F476936

General Info

Members Datasets Scaffolds Average Seq Length
714 236 714 267

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100459999|Ga0075434_1004599992
Length 285
Sequence MIARLGRILRNQQGQVVTGRAAAARPPIKASTLRKDTWWALPLTVVLVLGSFIVYSTWAGLQNANYWAPPYLSPFYSPCLSAKCLHVTFGYGLPDISLPIIGILSPAFLILWGPGLFRLTCYYYRKAYYRSFWLAPPACAVPDAKRGYTGETRFPLIFQNLHRYAWYVAVIFIVLLTWDAVLAFRFPMPDGSHRLGIGVGTLVMWVNVILLAGYTFSCHSCRHVCGGHVDVFSRAKTRYRVWHFFTRLNENHPAFAWLSLFSVGLTDLYIRLVAMGVIRDLRIVF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017390 3300003203 Bacteria 2974
2 JGI26129J50193_1000967 3300003349 Bacteria 1893
3 Ga0065712_10178808 3300005290 Bacteria 1203
4 Ga0065707_10134579 3300005295 Bacteria 1863
5 Ga0070676_10001402 3300005328 Bacteria 12171
6 Ga0070683_100234008 3300005329 Bacteria 1747
7 Ga0070670_100001558 3300005331 Bacteria 18473
8 Ga0068869_100000795 3300005334 Bacteria 18019
9 Ga0068869_100046889 3300005334 Bacteria 3118
10 Ga0068869_100114011 3300005334 Bacteria 2060
11 Ga0068869_100546733 3300005334 Bacteria 972
12 Ga0070680_100002409 3300005336 Bacteria 13849
13 Ga0070680_100049260 3300005336 Bacteria 3434
14 Ga0070680_100135883 3300005336 Bacteria 2060
15 Ga0070682_100000179 3300005337 Bacteria 47429
16 Ga0068868_100043820 3300005338 Bacteria 3496
17 Ga0068868_100256546 3300005338 Bacteria 1473
18 Ga0070660_100000476 3300005339 Bacteria 26750
19 Ga0070689_100073029 3300005340 Bacteria 2682
20 Ga0070691_10002169 3300005341 Bacteria 8686
21 Ga0070691_10111549 3300005341 Bacteria 1369
22 Ga0070661_100000876 3300005344 Bacteria 21630
23 Ga0070692_10000828 3300005345 Bacteria 10344
24 Ga0070692_10001115 3300005345 Bacteria 9386
25 Ga0070692_10046023 3300005345 Bacteria 2253
26 Ga0070692_10250019 3300005345 Bacteria 1061
27 Ga0070669_100017830 3300005353 Bacteria 5067
28 Ga0070669_100414852 3300005353 Bacteria 1104
29 Ga0070673_100447972 3300005364 Bacteria 1161
30 Ga0070688_100064606 3300005365 Bacteria 2323
31 Ga0070659_100153974 3300005366 Bacteria 1876
32 Ga0070701_10069613 3300005438 Bacteria 1877
33 Ga0070705_100000333 3300005440 Bacteria 27695
34 Ga0070705_100035395 3300005440 Bacteria 2799
35 Ga0070705_100078316 3300005440 Bacteria 2021
36 Ga0070705_100101787 3300005440 Bacteria 1815
37 Ga0070705_100122966 3300005440 Bacteria 1679
38 Ga0070705_100140294 3300005440 Bacteria 1590
39 Ga0070700_100026807 3300005441 Bacteria 3408
40 Ga0070700_100212381 3300005441 Bacteria 1366
41 Ga0070700_100477935 3300005441 Bacteria 954
42 Ga0070694_100022054 3300005444 Bacteria 4078
43 Ga0070694_100075232 3300005444 Bacteria 2335
44 Ga0070694_100182553 3300005444 Bacteria 1553
45 Ga0070694_100248203 3300005444 Bacteria 1345
46 Ga0070708_100006589 3300005445 Bacteria 9242
47 Ga0070708_100016216 3300005445 Bacteria 6177
48 Ga0070708_100055617 3300005445 Bacteria 3519
49 Ga0070708_100075366 3300005445 Bacteria 3045
50 Ga0070708_100159392 3300005445 Bacteria 2102
51 Ga0070708_100186897 3300005445 Bacteria 1938
52 Ga0070663_100226349 3300005455 Bacteria 1471
53 Ga0070663_100480325 3300005455 Bacteria 1029
54 Ga0070662_100027815 3300005457 Bacteria 3931
55 Ga0070681_10004124 3300005458 Bacteria 13743
56 Ga0068867_100000455 3300005459 Bacteria 27140
57 Ga0068867_100194989 3300005459 Bacteria 1618
58 Ga0068867_100547178 3300005459 Bacteria 1002
59 Ga0070706_100047684 3300005467 Bacteria 3954
60 Ga0070706_100062204 3300005467 Bacteria 3449
61 Ga0070706_100077558 3300005467 Bacteria 3075
62 Ga0070706_100116134 3300005467 Bacteria 2492
63 Ga0070706_100117317 3300005467 Bacteria 2479
64 Ga0070706_100224884 3300005467 Bacteria 1752
65 Ga0070706_100603264 3300005467 Bacteria 1020
66 Ga0070707_100000108 3300005468 Bacteria 76022
67 Ga0070707_100017934 3300005468 Bacteria 6656
68 Ga0070707_100103935 3300005468 Bacteria 2753
69 Ga0070707_100113897 3300005468 Bacteria 2624
70 Ga0070707_100261817 3300005468 Bacteria 1682
71 Ga0070707_100593067 3300005468 Bacteria 1070
72 Ga0070707_100603131 3300005468 Bacteria 1060
73 Ga0070698_100000691 3300005471 Bacteria 36018
74 Ga0070698_100011480 3300005471 Bacteria 9401
75 Ga0070698_100014980 3300005471 Bacteria 8196
76 Ga0070698_100094612 3300005471 Bacteria 2966
77 Ga0070698_100161752 3300005471 Bacteria 2182
78 Ga0070698_100258778 3300005471 Bacteria 1673
79 Ga0070699_100003274 3300005518 Bacteria 14324
80 Ga0070699_100013457 3300005518 Bacteria 7045
81 Ga0070699_100013570 3300005518 Bacteria 7013
82 Ga0070699_100015560 3300005518 Bacteria 6538
83 Ga0070699_100020088 3300005518 Bacteria 5757
84 Ga0070699_100061434 3300005518 Bacteria 3256
85 Ga0070699_100081230 3300005518 Bacteria 2826
86 Ga0070699_100224249 3300005518 Bacteria 1675
87 Ga0070699_100230631 3300005518 Bacteria 1651
88 Ga0070699_100279410 3300005518 Bacteria 1495
89 Ga0070699_100302754 3300005518 Bacteria 1434
90 Ga0070679_100007477 3300005530 Bacteria 10214
91 Ga0070679_100203873 3300005530 Bacteria 1943
92 Ga0070684_100164633 3300005535 Bacteria 2013
93 Ga0070697_100023932 3300005536 Bacteria 4860
94 Ga0070697_100065632 3300005536 Bacteria 2966
95 Ga0070697_100093448 3300005536 Bacteria 2490
96 Ga0070697_100124263 3300005536 Bacteria 2161
97 Ga0070697_100285780 3300005536 Bacteria 1416
98 Ga0070697_100349732 3300005536 Bacteria 1276
99 Ga0070697_100449415 3300005536 Bacteria 1122
100 Ga0068853_100191463 3300005539 Bacteria 1858
101 Ga0070672_100287910 3300005543 Bacteria 1390
102 Ga0070695_100003891 3300005545 Bacteria 8713
103 Ga0070695_100061321 3300005545 Bacteria 2440
104 Ga0070695_100082910 3300005545 Bacteria 2123
105 Ga0070695_100276227 3300005545 Unclassified 1233
106 Ga0070696_100036054 3300005546 Bacteria 3408
107 Ga0070696_100108775 3300005546 Bacteria 1994
108 Ga0070696_100272373 3300005546 Bacteria 1288
109 Ga0070693_100009781 3300005547 Bacteria 4780
110 Ga0070693_100338664 3300005547 Bacteria 1026
111 Ga0070704_100015876 3300005549 Bacteria 4742
112 Ga0070704_100046308 3300005549 Bacteria 3032
113 Ga0070704_100047238 3300005549 Bacteria 3008
114 Ga0070704_100103095 3300005549 Bacteria 2154
115 Ga0068855_100000225 3300005563 Bacteria 72196
116 Ga0070664_100017355 3300005564 Bacteria 5910
117 Ga0068857_100237393 3300005577 Bacteria 1668
118 Ga0068854_100013613 3300005578 Bacteria 5346
119 Ga0068854_100484107 3300005578 Bacteria 1039
120 Ga0068854_100511278 3300005578 Bacteria 1013
121 Ga0068854_100626729 3300005578 Bacteria 921
122 Ga0068856_100001169 3300005614 Bacteria 27611
123 Ga0068852_100142485 3300005616 Bacteria 2220
124 Ga0068859_100001393 3300005617 Bacteria 24544
