451576_0028871_4795_5607 | 260 |
| 337 | 3300045051 | Ga0451576_0278038 | Ga0451576_0278038_665_1477 | 260 |
| 338 | 3300046472 | Ga0495580_0224360 | Ga0495580_0224360_138_950 | 260 |
| 339 | 3300048911 | Ga0496108_0397804 | Ga0496108_0397804_49_861 | 260 |
| 340 | 3300050507 | nmdc:mga05p37_196355_c1 | nmdc:mga05p37_196355_c1_153_965 | 260 |
| 341 | 3300050508 | nmdc:mga09592_310142_c1 | nmdc:mga09592_310142_c1_236_1048 | 260 |
| 342 | 3300050512 | nmdc:mga0n895_43098_c1 | nmdc:mga0n895_43098_c1_2107_2919 | 260 |
| 343 | 3300050514 | nmdc:mga08x19_4220_c1 | nmdc:mga08x19_4220_c1_2637_3449 | 260 |
| 344 | 3300050515 | nmdc:mga0a205_123700_c1 | nmdc:mga0a205_123700_c1_198_1010 | 260 |
| 345 | 3300025885 | Ga0207653_10038407 | Ga0207653_100384072 | 261 |
| 346 | 3300025922 | Ga0207646_10008025 | Ga0207646_1000802511 | 261 |
| 347 | 3300049580 | Ga0501046_0074003 | Ga0501046_0074003_31_873 | 261 |
| 348 | 3300005467 | Ga0070706_100603264 | Ga0070706_1006032641 | 262 |
| 349 | 3300005578 | Ga0068854_100013613 | Ga0068854_1000136135 | 262 |
| 350 | 3300027876 | Ga0209974_10066276 | Ga0209974_100662762 | 262 |
| 351 | 3300046664 | Ga0495659_0061095 | Ga0495659_0061095_378_1169 | 262 |
| 352 | 3300049570 | Ga0501033_0008980 | Ga0501033_0008980_3951_4799 | 262 |
| 353 | 3300049572 | Ga0501036_0012481 | Ga0501036_0012481_5952_6800 | 262 |
| 354 | 3300049573 | Ga0501037_0064932 | Ga0501037_0064932_33_881 | 262 |
| 355 | 3300049574 | Ga0501038_0000777 | Ga0501038_0000777_2902_3750 | 262 |
| 356 | 3300049575 | Ga0501039_0001226 | Ga0501039_0001226_5886_6734 | 262 |
| 357 | 3300049576 | Ga0501040_0001715 | Ga0501040_0001715_8598_9446 | 262 |
| 358 | 3300049577 | Ga0501041_0000102 | Ga0501041_0000102_9418_10266 | 262 |
| 359 | 3300049578 | Ga0501042_0000777 | Ga0501042_0000777_7088_7936 | 262 |
| 360 | 3300049579 | Ga0501043_0029257 | Ga0501043_0029257_1072_1920 | 262 |
| 361 | 3300049580 | Ga0501046_0000609 | Ga0501046_0000609_11975_12823 | 262 |
| 362 | 3300049582 | Ga0501048_0018520 | Ga0501048_0018520_378_1226 | 262 |
| 363 | 3300049584 | Ga0501068_0030991 | Ga0501068_0030991_1288_2136 | 262 |
| 364 | 3300049585 | Ga0501069_0089197 | Ga0501069_0089197_506_1354 | 262 |
| 365 | 3300049586 | Ga0501070_0070558 | Ga0501070_0070558_282_1130 | 262 |
| 366 | 3300049587 | Ga0501071_0000736 | Ga0501071_0000736_10836_11684 | 262 |
| 367 | 3300049588 | Ga0501072_0002055 | Ga0501072_0002055_7942_8790 | 262 |
| 368 | 3300049590 | Ga0501074_0005624 | Ga0501074_0005624_5522_6370 | 262 |
| 369 | 3300049591 | Ga0501075_0000396 | Ga0501075_0000396_5748_6596 | 262 |
| 370 | 3300049592 | Ga0501076_0001680 | Ga0501076_0001680_6298_7146 | 262 |
| 371 | 3300049593 | Ga0501077_0000286 | Ga0501077_0000286_16761_17609 | 262 |
| 372 | 3300049741 | Ga0501079_0000134 | Ga0501079_0000134_12373_13221 | 262 |
| 373 | 3300049742 | Ga0501080_0000292 | Ga0501080_0000292_25198_26046 | 262 |
| 374 | 3300049743 | Ga0501081_0001499 | Ga0501081_0001499_5654_6502 | 262 |
| 375 | 3300049744 | Ga0501083_0103576 | Ga0501083_0103576_974_1822 | 262 |
| 376 | 3300049822 | Ga0501035_0006607 | Ga0501035_0006607_6404_7252 | 262 |
| 377 | 3300049824 | Ga0501045_0002290 | Ga0501045_0002290_3795_4643 | 262 |
| 378 | 3300054114 | Ga0501084_0001169 | Ga0501084_0001169_5345_6193 | 262 |
| 379 | 3300060353 | Ga0501082_0002631 | Ga0501082_0002631_8335_9183 | 262 |
| 380 | 3300061734 | Ga0530510_0001748 | Ga0530510_0001748_8615_9463 | 262 |
| 381 | 3300003349 | JGI26129J50193_1000967 | JGI26129J50193_10009673 | 263 |
| 382 | 3300005440 | Ga0070705_100101787 | Ga0070705_1001017872 | 263 |
| 383 | 3300005444 | Ga0070694_100182553 | Ga0070694_1001825532 | 263 |
| 384 | 3300005445 | Ga0070708_100055617 | Ga0070708_1000556172 | 263 |
| 385 | 3300005445 | Ga0070708_100159392 | Ga0070708_1001593922 | 263 |
| 386 | 3300005467 | Ga0070706_100047684 | Ga0070706_1000476842 | 263 |
| 387 | 3300005468 | Ga0070707_100103935 | Ga0070707_1001039352 | 263 |
| 388 | 3300005468 | Ga0070707_100113897 | Ga0070707_1001138972 | 263 |
| 389 | 3300005471 | Ga0070698_100094612 | Ga0070698_1000946122 | 263 |
| 390 | 3300005471 | Ga0070698_100161752 | Ga0070698_1001617522 | 263 |
| 391 | 3300005518 | Ga0070699_100013457 | Ga0070699_1000134574 | 263 |
| 392 | 3300005518 | Ga0070699_100020088 | Ga0070699_1000200882 | 263 |
| 393 | 3300005518 | Ga0070699_100302754 | Ga0070699_1003027542 | 263 |
| 394 | 3300005536 | Ga0070697_100023932 | Ga0070697_1000239322 | 263 |
| 395 | 3300005536 | Ga0070697_100065632 | Ga0070697_1000656322 | 263 |
| 396 | 3300005545 | Ga0070695_100003891 | Ga0070695_1000038913 | 263 |
| 397 | 3300005549 | Ga0070704_100103095 | Ga0070704_1001030952 | 263 |
| 398 | 3300005844 | Ga0068862_100080533 | Ga0068862_1000805332 | 263 |
| 399 | 3300005937 | Ga0081455_10001810 | Ga0081455_100018102 | 263 |
| 400 | 3300006846 | Ga0075430_100061652 | Ga0075430_1000616523 | 263 |
| 401 | 3300006846 | Ga0075430_100212495 | Ga0075430_1002124951 | 263 |
| 402 | 3300006847 | Ga0075431_100503852 | Ga0075431_1005038522 | 263 |
| 403 | 3300006852 | Ga0075433_10166688 | Ga0075433_101666882 | 263 |
| 404 | 3300006852 | Ga0075433_10281102 | Ga0075433_102811022 | 263 |
| 405 | 3300006871 | Ga0075434_100031633 | Ga0075434_1000316332 | 263 |
| 406 | 3300006871 | Ga0075434_100033398 | Ga0075434_1000333984 | 263 |
| 407 | 3300006871 | Ga0075434_100156094 | Ga0075434_1001560943 | 263 |
| 408 | 3300006880 | Ga0075429_100010038 | Ga0075429_1000100389 | 263 |
| 409 | 3300006880 | Ga0075429_100030148 | Ga0075429_1000301486 | 263 |
| 410 | 3300006914 | Ga0075436_100414469 | Ga0075436_1004144692 | 263 |
| 411 | 3300007076 | Ga0075435_100057817 | Ga0075435_1000578172 | 263 |
| 412 | 3300007076 | Ga0075435_100485406 | Ga0075435_1004854062 | 263 |
| 413 | 3300009094 | Ga0111539_10481786 | Ga0111539_104817862 | 263 |
| 414 | 3300009147 | Ga0114129_10008441 | Ga0114129_1000844110 | 263 |
| 415 | 3300009147 | Ga0114129_10009875 | Ga0114129_100098752 | 263 |
| 416 | 3300009147 | Ga0114129_10119347 | Ga0114129_101193473 | 263 |
| 417 | 3300009147 | Ga0114129_10753981 | Ga0114129_107539812 | 263 |
| 418 | 3300013307 | Ga0157372_10072881 | Ga0157372_100728815 | 263 |
| 419 | 3300025910 | Ga0207684_10019692 | Ga0207684_100196925 | 263 |
| 420 | 3300025910 | Ga0207684_10073541 | Ga0207684_100735412 | 263 |
| 421 | 3300025917 | Ga0207660_10570966 | Ga0207660_105709661 | 263 |
| 422 | 3300025922 | Ga0207646_10028619 | Ga0207646_100286192 | 263 |
| 423 | 3300025922 | Ga0207646_10108278 | Ga0207646_101082783 | 263 |
| 424 | 3300026088 | Ga0207641_10082607 | Ga0207641_100826072 | 263 |
| 425 | 3300026089 | Ga0207648_10202775 | Ga0207648_102027752 | 263 |
| 426 | 3300027378 | Ga0209981_1000490 | Ga0209981_10004905 | 263 |
| 427 | 3300027395 | Ga0209996_1000338 | Ga0209996_10003385 | 263 |
| 428 | 3300027471 | Ga0209995_1002164 | Ga0209995_10021642 | 263 |
| 429 | 3300027526 | Ga0209968_1000579 | Ga0209968_10005795 | 263 |
| 430 | 3300027543 | Ga0209999_1000243 | Ga0209999_10002439 | 263 |
| 431 | 3300027552 | Ga0209982_1001041 | Ga0209982_10010414 | 263 |
| 432 | 3300027617 | Ga0210002_1017292 | Ga0210002_10172922 | 263 |
| 433 | 3300027665 | Ga0209983_1000034 | Ga0209983_10000347 | 263 |
| 434 | 3300027682 | Ga0209971_1000028 | Ga0209971_100002814 | 263 |
| 435 | 3300027695 | Ga0209966_1000073 | Ga0209966_10000736 | 263 |
| 436 | 3300027717 | Ga0209998_10000001 | Ga0209998_10000001154 | 263 |
| 437 | 3300027876 | Ga0209974_10000369 | Ga0209974_100003697 | 263 |
| 438 | 3300027907 | Ga0207428_10000176 | Ga0207428_1000017680 | 263 |