125 Ga0068859_100089345 3300005617 Bacteria 3131
126 Ga0068864_100285188 3300005618 Bacteria 1542
127 Ga0068866_10060874 3300005718 Bacteria 1959
128 Ga0068866_10267607 3300005718 Bacteria 1053
129 Ga0068861_100018775 3300005719 Bacteria 4930
130 Ga0068870_10000139 3300005840 Bacteria 25224
131 Ga0068863_100032824 3300005841 Bacteria 4947
132 Ga0068863_100079836 3300005841 Bacteria 3098
133 Ga0068858_100189302 3300005842 Bacteria 1944
134 Ga0068860_100001109 3300005843 Bacteria 29627
135 Ga0068860_100315180 3300005843 Bacteria 1534
136 Ga0068862_100003750 3300005844 Bacteria 12958
137 Ga0068862_100080533 3300005844 Bacteria 2824
138 Ga0068862_100087038 3300005844 Bacteria 2717
139 Ga0068862_100143465 3300005844 Bacteria 2121
140 Ga0068862_100546214 3300005844 Bacteria 1106
141 Ga0081455_10001810 3300005937 Bacteria 25776
142 Ga0081538_10015371 3300005981 Bacteria 5929
143 Ga0081540_1005034 3300005983 Bacteria 9916
144 Ga0081539_10000005 3300005985 Bacteria 549026
145 Ga0075432_10024663 3300006058 Bacteria 2062
146 Ga0070715_10016204 3300006163 Bacteria 2796
147 Ga0070716_100085712 3300006173 Bacteria 1893
148 Ga0070712_100006589 3300006175 Bacteria 7212
149 Ga0075367_10339685 3300006178 Unclassified 947
150 Ga0068871_100259299 3300006358 Bacteria 1516
151 Ga0075428_100000924 3300006844 Bacteria 31024
152 Ga0075428_100001380 3300006844 Bacteria 25833
153 Ga0075428_100023900 3300006844 Bacteria 6763
154 Ga0075428_100030517 3300006844 Bacteria 5961
155 Ga0075428_100054921 3300006844 Bacteria 4364
156 Ga0075428_100182861 3300006844 Bacteria 2268
157 Ga0075428_100197674 3300006844 Bacteria 2174
158 Ga0075428_100224837 3300006844 Bacteria 2026
159 Ga0075428_100624849 3300006844 Bacteria 1150
160 Ga0075430_100000019 3300006846 Bacteria 86721
161 Ga0075430_100000487 3300006846 Bacteria 29740
162 Ga0075430_100016723 3300006846 Bacteria 6247
163 Ga0075430_100046733 3300006846 Bacteria 3656
164 Ga0075430_100061652 3300006846 Bacteria 3151
165 Ga0075430_100147154 3300006846 Bacteria 1962
166 Ga0075430_100212495 3300006846 Bacteria 1605
167 Ga0075431_100000797 3300006847 Bacteria 27524
168 Ga0075431_100002180 3300006847 Bacteria 18719
169 Ga0075431_100002229 3300006847 Bacteria 18559
170 Ga0075431_100008469 3300006847 Bacteria 10298
171 Ga0075431_100011273 3300006847 Bacteria 9005
172 Ga0075431_100023868 3300006847 Bacteria 6261
173 Ga0075431_100072397 3300006847 Bacteria 3556
174 Ga0075431_100168828 3300006847 Bacteria 2249
175 Ga0075431_100340726 3300006847 Bacteria 1509
176 Ga0075431_100503852 3300006847 Bacteria 1201
177 Ga0075433_10006420 3300006852 Bacteria 9298
178 Ga0075433_10032400 3300006852 Bacteria 4476
179 Ga0075433_10056759 3300006852 Bacteria 3421
180 Ga0075433_10062927 3300006852 Bacteria 3250
181 Ga0075433_10082435 3300006852 Bacteria 2836
182 Ga0075433_10166688 3300006852 Bacteria 1960
183 Ga0075433_10281102 3300006852 Bacteria 1474
184 Ga0075434_100022146 3300006871 Bacteria 6189
185 Ga0075434_100031633 3300006871 Bacteria 5217
186 Ga0075434_100033398 3300006871 Bacteria 5078
187 Ga0075434_100087316 3300006871 Bacteria 3119
188 Ga0075434_100156094 3300006871 Bacteria 2301
189 Ga0075434_100163988 3300006871 Bacteria 2242
190 Ga0075434_100167389 3300006871 Bacteria 2218
191 Ga0075434_100223242 3300006871 Bacteria 1904
192 Ga0075434_100232081 3300006871 Bacteria 1865
193 Ga0075434_100459999 3300006871 Bacteria 1294
194 Ga0075429_100000859 3300006880 Bacteria 23924
195 Ga0075429_100010038 3300006880 Bacteria 8205
196 Ga0075429_100011531 3300006880 Bacteria 7665
197 Ga0075429_100021240 3300006880 Bacteria 5627
198 Ga0075429_100027920 3300006880 Bacteria 4899
199 Ga0075429_100030148 3300006880 Bacteria 4712
200 Ga0075429_100144176 3300006880 Bacteria 2084
201 Ga0075429_100424371 3300006880 Bacteria 1165
202 Ga0075429_100611439 3300006880 Bacteria 955
203 Ga0068865_100124729 3300006881 Bacteria 1920
204 Ga0075436_100001157 3300006914 Bacteria 17854
205 Ga0075436_100015235 3300006914 Bacteria 5266
206 Ga0075436_100041000 3300006914 Bacteria 3195
207 Ga0075436_100146490 3300006914 Bacteria 1661
208 Ga0075436_100414469 3300006914 Bacteria 977
209 Ga0097620_100001393 3300006931 Bacteria 24544
210 Ga0097620_100089342 3300006931 Bacteria 3131
211 Ga0075435_100000661 3300007076 Bacteria 21221
212 Ga0075435_100015296 3300007076 Bacteria 5766
213 Ga0075435_100057817 3300007076 Bacteria 3138
214 Ga0075435_100485406 3300007076 Bacteria 1067
215 Ga0099794_10007170 3300007265 Bacteria 4562
216 Ga0099794_10016643 3300007265 Bacteria 3264
217 Ga0099794_10033382 3300007265 Bacteria 2420
218 Ga0099794_10119145 3300007265 Bacteria 1327
219 Ga0111539_10000535 3300009094 Bacteria 48283
220 Ga0111539_10018495 3300009094 Bacteria 8631
221 Ga0111539_10082769 3300009094 Bacteria 3775
222 Ga0111539_10114639 3300009094 Bacteria 3161
223 Ga0111539_10192811 3300009094 Bacteria 2377
224 Ga0111539_10249379 3300009094 Bacteria 2067
225 Ga0111539_10481786 3300009094 Bacteria 1445
226 Ga0114129_10000115 3300009147 Bacteria 80576
227 Ga0114129_10000606 3300009147 Bacteria 44322
228 Ga0114129_10001631 3300009147 Bacteria 30466
229 Ga0114129_10008441 3300009147 Bacteria 14680
230 Ga0114129_10009875 3300009147 Bacteria 13607
231 Ga0114129_10012726 3300009147 Bacteria 11977
232 Ga0114129_10036324 3300009147 Bacteria 6958
233 Ga0114129_10079508 3300009147 Bacteria 4559
234 Ga0114129_10102712 3300009147 Bacteria 3953
235 Ga0114129_10102978 3300009147 Bacteria 3947
236 Ga0114129_10114996 3300009147 Bacteria 3709
237 Ga0114129_10119347 3300009147 Bacteria 3632
238 Ga0114129_10225093 3300009147 Bacteria 2529
239 Ga0114129_10273784 3300009147 Bacteria 2258
240 Ga0114129_10529845 3300009147 Bacteria 1535
241 Ga0114129_10563662 3300009147 Bacteria 1480
242 Ga0114129_10734822 3300009147 Bacteria 1265
243 Ga0114129_10738955 3300009147 Bacteria 1261
244 Ga0114129_10753981 3300009147 Bacteria 1246
245 Ga0114129_10919193 3300009147 Bacteria 1107
246 Ga0105243_10007774 3300009148 Bacteria 8242
247 Ga0105243_10275853 3300009148 Bacteria 1512
248 Ga0105241_10001038 3300009174 Bacteria 21150
249 Ga0105241_10133370 3300009174 Bacteria 2013
250 Ga0105241_10212150 3300009174 Bacteria 1623
251 Ga0105242_10016052 3300009176 Bacteria 5817
252 Ga0105248_10472423 3300009177 Bacteria 1413
253 Ga0105249_10082436 3300009553 Bacteria 2992
254 Ga0105249_10227328 3300009553 Bacteria 1839
255 Ga0105249_10779791 3300009553 Bacteria 1019
256 Ga0105239_10016176 3300010375 Bacteria 8254
257 Ga0105239_10383916 3300010375 Bacteria 1588
258 Ga0105246_10170521 3300011119 Bacteria 1666
259 Ga0157373_10000388 3300013100 Bacteria 35150
260 Ga0157371_10107766 3300013102 Bacteria 1977
261 Ga0157369_10232425 3300013105 Bacteria 1927
262 Ga0157378_10339128 3300013297 Bacteria 1465
263 Ga0163162_10015647 3300013306 Bacteria 7413
264 Ga0163162_10017085 3300013306 Bacteria 7099
265 Ga0163162_10316041 3300013306 Bacteria 1694
266 Ga0163162_10361522 3300013306 Bacteria 1585
267 Ga0163162_11141169 3300013306 Bacteria 884
268 Ga0157372_10000105 3300013307 Bacteria 88007
269 Ga0157372_10072881 3300013307 Bacteria 3870
270 Ga0157380_10135536 3300014326 Bacteria 2107
271 Ga0157379_10190827 3300014968 Bacteria 1851
272 Ga0157379_10414095 3300014968 Bacteria 1240
273 Ga0182007_10037705 3300015262 Bacteria 1622
274 Ga0207653_10019880 3300025885 Bacteria 2120
275 Ga0207653_10038407 3300025885 Bacteria 1564
276 Ga0207642_10233978 3300025899 Bacteria 1034
277 Ga0207688_10012816 3300025901 Bacteria 4558
278 Ga0207645_10005499 3300025907 Bacteria 9176
279 Ga0207643_10001465 3300025908 Bacteria 13545
280 Ga0207684_10000115 3300025910 Bacteria 149762
281 Ga0207684_10019692 3300025910 Bacteria 5772
282 Ga0207684_10073541 3300025910 Bacteria 2903
283 Ga0207684_10132276 3300025910 Bacteria 2141
284 Ga0207684_10148413 3300025910 Bacteria 2017
285 Ga0207684_10359491 3300025910 Bacteria 1253
286 Ga0207654_10004154 3300025911 Bacteria 7301
287 Ga0207654_10082136 3300025911 Bacteria 1942
288 Ga0207707_10000352 3300025912 Bacteria 48248
289 Ga0207671_10168526 3300025914 Bacteria 1699
290 Ga0207693_10025215 3300025915 Bacteria 4715
291 Ga0207663_10207634 3300025916 Bacteria 1417
292 Ga0207660_10000334 3300025917 Bacteria 30356
293 Ga0207660_10570966 3300025917 Bacteria 920
294 Ga0207657_10002597 3300025919 Bacteria 19548
295 Ga0207649_10006035 3300025920 Bacteria 6576
296 Ga0207652_10000466 3300025921 Bacteria 41482
297 Ga0207646_10000250 3300025922 Bacteria 73162
298 Ga0207646_10003851 3300025922 Bacteria 16662
299 Ga0207646_10008025 3300025922 Bacteria 10643
300 Ga0207646_10028619 3300025922 Bacteria 5069
301 Ga0207646_10084314 3300025922 Bacteria 2843
302 Ga0207646_10108278 3300025922 Bacteria 2493
303 Ga0207646_10196959 3300025922 Bacteria 1819
304 Ga0207646_10283279 3300025922 Bacteria 1498
305 Ga0207646_10590039 3300025922 Bacteria 998
306 Ga0207681_10013659 3300025923 Bacteria 5028
307 Ga0207681_10166559 3300025923 Bacteria 1666
308 Ga0207681_10420961 3300025923 Bacteria 1082
309 Ga0207694_10201692 3300025924 Bacteria 1619
310 Ga0207650_10025156 3300025925 Bacteria 4239
311 Ga0207659_10148540 3300025926 Bacteria 1828
312 Ga0207690_10041224 3300025932 Bacteria 3024
313 Ga0207706_10024583 3300025933 Bacteria 5400
314 Ga0207706_10080188 3300025933 Bacteria 2870
315 Ga0207706_10131427 3300025933 Bacteria 2202
316 Ga0207706_10468686 3300025933 Bacteria 1089
317 Ga0207709_10003271 3300025935 Bacteria 9720
318 Ga0207709_10071982 3300025935 Bacteria 2197
319 Ga0207670_10088095 3300025936 Bacteria 2188
320 Ga0207670_10320547 3300025936 Bacteria 1219
321 Ga0207704_10160750 3300025938 Bacteria 1598
322 Ga0207665_10114297 3300025939 Bacteria 1900
323 Ga0207665_10165423 3300025939 Bacteria 1594
324 Ga0207691_10203962 3300025940 Bacteria 1720
325 Ga0207711_10418118 3300025941 Bacteria 1247
326 Ga0207689_10003685 3300025942 Bacteria 13959
327 Ga0207689_10074531 3300025942 Bacteria 2789
328 Ga0207661_10148620 3300025944 Bacteria 2024
329 Ga0207679_10000878 3300025945 Bacteria 19200
330 Ga0207667_10000497 3300025949 Bacteria 51927
331 Ga0207712_10347335 3300025961 Bacteria 1232
332 Ga0207712_10547631 3300025961 Bacteria 995
333 Ga0207640_10088641 3300025981 Bacteria 2136
334 Ga0207640_10100394 3300025981 Bacteria 2027
335 Ga0207640_10476418 3300025981 Bacteria 1034
336 Ga0207658_10165220 3300025986 Bacteria 1818
337 Ga0207677_10228346 3300026023 Bacteria 1498
338 Ga0207677_10422300 3300026023 Bacteria 1136
339 Ga0207703_10019303 3300026035 Bacteria 5325
340 Ga0207703_10318461 3300026035 Bacteria 1424
341 Ga0207639_10002384 3300026041 Bacteria 12612
342 Ga0207678_10013961 3300026067 Bacteria 7060
343 Ga0207678_10253752 3300026067 Bacteria 1507
344 Ga0207708_10135745 3300026075 Bacteria 1927
345 Ga0207708_10248471 3300026075 Bacteria 1433
346 Ga0207708_10396790 3300026075 Bacteria 1140
347 Ga0207708_10456647 3300026075 Bacteria 1065
348 Ga0207708_10570979 3300026075 Bacteria 956
349 Ga0207702_10008955 3300026078 Bacteria 8434
350 Ga0207641_10071148 3300026088 Bacteria 2991
351 Ga0207641_10082607 3300026088 Bacteria 2792
352 Ga0207648_10015946 3300026089 Bacteria 6885
353 Ga0207648_10153126 3300026089 Bacteria 2035
354 Ga0207648_10202775 3300026089 Bacteria 1759
355 Ga0207648_10295593 3300026089 Bacteria 1451
356 Ga0207648_10752173 3300026089 Bacteria 905
357 Ga0207674_10000550 3300026116 Bacteria 49205
358 Ga0207675_100002639 3300026118 Bacteria 17699
359 Ga0207675_100005709 3300026118 Bacteria 11909
360 Ga0207675_100132891 3300026118 Bacteria 2360
361 Ga0207698_10116523 3300026142 Bacteria 2252
362 Ga0209981_1000490 3300027378 Bacteria 5020
363 Ga0209996_1000338 3300027395 Bacteria 5808
364 Ga0210000_1017209 3300027462 Bacteria 1095
365 Ga0209995_1002164 3300027471 Bacteria 3084
366 Ga0209968_1000579 3300027526 Bacteria 5659
367 Ga0209999_1000243 3300027543 Bacteria 7873
368 Ga0209982_1001041 3300027552 Bacteria 3693
369 Ga0210002_1017292 3300027617 Bacteria 1147
370 Ga0209983_1000034 3300027665 Bacteria 19527
371 Ga0209588_1017370 3300027671 Bacteria 2230
372 Ga0209971_1000028 3300027682 Bacteria 53458
373 Ga0209971_1005708 3300027682 Bacteria 2948
374 Ga0209966_1000073 3300027695 Bacteria 44067
375 Ga0209966_1009155 3300027695 Bacteria 1764
376 Ga0209998_10000001 3300027717 Bacteria 203589
377 Ga0209974_10000369 3300027876 Bacteria 14852
378 Ga0209974_10066276 3300027876 Bacteria 1227
379 Ga0207428_10000176 3300027907 Bacteria 89634
380 Ga0207428_10000394 3300027907 Bacteria 54660
381 Ga0207428_10123151 3300027907 Bacteria 1987
382 Ga0207428_10141454 3300027907 Bacteria 1836
383 Ga0268265_10002923 3300028380 Bacteria 12524
384 Ga0268265_10024098 3300028380 Bacteria 4300
385 Ga0268265_10088185 3300028380 Bacteria 2471
386 Ga0268265_10268221 3300028380 Bacteria 1521
387 Ga0268264_10031393 3300028381 Bacteria 4356
388 Ga0268264_10155527 3300028381 Bacteria 2054
389 Ga0268264_10216801 3300028381 Bacteria 1760
390 Ga0307408_100034524 3300031548 Bacteria 3543
391 Ga0307408_100048113 3300031548 Bacteria 3057