| 439 | 3300028380 | Ga0268265_10268221 | Ga0268265_102682212 | 263 |
| 440 | 3300035112 | Ga0373932_0003143 | Ga0373932_0003143_2588_3382 | 263 |
| 441 | 3300035114 | Ga0373939_0007077 | Ga0373939_0007077_1789_2583 | 263 |
| 442 | 3300035691 | Ga0373931_0008836 | Ga0373931_0008836_2880_3674 | 263 |
| 443 | 3300042012 | Ga0439455_0013689 | Ga0439455_0013689_737_1558 | 263 |
| 444 | 3300044712 | Ga0453684_0435913 | Ga0453684_0435913_325_1119 | 263 |
| 445 | 3300045051 | Ga0451576_0024239 | Ga0451576_0024239_1123_1917 | 263 |
| 446 | 3300045051 | Ga0451576_0026201 | Ga0451576_0026201_1683_2504 | 263 |
| 447 | 3300045051 | Ga0451576_0263638 | Ga0451576_0263638_674_1468 | 263 |
| 448 | 3300046472 | Ga0495580_0029596 | Ga0495580_0029596_2620_3414 | 263 |
| 449 | 3300046491 | Ga0495584_0041628 | Ga0495584_0041628_1206_2027 | 263 |
| 450 | 3300046491 | Ga0495584_0213351 | Ga0495584_0213351_141_962 | 263 |
| 451 | 3300049570 | Ga0501033_0082046 | Ga0501033_0082046_118_966 | 263 |
| 452 | 3300049570 | Ga0501033_0231964 | Ga0501033_0231964_141_962 | 263 |
| 453 | 3300049574 | Ga0501038_0035789 | Ga0501038_0035789_1251_2099 | 263 |
| 454 | 3300049575 | Ga0501039_0006761 | Ga0501039_0006761_1510_2358 | 263 |
| 455 | 3300049576 | Ga0501040_0019396 | Ga0501040_0019396_1000_1848 | 263 |
| 456 | 3300049576 | Ga0501040_0113952 | Ga0501040_0113952_13_834 | 263 |
| 457 | 3300049577 | Ga0501041_0075614 | Ga0501041_0075614_823_1644 | 263 |
| 458 | 3300049577 | Ga0501041_0115390 | Ga0501041_0115390_526_1374 | 263 |
| 459 | 3300049578 | Ga0501042_0007483 | Ga0501042_0007483_912_1760 | 263 |
| 460 | 3300049578 | Ga0501042_0178235 | Ga0501042_0178235_68_889 | 263 |
| 461 | 3300049582 | Ga0501048_0009507 | Ga0501048_0009507_4732_5580 | 263 |
| 462 | 3300049587 | Ga0501071_0006665 | Ga0501071_0006665_984_1832 | 263 |
| 463 | 3300049587 | Ga0501071_0157789 | Ga0501071_0157789_325_1146 | 263 |
| 464 | 3300049590 | Ga0501074_0182597 | Ga0501074_0182597_201_1022 | 263 |
| 465 | 3300049591 | Ga0501075_0000122 | Ga0501075_0000122_15950_16798 | 263 |
| 466 | 3300049591 | Ga0501075_0062305 | Ga0501075_0062305_531_1352 | 263 |
| 467 | 3300049592 | Ga0501076_0000012 | Ga0501076_0000012_48574_49422 | 263 |
| 468 | 3300049592 | Ga0501076_0130234 | Ga0501076_0130234_676_1497 | 263 |
| 469 | 3300049593 | Ga0501077_0009995 | Ga0501077_0009995_4107_4928 | 263 |
| 470 | 3300049593 | Ga0501077_0045440 | Ga0501077_0045440_1281_2129 | 263 |
| 471 | 3300049741 | Ga0501079_0008164 | Ga0501079_0008164_6735_7556 | 263 |
| 472 | 3300049741 | Ga0501079_0041859 | Ga0501079_0041859_1160_2008 | 263 |
| 473 | 3300049742 | Ga0501080_0113479 | Ga0501080_0113479_598_1419 | 263 |
| 474 | 3300049743 | Ga0501081_0006424 | Ga0501081_0006424_5236_6084 | 263 |
| 475 | 3300049743 | Ga0501081_0008697 | Ga0501081_0008697_2305_3126 | 263 |
| 476 | 3300049822 | Ga0501035_0048808 | Ga0501035_0048808_1490_2338 | 263 |
| 477 | 3300050507 | nmdc:mga05p37_21565_c1 | nmdc:mga05p37_21565_c1_6425_7246 | 263 |
| 478 | 3300050507 | nmdc:mga05p37_238148_c1 | nmdc:mga05p37_238148_c1_720_1538 | 263 |
| 479 | 3300050507 | nmdc:mga05p37_85453_c1 | nmdc:mga05p37_85453_c1_942_1736 | 263 |
| 480 | 3300050508 | nmdc:mga09592_144514_c1 | nmdc:mga09592_144514_c1_367_1185 | 263 |
| 481 | 3300050509 | nmdc:mga0qj67_272243_c1 | nmdc:mga0qj67_272243_c1_502_1323 | 263 |
| 482 | 3300050509 | nmdc:mga0qj67_43339_c1 | nmdc:mga0qj67_43339_c1_2389_3183 | 263 |
| 483 | 3300050510 | nmdc:mga06r32_790916_c1 | nmdc:mga06r32_790916_c1_52_846 | 263 |
| 484 | 3300050510 | nmdc:mga06r32_87705_c1 | nmdc:mga06r32_87705_c1_1384_2178 | 263 |
| 485 | 3300050511 | nmdc:mga08y16_2945_c1 | nmdc:mga08y16_2945_c1_1341_2138 | 263 |
| 486 | 3300050512 | nmdc:mga0n895_41940_c1 | nmdc:mga0n895_41940_c1_1630_2424 | 263 |
| 487 | 3300050512 | nmdc:mga0n895_61867_c1 | nmdc:mga0n895_61867_c1_2413_3207 | 263 |
| 488 | 3300050514 | nmdc:mga08x19_153171_c1 | nmdc:mga08x19_153171_c1_742_1536 | 263 |
| 489 | 3300050514 | nmdc:mga08x19_397209_c1 | nmdc:mga08x19_397209_c1_134_928 | 263 |
| 490 | 3300050515 | nmdc:mga0a205_156982_c1 | nmdc:mga0a205_156982_c1_1276_2073 | 263 |
| 491 | 3300050515 | nmdc:mga0a205_205119_c1 | nmdc:mga0a205_205119_c1_150_944 | 263 |
| 492 | 3300050515 | nmdc:mga0a205_5896_c1 | nmdc:mga0a205_5896_c1_4440_5234 | 263 |
| 493 | 3300050515 | nmdc:mga0a205_66914_c2 | nmdc:mga0a205_66914_c2_1311_2129 | 263 |
| 494 | 3300054114 | Ga0501084_0001730 | Ga0501084_0001730_14925_15773 | 263 |
| 495 | 3300054114 | Ga0501084_0015809 | Ga0501084_0015809_3613_4434 | 263 |
| 496 | 3300054114 | Ga0501084_0097754 | Ga0501084_0097754_475_1314 | 263 |
| 497 | 3300060353 | Ga0501082_0009410 | Ga0501082_0009410_2330_3178 | 263 |
| 498 | 3300060353 | Ga0501082_0056973 | Ga0501082_0056973_1143_1964 | 263 |
| 499 | 3300061734 | Ga0530510_0000015 | Ga0530510_0000015_79174_80022 | 263 |
| 500 | 3300005549 | Ga0070704_100047238 | Ga0070704_1000472381 | 264 |
| 501 | 3300009094 | Ga0111539_10082769 | Ga0111539_100827692 | 264 |
| 502 | 3300009174 | Ga0105241_10212150 | Ga0105241_102121502 | 264 |
| 503 | 3300013306 | Ga0163162_10015647 | Ga0163162_100156472 | 264 |
| 504 | 3300035112 | Ga0373932_0026642 | Ga0373932_0026642_339_1136 | 264 |
| 505 | 3300035114 | Ga0373939_0039678 | Ga0373939_0039678_164_961 | 264 |
| 506 | 3300046684 | Ga0495669_0032522 | Ga0495669_0032522_1282_2079 | 264 |
| 507 | 3300048905 | Ga0496102_0001871 | Ga0496102_0001871_4526_5323 | 264 |
| 508 | 3300049574 | Ga0501038_0110847 | Ga0501038_0110847_1364_2158 | 264 |
| 509 | 3300049576 | Ga0501040_0067285 | Ga0501040_0067285_484_1278 | 264 |
| 510 | 3300049577 | Ga0501041_0170777 | Ga0501041_0170777_294_1088 | 264 |
| 511 | 3300049578 | Ga0501042_0126960 | Ga0501042_0126960_592_1386 | 264 |
| 512 | 3300049588 | Ga0501072_0025773 | Ga0501072_0025773_2796_3590 | 264 |
| 513 | 3300049592 | Ga0501076_0065644 | Ga0501076_0065644_1005_1799 | 264 |
| 514 | 3300049743 | Ga0501081_0112229 | Ga0501081_0112229_191_985 | 264 |
| 515 | 3300049824 | Ga0501045_0062629 | Ga0501045_0062629_94_888 | 264 |
| 516 | 3300050507 | nmdc:mga05p37_14582_c1 | nmdc:mga05p37_14582_c1_8040_8837 | 264 |
| 517 | 3300050509 | nmdc:mga0qj67_343_c1 | nmdc:mga0qj67_343_c1_24400_25197 | 264 |
| 518 | 3300050510 | nmdc:mga06r32_469340_c1 | nmdc:mga06r32_469340_c1_253_1047 | 264 |
| 519 | 3300050511 | nmdc:mga08y16_108945_c1 | nmdc:mga08y16_108945_c1_1423_2220 | 264 |
| 520 | 3300061734 | Ga0530510_0136055 | Ga0530510_0136055_604_1398 | 264 |
| 521 | 3300009147 | Ga0114129_10000115 | Ga0114129_1000011554 | 265 |
| 522 | 3300009147 | Ga0114129_10102712 | Ga0114129_101027125 | 265 |
| 523 | 3300037418 | Ga0395900_0062032 | Ga0395900_0062032_103_906 | 265 |
| 524 | 3300037466 | Ga0395898_0079077 | Ga0395898_0079077_2339_3142 | 265 |
| 525 | 3300038443 | Ga0395901_0029677 | Ga0395901_0029677_144_947 | 265 |
| 526 | 3300050507 | nmdc:mga05p37_23238_c1 | nmdc:mga05p37_23238_c1_1580_2377 | 265 |
| 527 | 3300050507 | nmdc:mga05p37_300449_c1 | nmdc:mga05p37_300449_c1_244_1041 | 265 |
| 528 | 3300050507 | nmdc:mga05p37_89_c1 | nmdc:mga05p37_89_c1_58775_59572 | 265 |
| 529 | 3300050508 | nmdc:mga09592_1406_c1 | nmdc:mga09592_1406_c1_17852_18649 | 265 |
| 530 | 3300050512 | nmdc:mga0n895_203_c1 | nmdc:mga0n895_203_c1_19551_20348 | 265 |
| 531 | 3300050513 | nmdc:mga0rr50_694_c1 | nmdc:mga0rr50_694_c1_12909_13706 | 265 |
| 532 | 3300050514 | nmdc:mga08x19_470_c1 | nmdc:mga08x19_470_c1_14316_15113 | 265 |
| 533 | 3300050515 | nmdc:mga0a205_420270_c1 | nmdc:mga0a205_420270_c1_254_1057 | 265 |