392 Ga0307408_100145291 3300031548 Bacteria 1866
393 Ga0307408_100353624 3300031548 Bacteria 1247
394 Ga0307405_10240301 3300031731 Bacteria 1341
395 Ga0307410_10059238 3300031852 Bacteria 2614
396 Ga0307410_10193742 3300031852 Bacteria 1547
397 Ga0307416_100599922 3300032002 Bacteria 1181
398 Ga0307411_10063789 3300032005 Bacteria 2464
399 Ga0307411_10334865 3300032005 Bacteria 1228
400 Ga0373959_0013857 3300034820 Bacteria 1460
401 Ga0373940_0017681 3300035088 Bacteria 1779
402 Ga0373949_0043019 3300035090 Bacteria 1116
403 Ga0373951_0013500 3300035091 Bacteria 1836
404 Ga0373932_0003143 3300035112 Bacteria 4023
405 Ga0373932_0026642 3300035112 Bacteria 1574
406 Ga0373939_0007077 3300035114 Bacteria 2716
407 Ga0373939_0039678 3300035114 Bacteria 1410
408 Ga0373960_0032466 3300035121 Bacteria 1466
409 Ga0373931_0008836 3300035691 Bacteria 4795
410 Ga0395899_0005401 3300037312 Bacteria 9925
411 Ga0395900_0062032 3300037418 Bacteria 3843
412 Ga0395900_0333236 3300037418 Bacteria 1495
413 Ga0395898_0079077 3300037466 Bacteria 3172
414 Ga0395905_0139761 3300037471 Bacteria 2279
415 Ga0395901_0029677 3300038443 Bacteria 5631
416 Ga0439448_0009418 3300042005 Bacteria 2879
417 Ga0439455_0013689 3300042012 Bacteria 1842
418 Ga0439458_0002296 3300042157 Bacteria 4694
419 Ga0439435_0042049 3300042436 Bacteria 1282
420 Ga0439460_0058949 3300042461 Bacteria 1168
421 Ga0451577_0005206 3300042876 Bacteria 13385
422 Ga0451577_0010038 3300042876 Bacteria 9071
423 Ga0451577_0025265 3300042876 Bacteria 5391
424 Ga0451577_0035839 3300042876 Bacteria 4469
425 Ga0451577_0250202 3300042876 Bacteria 1604
426 Ga0453683_0003008 3300044673 Bacteria 12624
427 Ga0453683_0005950 3300044673 Bacteria 8409
428 Ga0453683_0013136 3300044673 Bacteria 5414
429 Ga0453683_0060352 3300044673 Bacteria 2371
430 Ga0453684_0032377 3300044712 Bacteria 7318
431 Ga0453684_0185691 3300044712 Bacteria 2437
432 Ga0453684_0435913 3300044712 Bacteria 1461
433 Ga0451576_0024239 3300045051 Bacteria 6555
434 Ga0451576_0026201 3300045051 Bacteria 6272
435 Ga0451576_0028871 3300045051 Bacteria 5941
436 Ga0451576_0036861 3300045051 Bacteria 5181
437 Ga0451576_0049195 3300045051 Bacteria 4424
438 Ga0451576_0263638 3300045051 Bacteria 1801
439 Ga0451576_0278038 3300045051 Bacteria 1750
440 Ga0451576_0599263 3300045051 Bacteria 1158
441 Ga0495580_0029596 3300046472 Bacteria 3973
442 Ga0495580_0224360 3300046472 Bacteria 1291
443 Ga0495584_0041628 3300046491 Bacteria 2319
444 Ga0495584_0213351 3300046491 Bacteria 981
445 Ga0495659_0061095 3300046664 Bacteria 1392
446 Ga0495669_0032522 3300046684 Bacteria 2293
447 Ga0495669_0185321 3300046684 Bacteria 992
448 Ga0496102_0001871 3300048905 Bacteria 18136
449 Ga0496108_0397804 3300048911 Bacteria 1203
450 Ga0496110_0210918 3300048913 Bacteria 1766
451 Ga0501031_0003020 3300049568 Bacteria 10764
452 Ga0501031_0090122 3300049568 Bacteria 2000
453 Ga0501033_0008980 3300049570 Bacteria 7718
454 Ga0501033_0082046 3300049570 Bacteria 2365
455 Ga0501033_0204541 3300049570 Bacteria 1409
456 Ga0501033_0231964 3300049570 Bacteria 1311
457 Ga0501036_0012481 3300049572 Bacteria 7043
458 Ga0501036_0025187 3300049572 Bacteria 5019
459 Ga0501036_0207057 3300049572 Bacteria 1649
460 Ga0501036_0306586 3300049572 Bacteria 1328
461 Ga0501037_0064932 3300049573 Bacteria 2659
462 Ga0501038_0000777 3300049574 Bacteria 28251
463 Ga0501038_0035789 3300049574 Bacteria 4358
464 Ga0501038_0110847 3300049574 Bacteria 2274
465 Ga0501038_0197507 3300049574 Bacteria 1616
466 Ga0501039_0001226 3300049575 Bacteria 18831
467 Ga0501039_0006761 3300049575 Bacteria 8728
468 Ga0501039_0147603 3300049575 Bacteria 1848
469 Ga0501039_0164062 3300049575 Bacteria 1747
470 Ga0501039_0168675 3300049575 Bacteria 1721
471 Ga0501040_0001715 3300049576 Bacteria 14046
472 Ga0501040_0006783 3300049576 Bacteria 7424
473 Ga0501040_0016619 3300049576 Bacteria 4876
474 Ga0501040_0019396 3300049576 Bacteria 4523
475 Ga0501040_0061962 3300049576 Bacteria 2573
476 Ga0501040_0067285 3300049576 Bacteria 2469
477 Ga0501040_0111631 3300049576 Bacteria 1912
478 Ga0501040_0113952 3300049576 Bacteria 1892
479 Ga0501040_0326956 3300049576 Bacteria 1097
480 Ga0501041_0000102 3300049577 Bacteria 35437
481 Ga0501041_0009513 3300049577 Bacteria 5729
482 Ga0501041_0031877 3300049577 Bacteria 3186
483 Ga0501041_0041434 3300049577 Bacteria 2797
484 Ga0501041_0047070 3300049577 Bacteria 2625
485 Ga0501041_0047877 3300049577 Bacteria 2603
486 Ga0501041_0075614 3300049577 Bacteria 2071
487 Ga0501041_0115390 3300049577 Bacteria 1667
488 Ga0501041_0170777 3300049577 Bacteria 1361
489 Ga0501042_0000777 3300049578 Bacteria 17428
490 Ga0501042_0007483 3300049578 Bacteria 7156
491 Ga0501042_0007739 3300049578 Bacteria 7058
492 Ga0501042_0030821 3300049578 Bacteria 3792
493 Ga0501042_0126960 3300049578 Bacteria 1837
494 Ga0501042_0160808 3300049578 Bacteria 1620
495 Ga0501042_0171228 3300049578 Bacteria 1566
496 Ga0501042_0178235 3300049578 Bacteria 1533
497 Ga0501042_0291500 3300049578 Bacteria 1179
498 Ga0501042_0427570 3300049578 Bacteria 960
499 Ga0501043_0029257 3300049579 Bacteria 4327
500 Ga0501043_0180607 3300049579 Bacteria 1644
501 Ga0501046_0000609 3300049580 Bacteria 35206
502 Ga0501046_0002061 3300049580 Bacteria 19077
503 Ga0501046_0074003 3300049580 Bacteria 2643
504 Ga0501047_0056714 3300049581 Bacteria 3789
505 Ga0501048_0009507 3300049582 Bacteria 7297
506 Ga0501048_0018520 3300049582 Bacteria 5118
507 Ga0501048_0021144 3300049582 Bacteria 4765
508 Ga0501048_0058521 3300049582 Bacteria 2731
509 Ga0501048_0076147 3300049582 Bacteria 2368
510 Ga0501048_0095448 3300049582 Bacteria 2097
511 Ga0501067_0048491 3300049583 Bacteria 2355
512 Ga0501068_0019384 3300049584 Bacteria 3950
513 Ga0501068_0030991 3300049584 Bacteria 3175
514 Ga0501068_0047035 3300049584 Bacteria 2602
515 Ga0501068_0064635 3300049584 Bacteria 2227
516 Ga0501068_0087739 3300049584 Bacteria 1916
517 Ga0501068_0167374 3300049584 Bacteria 1386
518 Ga0501069_0007927 3300049585 Bacteria 5578
519 Ga0501069_0089197 3300049585 Bacteria 1743
520 Ga0501070_0070558 3300049586 Bacteria 2893
521 Ga0501071_0000736 3300049587 Bacteria 17318
522 Ga0501071_0006665 3300049587 Bacteria 7504
523 Ga0501071_0124817 3300049587 Bacteria 1910
524 Ga0501071_0157789 3300049587 Bacteria 1695
525 Ga0501072_0002055 3300049588 Bacteria 14964
526 Ga0501072_0015809 3300049588 Bacteria 5786
527 Ga0501072_0025773 3300049588 Bacteria 4581
528 Ga0501072_0059434 3300049588 Bacteria 3014