| 534 | 3300005518 | Ga0070699_100230631 | Ga0070699_1002306311 | 267 |
| 535 | 3300005546 | Ga0070696_100272373 | Ga0070696_1002723732 | 267 |
| 536 | 3300006914 | Ga0075436_100015235 | Ga0075436_1000152355 | 267 |
| 537 | 3300009147 | Ga0114129_10529845 | Ga0114129_105298452 | 267 |
| 538 | 3300025939 | Ga0207665_10165423 | Ga0207665_101654232 | 267 |
| 539 | 3300031548 | Ga0307408_100145291 | Ga0307408_1001452912 | 267 |
| 540 | 3300031731 | Ga0307405_10240301 | Ga0307405_102403012 | 267 |
| 541 | 3300031852 | Ga0307410_10059238 | Ga0307410_100592383 | 267 |
| 542 | 3300032002 | Ga0307416_100599922 | Ga0307416_1005999222 | 267 |
| 543 | 3300032005 | Ga0307411_10063789 | Ga0307411_100637892 | 267 |
| 544 | 3300049575 | Ga0501039_0168675 | Ga0501039_0168675_356_1162 | 267 |
| 545 | 3300049576 | Ga0501040_0111631 | Ga0501040_0111631_244_1050 | 267 |
| 546 | 3300049577 | Ga0501041_0009513 | Ga0501041_0009513_2024_2830 | 267 |
| 547 | 3300049578 | Ga0501042_0030821 | Ga0501042_0030821_2172_2978 | 267 |
| 548 | 3300049584 | Ga0501068_0087739 | Ga0501068_0087739_809_1615 | 267 |
| 549 | 3300049587 | Ga0501071_0124817 | Ga0501071_0124817_166_972 | 267 |
| 550 | 3300049590 | Ga0501074_0102039 | Ga0501074_0102039_708_1514 | 267 |
| 551 | 3300049592 | Ga0501076_0002878 | Ga0501076_0002878_1497_2303 | 267 |
| 552 | 3300049593 | Ga0501077_0018034 | Ga0501077_0018034_510_1316 | 267 |
| 553 | 3300049741 | Ga0501079_0011862 | Ga0501079_0011862_1968_2774 | 267 |
| 554 | 3300049742 | Ga0501080_0059941 | Ga0501080_0059941_1928_2734 | 267 |
| 555 | 3300049743 | Ga0501081_0003182 | Ga0501081_0003182_2932_3738 | 267 |
| 556 | 3300049824 | Ga0501045_0024468 | Ga0501045_0024468_1010_1816 | 267 |
| 557 | 3300050510 | nmdc:mga06r32_204473_c1 | nmdc:mga06r32_204473_c1_625_1431 | 267 |
| 558 | 3300050514 | nmdc:mga08x19_29864_c1 | nmdc:mga08x19_29864_c1_312_1154 | 267 |
| 559 | 3300054114 | Ga0501084_0055736 | Ga0501084_0055736_1485_2291 | 267 |
| 560 | 3300060353 | Ga0501082_0351825 | Ga0501082_0351825_254_1060 | 267 |
| 561 | 3300061734 | Ga0530510_0063379 | Ga0530510_0063379_1211_2017 | 267 |
| 562 | 3300005336 | Ga0070680_100049260 | Ga0070680_1000492603 | 268 |
| 563 | 3300005341 | Ga0070691_10111549 | Ga0070691_101115491 | 268 |
| 564 | 3300005440 | Ga0070705_100122966 | Ga0070705_1001229662 | 268 |
| 565 | 3300005459 | Ga0068867_100194989 | Ga0068867_1001949892 | 268 |
| 566 | 3300005467 | Ga0070706_100224884 | Ga0070706_1002248842 | 268 |
| 567 | 3300005518 | Ga0070699_100279410 | Ga0070699_1002794102 | 268 |
| 568 | 3300005530 | Ga0070679_100203873 | Ga0070679_1002038732 | 268 |
| 569 | 3300005546 | Ga0070696_100108775 | Ga0070696_1001087752 | 268 |
| 570 | 3300005549 | Ga0070704_100015876 | Ga0070704_1000158762 | 268 |
| 571 | 3300005617 | Ga0068859_100089345 | Ga0068859_1000893452 | 268 |
| 572 | 3300005718 | Ga0068866_10060874 | Ga0068866_100608742 | 268 |
| 573 | 3300005843 | Ga0068860_100315180 | Ga0068860_1003151802 | 268 |
| 574 | 3300005844 | Ga0068862_100546214 | Ga0068862_1005462142 | 268 |
| 575 | 3300006844 | Ga0075428_100001380 | Ga0075428_10000138014 | 268 |
| 576 | 3300006844 | Ga0075428_100054921 | Ga0075428_1000549213 | 268 |
| 577 | 3300006844 | Ga0075428_100197674 | Ga0075428_1001976743 | 268 |
| 578 | 3300006844 | Ga0075428_100624849 | Ga0075428_1006248492 | 268 |
| 579 | 3300006846 | Ga0075430_100000019 | Ga0075430_10000001926 | 268 |
| 580 | 3300006846 | Ga0075430_100000487 | Ga0075430_10000048712 | 268 |
| 581 | 3300006847 | Ga0075431_100002180 | Ga0075431_1000021808 | 268 |
| 582 | 3300006847 | Ga0075431_100011273 | Ga0075431_1000112732 | 268 |
| 583 | 3300006847 | Ga0075431_100072397 | Ga0075431_1000723973 | 268 |
| 584 | 3300006871 | Ga0075434_100459999 | Ga0075434_1004599992 | 268 |
| 585 | 3300006880 | Ga0075429_100000859 | Ga0075429_10000085918 | 268 |
| 586 | 3300006880 | Ga0075429_100021240 | Ga0075429_1000212404 | 268 |
| 587 | 3300006880 | Ga0075429_100424371 | Ga0075429_1004243712 | 268 |
| 588 | 3300006931 | Ga0097620_100089342 | Ga0097620_1000893422 | 268 |
| 589 | 3300007265 | Ga0099794_10016643 | Ga0099794_100166432 | 268 |
| 590 | 3300007265 | Ga0099794_10119145 | Ga0099794_101191452 | 268 |
| 591 | 3300009094 | Ga0111539_10192811 | Ga0111539_101928112 | 268 |
| 592 | 3300009147 | Ga0114129_10114996 | Ga0114129_101149963 | 268 |
| 593 | 3300009147 | Ga0114129_10738955 | Ga0114129_107389552 | 268 |
| 594 | 3300009147 | Ga0114129_10919193 | Ga0114129_109191932 | 268 |
| 595 | 3300013297 | Ga0157378_10339128 | Ga0157378_103391282 | 268 |
| 596 | 3300025923 | Ga0207681_10166559 | Ga0207681_101665592 | 268 |
| 597 | 3300025933 | Ga0207706_10080188 | Ga0207706_100801882 | 268 |
| 598 | 3300025936 | Ga0207670_10320547 | Ga0207670_103205472 | 268 |
| 599 | 3300026075 | Ga0207708_10570979 | Ga0207708_105709792 | 268 |
| 600 | 3300026089 | Ga0207648_10153126 | Ga0207648_101531263 | 268 |
| 601 | 3300026089 | Ga0207648_10295593 | Ga0207648_102955932 | 268 |
| 602 | 3300026118 | Ga0207675_100132891 | Ga0207675_1001328912 | 268 |
| 603 | 3300027671 | Ga0209588_1017370 | Ga0209588_10173702 | 268 |
| 604 | 3300027907 | Ga0207428_10123151 | Ga0207428_101231512 | 268 |
| 605 | 3300031548 | Ga0307408_100048113 | Ga0307408_1000481132 | 268 |
| 606 | 3300031548 | Ga0307408_100353624 | Ga0307408_1003536242 | 268 |
| 607 | 3300037312 | Ga0395899_0005401 | Ga0395899_0005401_4782_5594 | 268 |
| 608 | 3300042876 | Ga0451577_0250202 | Ga0451577_0250202_139_981 | 268 |
| 609 | 3300049588 | Ga0501072_0059434 | Ga0501072_0059434_993_1805 | 268 |
| 610 | 3300049591 | Ga0501075_0076372 | Ga0501075_0076372_1553_2365 | 268 |
| 611 | 3300049592 | Ga0501076_0332088 | Ga0501076_0332088_313_1125 | 268 |
| 612 | 3300050507 | nmdc:mga05p37_331825_c1 | nmdc:mga05p37_331825_c1_699_1553 | 268 |
| 613 | 3300050507 | nmdc:mga05p37_35596_c1 | nmdc:mga05p37_35596_c1_2643_3455 | 268 |
| 614 | 3300050507 | nmdc:mga05p37_743528_c1 | nmdc:mga05p37_743528_c1_75_929 | 268 |
| 615 | 3300050508 | nmdc:mga09592_837_c1 | nmdc:mga09592_837_c1_4733_5545 | 268 |
| 616 | 3300050509 | nmdc:mga0qj67_798_c1 | nmdc:mga0qj67_798_c1_6370_7182 | 268 |
| 617 | 3300050510 | nmdc:mga06r32_10348_c1 | nmdc:mga06r32_10348_c1_3944_4756 | 268 |
| 618 | 3300050510 | nmdc:mga06r32_176697_c1 | nmdc:mga06r32_176697_c1_1101_1955 | 268 |
| 619 | 3300050511 | nmdc:mga08y16_163309_c1 | nmdc:mga08y16_163309_c1_245_1099 | 268 |
| 620 | 3300050511 | nmdc:mga08y16_420122_c1 | nmdc:mga08y16_420122_c1_41_853 | 268 |
| 621 | 3300061734 | Ga0530510_0221293 | Ga0530510_0221293_226_1032 | 268 |
| 622 | 3300003203 | JGI25406J46586_10017390 | JGI25406J46586_100173902 | 269 |
| 623 | 3300005445 | Ga0070708_100016216 | Ga0070708_1000162165 | 269 |
| 624 | 3300005467 | Ga0070706_100077558 | Ga0070706_1000775583 | 269 |
| 625 | 3300005468 | Ga0070707_100593067 | Ga0070707_1005930672 | 269 |
| 626 | 3300005471 | Ga0070698_100014980 | Ga0070698_1000149803 | 269 |
| 627 | 3300005518 | Ga0070699_100015560 | Ga0070699_1000155602 | 269 |
| 628 | 3300005536 | Ga0070697_100349732 | Ga0070697_1003497321 | 269 |
| 629 | 3300005536 | Ga0070697_100449415 | Ga0070697_1004494151 | 269 |
| 630 | 3300005985 | Ga0081539_10000005 | Ga0081539_10000005380 | 269 |
| 631 | 3300006058 | Ga0075432_10024663 | Ga0075432_100246632 | 269 |
| 632 | 3300006844 | Ga0075428_100000924 | Ga0075428_10000092421 | 269 |
| 633 | 3300006844 | Ga0075428_100030517 | Ga0075428_1000305174 | 269 |
| 634 | 3300006844 | Ga0075428_100182861 | Ga0075428_1001828611 | 269 |