529 Ga0501072_0116890 3300049588 Bacteria 2124
530 Ga0501072_0124331 3300049588 Bacteria 2055
531 Ga0501074_0005624 3300049590 Bacteria 9026
532 Ga0501074_0019321 3300049590 Bacteria 4950
533 Ga0501074_0021260 3300049590 Bacteria 4712
534 Ga0501074_0102039 3300049590 Bacteria 2054
535 Ga0501074_0182597 3300049590 Bacteria 1496
536 Ga0501075_0000122 3300049591 Bacteria 37780
537 Ga0501075_0000396 3300049591 Bacteria 25290
538 Ga0501075_0014948 3300049591 Bacteria 5567
539 Ga0501075_0026576 3300049591 Bacteria 4263
540 Ga0501075_0062305 3300049591 Bacteria 2811
541 Ga0501075_0076372 3300049591 Bacteria 2534
542 Ga0501075_0097421 3300049591 Bacteria 2232
543 Ga0501075_0121655 3300049591 Bacteria 1986
544 Ga0501075_0205952 3300049591 Bacteria 1500
545 Ga0501076_0000012 3300049592 Bacteria 113396
546 Ga0501076_0001680 3300049592 Bacteria 14960
547 Ga0501076_0002878 3300049592 Bacteria 11918
548 Ga0501076_0021226 3300049592 Bacteria 4980
549 Ga0501076_0024534 3300049592 Bacteria 4661
550 Ga0501076_0027487 3300049592 Bacteria 4411
551 Ga0501076_0065644 3300049592 Bacteria 2895
552 Ga0501076_0110518 3300049592 Bacteria 2222
553 Ga0501076_0130234 3300049592 Bacteria 2040
554 Ga0501076_0332088 3300049592 Bacteria 1247
555 Ga0501077_0000286 3300049593 Bacteria 30007
556 Ga0501077_0009924 3300049593 Bacteria 5926
557 Ga0501077_0009995 3300049593 Bacteria 5905
558 Ga0501077_0018034 3300049593 Bacteria 4461
559 Ga0501077_0045440 3300049593 Bacteria 2790
560 Ga0501077_0046484 3300049593 Bacteria 2757
561 Ga0501077_0063696 3300049593 Bacteria 2339
562 Ga0501077_0092273 3300049593 Bacteria 1919
563 Ga0501077_0118791 3300049593 Bacteria 1675
564 Ga0501077_0121342 3300049593 Bacteria 1657
565 Ga0501079_0000134 3300049741 Bacteria 40016
566 Ga0501079_0001185 3300049741 Bacteria 18261
567 Ga0501079_0008164 3300049741 Bacteria 7935
568 Ga0501079_0011862 3300049741 Bacteria 6649
569 Ga0501079_0017090 3300049741 Bacteria 5540
570 Ga0501079_0018925 3300049741 Bacteria 5262
571 Ga0501079_0041859 3300049741 Bacteria 3537
572 Ga0501079_0059765 3300049741 Bacteria 2940
573 Ga0501079_0115618 3300049741 Bacteria 2085
574 Ga0501079_0333676 3300049741 Bacteria 1188
575 Ga0501080_0000292 3300049742 Bacteria 38028
576 Ga0501080_0059941 3300049742 Bacteria 3542
577 Ga0501080_0113479 3300049742 Bacteria 2512
578 Ga0501080_0122207 3300049742 Bacteria 2412
579 Ga0501080_0138368 3300049742 Bacteria 2252
580 Ga0501080_0312189 3300049742 Bacteria 1425
581 Ga0501081_0001033 3300049743 Bacteria 16654
582 Ga0501081_0001499 3300049743 Bacteria 14316
583 Ga0501081_0003182 3300049743 Bacteria 10436
584 Ga0501081_0006424 3300049743 Bacteria 7628
585 Ga0501081_0008697 3300049743 Bacteria 6598
586 Ga0501081_0010620 3300049743 Bacteria 6013
587 Ga0501081_0016788 3300049743 Bacteria 4840
588 Ga0501081_0021956 3300049743 Bacteria 4265
589 Ga0501081_0036313 3300049743 Bacteria 3360
590 Ga0501081_0049117 3300049743 Bacteria 2904
591 Ga0501081_0112229 3300049743 Bacteria 1935
592 Ga0501081_0197000 3300049743 Bacteria 1460
593 Ga0501081_0422390 3300049743 Bacteria 988
594 Ga0501083_0031778 3300049744 Bacteria 3623
595 Ga0501083_0103576 3300049744 Bacteria 1875
596 Ga0501083_0113204 3300049744 Bacteria 1783
597 Ga0501035_0006607 3300049822 Bacteria 10855
598 Ga0501035_0048808 3300049822 Bacteria 3795
599 Ga0501035_0415821 3300049822 Bacteria 1117
600 Ga0501035_0451103 3300049822 Bacteria 1064
601 Ga0501045_0002290 3300049824 Bacteria 12977
602 Ga0501045_0024468 3300049824 Bacteria 4336
603 Ga0501045_0062629 3300049824 Bacteria 2730
604 Ga0501045_0073786 3300049824 Bacteria 2513
605 nmdc:mga05p37_141781_c1 3300050507 Bacteria 2944
606 nmdc:mga05p37_14582_c1 3300050507 Bacteria 9438
607 nmdc:mga05p37_196355_c1 3300050507 Bacteria 2447
608 nmdc:mga05p37_21565_c1 3300050507 Bacteria 7806
609 nmdc:mga05p37_23238_c1 3300050507 Bacteria 7520
610 nmdc:mga05p37_238148_c1 3300050507 Bacteria 2190
611 nmdc:mga05p37_28205_c1 3300050507 Bacteria 6844
612 nmdc:mga05p37_300449_c1 3300050507 Bacteria 1908
613 nmdc:mga05p37_331825_c1 3300050507 Bacteria 1796
614 nmdc:mga05p37_35596_c1 3300050507 Bacteria 6106
615 nmdc:mga05p37_4063_c1 3300050507 Bacteria 17103
616 nmdc:mga05p37_407123_c1 3300050507 Unclassified 1587
617 nmdc:mga05p37_49894_c1 3300050507 Bacteria 5148
618 nmdc:mga05p37_743528_c1 3300050507 Bacteria 1082
619 nmdc:mga05p37_85453_c1 3300050507 Bacteria 3888
620 nmdc:mga05p37_89_c1 3300050507 Bacteria 81482
621 nmdc:mga09592_1406_c1 3300050508 Bacteria 19268
622 nmdc:mga09592_144514_c1 3300050508 Bacteria 2051
623 nmdc:mga09592_21339_c1 3300050508 Bacteria 5338
624 nmdc:mga09592_310142_c1 3300050508 Bacteria 1367
625 nmdc:mga09592_6345_c1 3300050508 Bacteria 9637
626 nmdc:mga09592_837_c1 3300050508 Bacteria 23885
627 nmdc:mga0qj67_167798_c1 3300050509 Bacteria 1782
628 nmdc:mga0qj67_22992_c1 3300050509 Bacteria 4790
629 nmdc:mga0qj67_272243_c1 3300050509 Bacteria 1373
630 nmdc:mga0qj67_343_c1 3300050509 Bacteria 32121
631 nmdc:mga0qj67_43339_c1 3300050509 Bacteria 3544
632 nmdc:mga0qj67_798_c1 3300050509 Bacteria 21472
633 nmdc:mga06r32_10348_c1 3300050510 Bacteria 8414
634 nmdc:mga06r32_14068_c1 3300050510 Bacteria 7257
635 nmdc:mga06r32_176697_c1 3300050510 Bacteria 2120
636 nmdc:mga06r32_204473_c1 3300050510 Bacteria 1962
637 nmdc:mga06r32_32294_c1 3300050510 Bacteria 4924
638 nmdc:mga06r32_460165_c1 3300050510 Bacteria 1251
639 nmdc:mga06r32_4631_c1 3300050510 Bacteria 12337
640 nmdc:mga06r32_469340_c1 3300050510 Bacteria 1237
641 nmdc:mga06r32_790916_c1 3300050510 Bacteria 910
642 nmdc:mga06r32_87705_c1 3300050510 Bacteria 3037
643 nmdc:mga08y16_1016574_c1 3300050511 Bacteria 808
644 nmdc:mga08y16_108945_c1 3300050511 Bacteria 2884
645 nmdc:mga08y16_1417_c1 3300050511 Bacteria 24061
646 nmdc:mga08y16_158513_c1 3300050511 Bacteria 2352
647 nmdc:mga08y16_163309_c1 3300050511 Bacteria 2314
648 nmdc:mga08y16_2945_c1 3300050511 Bacteria 17531
649 nmdc:mga08y16_420122_c1 3300050511 Bacteria 1366
650 nmdc:mga08y16_90439_c1 3300050511 Bacteria 3191
651 nmdc:mga0n895_176870_c1 3300050512 Bacteria 2165
652 nmdc:mga0n895_203_c1 3300050512 Bacteria 21253
653 nmdc:mga0n895_271662_c1 3300050512 Bacteria 1720
654 nmdc:mga0n895_35010_c1 3300050512 Bacteria 4838
655 nmdc:mga0n895_357894_c1 3300050512 Bacteria 1478
656 nmdc:mga0n895_41940_c1 3300050512 Bacteria 4451
657 nmdc:mga0n895_43098_c1 3300050512 Bacteria 4396
658 nmdc:mga0n895_61867_c1 3300050512 Bacteria 3698
659 nmdc:mga0n895_657044_c1 3300050512 Unclassified 1047
660 nmdc:mga0n895_883841_c1 3300050512 Bacteria 880
661 nmdc:mga0n895_88977_c1 3300050512 Bacteria 3088
662 nmdc:mga0rr50_694_c1 3300050513 Bacteria 18015
663 nmdc:mga0rr50_88479_c1 3300050513 Bacteria 2406
664 nmdc:mga08x19_153171_c1 3300050514 Bacteria 1562
665 nmdc:mga08x19_29864_c1 3300050514 Bacteria 3421
666 nmdc:mga08x19_397209_c1 3300050514 Bacteria 967
667 nmdc:mga08x19_4220_c1 3300050514 Bacteria 8518
668 nmdc:mga08x19_470_c1 3300050514 Bacteria 27216
669 nmdc:mga08x19_7471_c1 3300050514 Bacteria 6491
670 nmdc:mga0a205_12060_c1 3300050515 Bacteria 7985
671 nmdc:mga0a205_123700_c1 3300050515 Bacteria 2487
672 nmdc:mga0a205_15170_c1 3300050515 Bacteria 7197
673 nmdc:mga0a205_156982_c1 3300050515 Bacteria 2173
674 nmdc:mga0a205_205119_c1 3300050515 Bacteria 1861
675 nmdc:mga0a205_22996_c1 3300050515 Bacteria 5910
676 nmdc:mga0a205_23223_c1 3300050515 Bacteria 2949
677 nmdc:mga0a205_24042_c1 3300050515 Bacteria 5786
678 nmdc:mga0a205_420270_c1 3300050515 Bacteria 1199
679 nmdc:mga0a205_5896_c1 3300050515 Bacteria 11035
680 nmdc:mga0a205_66914_c2 3300050515 Bacteria 2986
681 nmdc:mga0a205_76617_c1 3300050515 Bacteria 3232
682 Ga0501084_0000300 3300054114 Bacteria 37454
683 Ga0501084_0001169 3300054114 Bacteria 20453
684 Ga0501084_0001730 3300054114 Bacteria 17322
685 Ga0501084_0015809 3300054114 Bacteria 6259
686 Ga0501084_0024553 3300054114 Bacteria 5029
687 Ga0501084_0036762 3300054114 Bacteria 4092
688 Ga0501084_0053423 3300054114 Bacteria 3380
689 Ga0501084_0055736 3300054114 Bacteria 3307
690 Ga0501084_0097754 3300054114 Bacteria 2465
691 Ga0501084_0199873 3300054114 Bacteria 1686
692 Ga0501084_0312606 3300054114 Bacteria 1327
693 Ga0501084_0319994 3300054114 Bacteria 1310
694 Ga0590071_010281 3300059421 Bacteria 2193
695 Ga0590075_007138 3300059424 Bacteria 2650
696 Ga0501082_0002631 3300060353 Bacteria 15690
697 Ga0501082_0009410 3300060353 Bacteria 8414
698 Ga0501082_0016940 3300060353 Bacteria 6274
699 Ga0501082_0026089 3300060353 Bacteria 5037
700 Ga0501082_0056973 3300060353 Bacteria 3367
701 Ga0501082_0064057 3300060353 Bacteria 3166
702 Ga0501082_0282495 3300060353 Bacteria 1445
703 Ga0501082_0351825 3300060353 Bacteria 1284
704 Ga0530510_0000015 3300061734 Bacteria 104554
705 Ga0530510_0001748 3300061734 Bacteria 14807
706 Ga0530510_0015625 3300061734 Bacteria 5364
707 Ga0530510_0046999 3300061734 Bacteria 3118
708 Ga0530510_0063379 3300061734 Bacteria 2676
709 Ga0530510_0136055 3300061734 Bacteria 1809
710 Ga0530510_0179918 3300061734 Bacteria 1568
711 Ga0530510_0188761 3300061734 Bacteria 1529
712 Ga0530510_0221293 3300061734 Bacteria 1407
713 Ga0530510_0236658 3300061734 Bacteria 1359
714 Ga0530510_0283842 3300061734 Bacteria 1237

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10383916 Ga0105239_103839162 230
2 3300013306 Ga0163162_11141169 Ga0163162_111411691 230
3 3300048913 Ga0496110_0210918 Ga0496110_0210918_775_1470 230
4 3300005334 Ga0068869_100546733 Ga0068869_1005467332 232
5 3300005338 Ga0068868_100256546 Ga0068868_1002565462 232
6 3300005545 Ga0070695_100276227 Ga0070695_1002762272 232
7 3300005578 Ga0068854_100484107 Ga0068854_1004841071 232
8 3300025923 Ga0207681_10420961 Ga0207681_104209611 232
9 3300025981 Ga0207640_10100394 Ga0207640_101003941 232
10 3300026023 Ga0207677_10228346 Ga0207677_102283462 232
11 3300045051 Ga0451576_0599263 Ga0451576_0599263_409_1131 232
12 3300050511 nmdc:mga08y16_90439_c1 nmdc:mga08y16_90439_c1_782_1582 232
13 3300050515 nmdc:mga0a205_22996_c1 nmdc:mga0a205_22996_c1_3517_4317 232
14 3300050511 nmdc:mga08y16_1016574_c1 nmdc:mga08y16_1016574_c1_32_769 234
15 3300049576 Ga0501040_0006783 Ga0501040_0006783_6003_6824 239
16 3300049577 Ga0501041_0041434 Ga0501041_0041434_1028_1849 239
17 3300049578 Ga0501042_0007739 Ga0501042_0007739_1358_2179 239
18 3300049580 Ga0501046_0002061 Ga0501046_0002061_731_1552 239
19 3300049581 Ga0501047_0056714 Ga0501047_0056714_2750_3571 239
20 3300049582 Ga0501048_0058521 Ga0501048_0058521_892_1713 239
21 3300049584 Ga0501068_0064635 Ga0501068_0064635_921_1742 239
22 3300049588 Ga0501072_0116890 Ga0501072_0116890_480_1301 239
23 3300049590 Ga0501074_0019321 Ga0501074_0019321_2177_2998 239
24 3300049591 Ga0501075_0097421 Ga0501075_0097421_290_1111 239
25 3300049592 Ga0501076_0021226 Ga0501076_0021226_2103_2924 239
26 3300049741 Ga0501079_0001185 Ga0501079_0001185_16397_17218 239
27 3300049743 Ga0501081_0016788 Ga0501081_0016788_957_1778 239
28 3300049744 Ga0501083_0031778 Ga0501083_0031778_1109_1930 239
29 3300049822 Ga0501035_0451103 Ga0501035_0451103_159_980 239
30 3300054114 Ga0501084_0000300 Ga0501084_0000300_36127_36948 239
31 3300060353 Ga0501082_0064057 Ga0501082_0064057_989_1810 239
32 3300061734 Ga0530510_0046999 Ga0530510_0046999_188_1009 239
33 3300006178 Ga0075367_10339685 Ga0075367_103396852 240
34 3300014968 Ga0157379_10190827 Ga0157379_101908272 240
35 3300046684 Ga0495669_0185321 Ga0495669_0185321_19_744 240
36 3300049575 Ga0501039_0147603 Ga0501039_0147603_75_842 240
37 3300049577 Ga0501041_0047877 Ga0501041_0047877_38_805 240
38 3300049582 Ga0501048_0095448 Ga0501048_0095448_399_1166 240
39 3300049584 Ga0501068_0019384 Ga0501068_0019384_1291_2058 240
40 3300049591 Ga0501075_0205952 Ga0501075_0205952_347_1114 240
41 3300049592 Ga0501076_0027487 Ga0501076_0027487_2572_3339 240
42 3300049593 Ga0501077_0063696 Ga0501077_0063696_1413_2180 240
43 3300049741 Ga0501079_0059765 Ga0501079_0059765_1998_2765 240
44 3300049743 Ga0501081_0049117 Ga0501081_0049117_2122_2889 240
45 3300049822 Ga0501035_0415821 Ga0501035_0415821_12_779 240
46 3300054114 Ga0501084_0319994 Ga0501084_0319994_440_1207 240
47 3300060353 Ga0501082_0026089 Ga0501082_0026089_3008_3775 240
48 3300005467 Ga0070706_100062204 Ga0070706_1000622042 241
49 3300005468 Ga0070707_100000108 Ga0070707_10000010827 241
50 3300005719 Ga0068861_100018775 Ga0068861_1000187752 241
51 3300006852 Ga0075433_10032400 Ga0075433_100324005 241
52 3300006871 Ga0075434_100163988 Ga0075434_1001639882 241
53 3300006914 Ga0075436_100146490 Ga0075436_1001464902 241
54 3300009147 Ga0114129_10012726 Ga0114129_100127262 241
55 3300010375 Ga0105239_10016176 Ga0105239_100161766 241
56 3300013306 Ga0163162_10017085 Ga0163162_100170857 241
57 3300026118 Ga0207675_100002639 Ga0207675_10000263912 241
58 3300050507 nmdc:mga05p37_407123_c1 nmdc:mga05p37_407123_c1_313_1077 241
59 3300050512 nmdc:mga0n895_657044_c1 nmdc:mga0n895_657044_c1_121_885 241
60 3300050515 nmdc:mga0a205_15170_c1 nmdc:mga0a205_15170_c1_4883_5647 241