| 635 | 3300006844 | Ga0075428_100224837 | Ga0075428_1002248372 | 269 |
| 636 | 3300006846 | Ga0075430_100016723 | Ga0075430_1000167233 | 269 |
| 637 | 3300006846 | Ga0075430_100046733 | Ga0075430_1000467335 | 269 |
| 638 | 3300006846 | Ga0075430_100147154 | Ga0075430_1001471542 | 269 |
| 639 | 3300006847 | Ga0075431_100000797 | Ga0075431_1000007972 | 269 |
| 640 | 3300006847 | Ga0075431_100002229 | Ga0075431_10000222916 | 269 |
| 641 | 3300006847 | Ga0075431_100008469 | Ga0075431_1000084695 | 269 |
| 642 | 3300006847 | Ga0075431_100168828 | Ga0075431_1001688282 | 269 |
| 643 | 3300006847 | Ga0075431_100340726 | Ga0075431_1003407261 | 269 |
| 644 | 3300006852 | Ga0075433_10006420 | Ga0075433_100064205 | 269 |
| 645 | 3300006871 | Ga0075434_100022146 | Ga0075434_1000221466 | 269 |
| 646 | 3300006871 | Ga0075434_100232081 | Ga0075434_1002320813 | 269 |
| 647 | 3300006880 | Ga0075429_100027920 | Ga0075429_1000279202 | 269 |
| 648 | 3300006880 | Ga0075429_100144176 | Ga0075429_1001441762 | 269 |
| 649 | 3300006914 | Ga0075436_100001157 | Ga0075436_1000011577 | 269 |
| 650 | 3300007076 | Ga0075435_100015296 | Ga0075435_1000152964 | 269 |
| 651 | 3300009147 | Ga0114129_10001631 | Ga0114129_100016314 | 269 |
| 652 | 3300009147 | Ga0114129_10036324 | Ga0114129_100363244 | 269 |
| 653 | 3300009147 | Ga0114129_10563662 | Ga0114129_105636622 | 269 |
| 654 | 3300025910 | Ga0207684_10000115 | Ga0207684_100001159 | 269 |
| 655 | 3300025922 | Ga0207646_10003851 | Ga0207646_1000385110 | 269 |
| 656 | 3300027682 | Ga0209971_1005708 | Ga0209971_10057083 | 269 |
| 657 | 3300027695 | Ga0209966_1009155 | Ga0209966_10091552 | 269 |
| 658 | 3300031548 | Ga0307408_100034524 | Ga0307408_1000345242 | 269 |
| 659 | 3300031852 | Ga0307410_10193742 | Ga0307410_101937422 | 269 |
| 660 | 3300032005 | Ga0307411_10334865 | Ga0307411_103348652 | 269 |
| 661 | 3300037418 | Ga0395900_0333236 | Ga0395900_0333236_665_1474 | 269 |
| 662 | 3300037471 | Ga0395905_0139761 | Ga0395905_0139761_876_1685 | 269 |
| 663 | 3300049570 | Ga0501033_0204541 | Ga0501033_0204541_82_897 | 269 |
| 664 | 3300049572 | Ga0501036_0025187 | Ga0501036_0025187_1885_2700 | 269 |
| 665 | 3300049572 | Ga0501036_0207057 | Ga0501036_0207057_297_1112 | 269 |
| 666 | 3300049572 | Ga0501036_0306586 | Ga0501036_0306586_410_1225 | 269 |
| 667 | 3300049574 | Ga0501038_0197507 | Ga0501038_0197507_53_868 | 269 |
| 668 | 3300049575 | Ga0501039_0164062 | Ga0501039_0164062_736_1551 | 269 |
| 669 | 3300049576 | Ga0501040_0016619 | Ga0501040_0016619_840_1655 | 269 |
| 670 | 3300049577 | Ga0501041_0031877 | Ga0501041_0031877_1802_2617 | 269 |
| 671 | 3300049578 | Ga0501042_0160808 | Ga0501042_0160808_166_981 | 269 |
| 672 | 3300049579 | Ga0501043_0180607 | Ga0501043_0180607_568_1383 | 269 |
| 673 | 3300049582 | Ga0501048_0021144 | Ga0501048_0021144_3168_3983 | 269 |
| 674 | 3300049582 | Ga0501048_0076147 | Ga0501048_0076147_1201_2016 | 269 |
| 675 | 3300049583 | Ga0501067_0048491 | Ga0501067_0048491_773_1588 | 269 |
| 676 | 3300049584 | Ga0501068_0047035 | Ga0501068_0047035_735_1550 | 269 |
| 677 | 3300049584 | Ga0501068_0167374 | Ga0501068_0167374_26_841 | 269 |
| 678 | 3300049585 | Ga0501069_0007927 | Ga0501069_0007927_3261_4076 | 269 |
| 679 | 3300049588 | Ga0501072_0015809 | Ga0501072_0015809_871_1686 | 269 |
| 680 | 3300049588 | Ga0501072_0124331 | Ga0501072_0124331_872_1687 | 269 |
| 681 | 3300049590 | Ga0501074_0021260 | Ga0501074_0021260_2495_3310 | 269 |
| 682 | 3300049591 | Ga0501075_0014948 | Ga0501075_0014948_3266_4081 | 269 |
| 683 | 3300049591 | Ga0501075_0121655 | Ga0501075_0121655_1092_1907 | 269 |
| 684 | 3300049592 | Ga0501076_0024534 | Ga0501076_0024534_2539_3354 | 269 |
| 685 | 3300049592 | Ga0501076_0110518 | Ga0501076_0110518_813_1628 | 269 |