61 3300050515 nmdc:mga0a205_76617_c1 nmdc:mga0a205_76617_c1_12_737 241
62 3300049578 Ga0501042_0427570 Ga0501042_0427570_209_943 244
63 3300054114 Ga0501084_0312606 Ga0501084_0312606_579_1313 244
64 3300005295 Ga0065707_10134579 Ga0065707_101345792 245
65 3300005345 Ga0070692_10250019 Ga0070692_102500192 245
66 3300006844 Ga0075428_100023900 Ga0075428_1000239003 245
67 3300006852 Ga0075433_10056759 Ga0075433_100567594 245
68 3300006871 Ga0075434_100167389 Ga0075434_1001673892 245
69 3300006880 Ga0075429_100011531 Ga0075429_1000115314 245
70 3300009094 Ga0111539_10018495 Ga0111539_100184953 245
71 3300009147 Ga0114129_10102978 Ga0114129_101029783 245
72 3300025933 Ga0207706_10131427 Ga0207706_101314272 245
73 3300027462 Ga0210000_1017209 Ga0210000_10172092 245
74 3300027907 Ga0207428_10141454 Ga0207428_101414543 245
75 3300050507 nmdc:mga05p37_49894_c1 nmdc:mga05p37_49894_c1_332_1126 245
76 3300050510 nmdc:mga06r32_460165_c1 nmdc:mga06r32_460165_c1_363_1157 245
77 3300050511 nmdc:mga08y16_158513_c1 nmdc:mga08y16_158513_c1_973_1767 245
78 3300050512 nmdc:mga0n895_176870_c1 nmdc:mga0n895_176870_c1_778_1578 245
79 3300050515 nmdc:mga0a205_12060_c1 nmdc:mga0a205_12060_c1_2014_2814 245
80 3300050515 nmdc:mga0a205_23223_c1 nmdc:mga0a205_23223_c1_1691_2485 245
81 3300005336 Ga0070680_100135883 Ga0070680_1001358832 247
82 3300005535 Ga0070684_100164633 Ga0070684_1001646332 247
83 3300005578 Ga0068854_100626729 Ga0068854_1006267291 247
84 3300005844 Ga0068862_100087038 Ga0068862_1000870381 247
85 3300006852 Ga0075433_10082435 Ga0075433_100824352 247
86 3300009094 Ga0111539_10000535 Ga0111539_100005352 247
87 3300009094 Ga0111539_10114639 Ga0111539_101146392 247
88 3300009147 Ga0114129_10225093 Ga0114129_102250933 247
89 3300027907 Ga0207428_10000394 Ga0207428_100003947 247
90 3300028380 Ga0268265_10024098 Ga0268265_100240982 247
91 3300042876 Ga0451577_0025265 Ga0451577_0025265_476_1276 247
92 3300044673 Ga0453683_0005950 Ga0453683_0005950_4752_5552 247
93 3300044712 Ga0453684_0032377 Ga0453684_0032377_4897_5697 247
94 3300045051 Ga0451576_0049195 Ga0451576_0049195_2963_3763 247
95 3300050511 nmdc:mga08y16_1417_c1 nmdc:mga08y16_1417_c1_5813_6613 247
96 3300050512 nmdc:mga0n895_35010_c1 nmdc:mga0n895_35010_c1_1960_2760 247
97 3300050515 nmdc:mga0a205_24042_c1 nmdc:mga0a205_24042_c1_3289_4089 247
98 3300034820 Ga0373959_0013857 Ga0373959_0013857_29_838 248
99 3300061734 Ga0530510_0283842 Ga0530510_0283842_187_954 248
100 3300049743 Ga0501081_0197000 Ga0501081_0197000_467_1318 249
101 3300005445 Ga0070708_100186897 Ga0070708_1001868972 250
102 3300006852 Ga0075433_10062927 Ga0075433_100629272 250
103 3300009553 Ga0105249_10227328 Ga0105249_102273283 250
104 3300005983 Ga0081540_1005034 Ga0081540_10050344 251
105 3300049568 Ga0501031_0090122 Ga0501031_0090122_48_857 251
106 3300009147 Ga0114129_10000606 Ga0114129_1000060611 252
107 3300050507 nmdc:mga05p37_4063_c1 nmdc:mga05p37_4063_c1_10076_10909 252
108 3300044673 Ga0453683_0060352 Ga0453683_0060352_511_1314 253
109 3300049576 Ga0501040_0326956 Ga0501040_0326956_133_951 253
110 3300005334 Ga0068869_100046889 Ga0068869_1000468892 254
111 3300005345 Ga0070692_10046023 Ga0070692_100460232 254
112 3300005364 Ga0070673_100447972 Ga0070673_1004479722 254
113 3300005365 Ga0070688_100064606 Ga0070688_1000646062 254
114 3300005441 Ga0070700_100477935 Ga0070700_1004779351 254
115 3300005444 Ga0070694_100075232 Ga0070694_1000752322 254
116 3300005455 Ga0070663_100480325 Ga0070663_1004803251 254
117 3300005545 Ga0070695_100082910 Ga0070695_1000829102 254
118 3300005547 Ga0070693_100338664 Ga0070693_1003386641 254
119 3300005578 Ga0068854_100511278 Ga0068854_1005112781 254
120 3300005718 Ga0068866_10267607 Ga0068866_102676072 254
121 3300005844 Ga0068862_100143465 Ga0068862_1001434652 254
122 3300009094 Ga0111539_10249379 Ga0111539_102493792 254
123 3300009148 Ga0105243_10275853 Ga0105243_102758532 254
124 3300009553 Ga0105249_10082436 Ga0105249_100824362 254
125 3300013306 Ga0163162_10361522 Ga0163162_103615222 254
126 3300014326 Ga0157380_10135536 Ga0157380_101355361 254
127 3300014968 Ga0157379_10414095 Ga0157379_104140952 254
128 3300025899 Ga0207642_10233978 Ga0207642_102339782 254
129 3300025933 Ga0207706_10468686 Ga0207706_104686862 254
130 3300025935 Ga0207709_10071982 Ga0207709_100719822 254
131 3300025942 Ga0207689_10074531 Ga0207689_100745312 254
132 3300025961 Ga0207712_10347335 Ga0207712_103473352 254
133 3300025961 Ga0207712_10547631 Ga0207712_105476311 254
134 3300025981 Ga0207640_10476418 Ga0207640_104764181 254
135 3300025986 Ga0207658_10165220 Ga0207658_101652202 254
136 3300026035 Ga0207703_10318461 Ga0207703_103184612 254
137 3300026067 Ga0207678_10253752 Ga0207678_102537521 254
138 3300026075 Ga0207708_10396790 Ga0207708_103967902 254
139 3300026075 Ga0207708_10456647 Ga0207708_104566471 254
140 3300028380 Ga0268265_10088185 Ga0268265_100881853 254
141 3300042436 Ga0439435_0042049 Ga0439435_0042049_253_1098 254
142 3300049576 Ga0501040_0061962 Ga0501040_0061962_1556_2410 254
143 3300049577 Ga0501041_0047070 Ga0501041_0047070_819_1673 254
144 3300049578 Ga0501042_0171228 Ga0501042_0171228_686_1540 254
145 3300049593 Ga0501077_0046484 Ga0501077_0046484_381_1235 254
146 3300049741 Ga0501079_0115618 Ga0501079_0115618_973_1827 254
147 3300049742 Ga0501080_0138368 Ga0501080_0138368_512_1366 254
148 3300049743 Ga0501081_0010620 Ga0501081_0010620_4512_5366 254
149 3300054114 Ga0501084_0036762 Ga0501084_0036762_2151_3005 254
150 3300060353 Ga0501082_0016940 Ga0501082_0016940_1836_2690 254
151 3300005445 Ga0070708_100075366 Ga0070708_1000753662 255
152 3300005468 Ga0070707_100017934 Ga0070707_1000179346 255
153 3300005471 Ga0070698_100000691 Ga0070698_10000069119 255
154 3300005518 Ga0070699_100013570 Ga0070699_1000135706 255
155 3300005536 Ga0070697_100124263 Ga0070697_1001242631 255
156 3300025922 Ga0207646_10000250 Ga0207646_1000025039 255
157 3300042876 Ga0451577_0010038 Ga0451577_0010038_1134_1952 255
158 3300044673 Ga0453683_0013136 Ga0453683_0013136_766_1584 255
159 3300045051 Ga0451576_0036861 Ga0451576_0036861_1469_2287 255
160 3300049578 Ga0501042_0291500 Ga0501042_0291500_35_829 255
161 3300005334 Ga0068869_100114011 Ga0068869_1001140112 256
162 3300005345 Ga0070692_10001115 Ga0070692_100011157 256
163 3300005353 Ga0070669_100414852 Ga0070669_1004148522 256
164 3300005438 Ga0070701_10069613 Ga0070701_100696132 256
165 3300005440 Ga0070705_100035395 Ga0070705_1000353952 256
166 3300005440 Ga0070705_100140294 Ga0070705_1001402942 256
167 3300005441 Ga0070700_100026807 Ga0070700_1000268072 256
168 3300005444 Ga0070694_100248203 Ga0070694_1002482032 256
169 3300005459 Ga0068867_100547178 Ga0068867_1005471782 256
170 3300005471 Ga0070698_100258778 Ga0070698_1002587782 256
171 3300005518 Ga0070699_100061434 Ga0070699_1000614341 256
172 3300005536 Ga0070697_100285780 Ga0070697_1002857802 256
173 3300005546 Ga0070696_100036054 Ga0070696_1000360543 256
174 3300005549 Ga0070704_100046308 Ga0070704_1000463082 256
175 3300005841 Ga0068863_100032824 Ga0068863_1000328244 256
176 3300005981 Ga0081538_10015371 Ga0081538_100153715 256
177 3300006163 Ga0070715_10016204 Ga0070715_100162042 256
178 3300006175 Ga0070712_100006589 Ga0070712_1000065894 256
179 3300006847 Ga0075431_100023868 Ga0075431_1000238682 256
180 3300006871 Ga0075434_100087316 Ga0075434_1000873162 256
181 3300006914 Ga0075436_100041000 Ga0075436_1000410002 256
182 3300007076 Ga0075435_100000661 Ga0075435_10000066114 256
183 3300009147 Ga0114129_10079508 Ga0114129_100795085 256
184 3300009148 Ga0105243_10007774 Ga0105243_100077747 256
185 3300009174 Ga0105241_10133370 Ga0105241_101333702 256
186 3300009176 Ga0105242_10016052 Ga0105242_100160523 256
187 3300009177 Ga0105248_10472423 Ga0105248_104724232 256
188 3300009553 Ga0105249_10779791 Ga0105249_107797912 256
189 3300013306 Ga0163162_10316041 Ga0163162_103160412 256
190 3300025911 Ga0207654_10082136 Ga0207654_100821362 256
191 3300025915 Ga0207693_10025215 Ga0207693_100252154 256
192 3300025935 Ga0207709_10003271 Ga0207709_100032714 256
193 3300025941 Ga0207711_10418118 Ga0207711_104181182 256
194 3300026075 Ga0207708_10135745 Ga0207708_101357452 256
195 3300026089 Ga0207648_10752173 Ga0207648_107521731 256
196 3300028381 Ga0268264_10155527 Ga0268264_101555273 256
197 3300028381 Ga0268264_10216801 Ga0268264_102168012 256
198 3300042461 Ga0439460_0058949 Ga0439460_0058949_212_1009 256
199 3300044673 Ga0453683_0003008 Ga0453683_0003008_6463_7281 256
200 3300050507 nmdc:mga05p37_141781_c1 nmdc:mga05p37_141781_c1_1852_2640 256
201 3300050508 nmdc:mga09592_21339_c1 nmdc:mga09592_21339_c1_3475_4263 256
202 3300050510 nmdc:mga06r32_14068_c1 nmdc:mga06r32_14068_c1_5037_5834 256
203 3300050512 nmdc:mga0n895_271662_c1 nmdc:mga0n895_271662_c1_247_1044 256
204 3300050512 nmdc:mga0n895_883841_c1 nmdc:mga0n895_883841_c1_73_870 256
205 3300050514 nmdc:mga08x19_7471_c1 nmdc:mga08x19_7471_c1_2598_3395 256
206 3300005445 Ga0070708_100006589 Ga0070708_1000065892 257
207 3300005467 Ga0070706_100117317 Ga0070706_1001173172 257
208 3300006871 Ga0075434_100223242 Ga0075434_1002232422 257
209 3300025910 Ga0207684_10148413 Ga0207684_101484132 257
210 3300049743 Ga0501081_0422390 Ga0501081_0422390_49_885 257
211 3300050512 nmdc:mga0n895_357894_c1 nmdc:mga0n895_357894_c1_246_1091 257
212 3300050513 nmdc:mga0rr50_88479_c1 nmdc:mga0rr50_88479_c1_1446_2291 257
213 3300060353 Ga0501082_0282495 Ga0501082_0282495_529_1332 257
214 3300005518 Ga0070699_100081230 Ga0070699_1000812301 258
215 3300025922 Ga0207646_10196959 Ga0207646_101969592 258
216 3300049591 Ga0501075_0026576 Ga0501075_0026576_2278_3084 258
217 3300049593 Ga0501077_0121342 Ga0501077_0121342_742_1548 258
218 3300009147 Ga0114129_10273784 Ga0114129_102737843 259
219 3300049568 Ga0501031_0003020 Ga0501031_0003020_11_823 259
220 3300005290 Ga0065712_10178808 Ga0065712_101788082 260
221 3300005328 Ga0070676_10001402 Ga0070676_100014022 260
222 3300005329 Ga0070683_100234008 Ga0070683_1002340082 260
223 3300005331 Ga0070670_100001558 Ga0070670_1000015582 260
224 3300005334 Ga0068869_100000795 Ga0068869_1000007955 260
225 3300005336 Ga0070680_100002409 Ga0070680_10000240912 260
226 3300005337 Ga0070682_100000179 Ga0070682_10000017929 260
227 3300005338 Ga0068868_100043820 Ga0068868_1000438202 260
228 3300005339 Ga0070660_100000476 Ga0070660_10000047614 260
229 3300005340 Ga0070689_100073029 Ga0070689_1000730293 260
230 3300005341 Ga0070691_10002169 Ga0070691_100021691 260
231 3300005344 Ga0070661_100000876 Ga0070661_1000008764 260
232 3300005345 Ga0070692_10000828 Ga0070692_100008284 260
233 3300005353 Ga0070669_100017830 Ga0070669_1000178304 260
234 3300005366 Ga0070659_100153974 Ga0070659_1001539742 260
235 3300005440 Ga0070705_100000333 Ga0070705_1000003336 260
236 3300005440 Ga0070705_100078316 Ga0070705_1000783161 260
237 3300005441 Ga0070700_100212381 Ga0070700_1002123812 260
238 3300005444 Ga0070694_100022054 Ga0070694_1000220545 260
239 3300005455 Ga0070663_100226349 Ga0070663_1002263492 260
240 3300005457 Ga0070662_100027815 Ga0070662_1000278152 260
241 3300005458 Ga0070681_10004124 Ga0070681_100041242 260
242 3300005459 Ga0068867_100000455 Ga0068867_10000045514 260
243 3300005467 Ga0070706_100116134 Ga0070706_1001161342 260
244 3300005468 Ga0070707_100261817 Ga0070707_1002618172 260
245 3300005468 Ga0070707_100603131 Ga0070707_1006031312 260
246 3300005471 Ga0070698_100011480 Ga0070698_1000114806 260
247 3300005518 Ga0070699_100003274 Ga0070699_1000032742 260
248 3300005518 Ga0070699_100224249 Ga0070699_1002242491 260
249 3300005530 Ga0070679_100007477 Ga0070679_1000074772 260
250 3300005536 Ga0070697_100093448 Ga0070697_1000934482 260
251 3300005539 Ga0068853_100191463 Ga0068853_1001914632 260
252 3300005543 Ga0070672_100287910 Ga0070672_1002879102 260
253 3300005545 Ga0070695_100061321 Ga0070695_1000613213 260
254 3300005547 Ga0070693_100009781 Ga0070693_1000097814 260
255 3300005563 Ga0068855_100000225 Ga0068855_10000022558 260
256 3300005564 Ga0070664_100017355 Ga0070664_1000173554 260
257 3300005577 Ga0068857_100237393 Ga0068857_1002373932 260
258 3300005614 Ga0068856_100001169 Ga0068856_10000116914 260
259 3300005616 Ga0068852_100142485 Ga0068852_1001424852 260
260 3300005617 Ga0068859_100001393 Ga0068859_1000013936 260
261 3300005618 Ga0068864_100285188 Ga0068864_1002851882 260
262 3300005840 Ga0068870_10000139 Ga0068870_1000013921 260
263 3300005841 Ga0068863_100079836 Ga0068863_1000798362 260
264 3300005842 Ga0068858_100189302 Ga0068858_1001893022 260
265 3300005843 Ga0068860_100001109 Ga0068860_10000110914 260
266 3300005844 Ga0068862_100003750 Ga0068862_10000375015 260
267 3300006173 Ga0070716_100085712 Ga0070716_1000857122 260
268 3300006358 Ga0068871_100259299 Ga0068871_1002592992 260
269 3300006880 Ga0075429_100611439 Ga0075429_1006114392 260
270 3300006881 Ga0068865_100124729 Ga0068865_1001247293 260
271 3300006931 Ga0097620_100001393 Ga0097620_10000139317 260
272 3300007265 Ga0099794_10007170 