| 686 | 3300049593 | Ga0501077_0009924 | Ga0501077_0009924_2103_2918 | 269 |
| 687 | 3300049593 | Ga0501077_0092273 | Ga0501077_0092273_113_928 | 269 |
| 688 | 3300049593 | Ga0501077_0118791 | Ga0501077_0118791_155_970 | 269 |
| 689 | 3300049741 | Ga0501079_0017090 | Ga0501079_0017090_3286_4101 | 269 |
| 690 | 3300049741 | Ga0501079_0018925 | Ga0501079_0018925_2216_3031 | 269 |
| 691 | 3300049741 | Ga0501079_0333676 | Ga0501079_0333676_179_994 | 269 |
| 692 | 3300049742 | Ga0501080_0122207 | Ga0501080_0122207_1129_1944 | 269 |
| 693 | 3300049742 | Ga0501080_0312189 | Ga0501080_0312189_356_1171 | 269 |
| 694 | 3300049743 | Ga0501081_0001033 | Ga0501081_0001033_13077_13892 | 269 |
| 695 | 3300049743 | Ga0501081_0021956 | Ga0501081_0021956_1828_2643 | 269 |
| 696 | 3300049743 | Ga0501081_0036313 | Ga0501081_0036313_716_1531 | 269 |
| 697 | 3300049744 | Ga0501083_0113204 | Ga0501083_0113204_881_1696 | 269 |
| 698 | 3300049824 | Ga0501045_0073786 | Ga0501045_0073786_107_922 | 269 |
| 699 | 3300050507 | nmdc:mga05p37_28205_c1 | nmdc:mga05p37_28205_c1_3542_4357 | 269 |
| 700 | 3300050508 | nmdc:mga09592_6345_c1 | nmdc:mga09592_6345_c1_6293_7102 | 269 |
| 701 | 3300050509 | nmdc:mga0qj67_167798_c1 | nmdc:mga0qj67_167798_c1_505_1314 | 269 |
| 702 | 3300050509 | nmdc:mga0qj67_22992_c1 | nmdc:mga0qj67_22992_c1_2702_3517 | 269 |
| 703 | 3300050510 | nmdc:mga06r32_32294_c1 | nmdc:mga06r32_32294_c1_3235_4044 | 269 |
| 704 | 3300050510 | nmdc:mga06r32_4631_c1 | nmdc:mga06r32_4631_c1_4932_5747 | 269 |
| 705 | 3300050512 | nmdc:mga0n895_88977_c1 | nmdc:mga0n895_88977_c1_326_1141 | 269 |
| 706 | 3300054114 | Ga0501084_0024553 | Ga0501084_0024553_19_834 | 269 |
| 707 | 3300054114 | Ga0501084_0053423 | Ga0501084_0053423_524_1339 | 269 |
| 708 | 3300054114 | Ga0501084_0199873 | Ga0501084_0199873_583_1398 | 269 |
| 709 | 3300059421 | Ga0590071_010281 | Ga0590071_010281_873_1688 | 269 |
| 710 | 3300059424 | Ga0590075_007138 | Ga0590075_007138_322_1137 | 269 |
| 711 | 3300061734 | Ga0530510_0015625 | Ga0530510_0015625_1031_1846 | 269 |
| 712 | 3300061734 | Ga0530510_0179918 | Ga0530510_0179918_368_1183 | 269 |
| 713 | 3300061734 | Ga0530510_0188761 | Ga0530510_0188761_421_1236 | 269 |
| 714 | 3300061734 | Ga0530510_0236658 | Ga0530510_0236658_283_1098 | 269 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d6x-assembly1.cif.gz_C | mycobacterium smegmatis sdh1 complex in the apo form | 0.7958 | 17 | 269 |
| 7d6x-assembly1.cif.gz_C | mycobacterium smegmatis sdh1 complex in the apo form | 0.7471 | 17 | 269 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.486 | 80 | 262 |
| 7jh6-assembly4.cif.gz_D | de novo designed two-domain di-zn(ii) and porphyrin-binding protein | 0.4842 | 92 | 263 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.4716 | 80 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DSB3_1_115_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.583 | 97 | 255 | 1.20.58.400 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5353 | 94 | 261 | 1.20.120.1770 |
| af_Q4DSB3_1_115_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.5099 | 97 | 255 | 1.20.58.400 |
| 4gd3B00 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.5051 | 92 | 262 | 1.20.950.20 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5027 | 94 | 261 | 1.20.120.1770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1FLJ0-F1-model_v4 | deleted | 0.968 | 180 | 269 |
|
| AF-A0A6B1FLJ0-F1-model_v4 | deleted | 0.9576 | 180 | 269 |
|
| AF-A0A2V7RLD6-F1-model_v4 | Succinate dehydrogenase | 0.9508 | 152 | 269 |
GO:0016020
|
| AF-A0A292Z6H2-F1-model_v4 | Putative succinate dehydrogenase | 0.9368 | 161 | 269 |
GO:0016020
|
| AF-A0A2V6H4D2-F1-model_v4 | Succinate dehydrogenase | 0.9366 | 168 | 269 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar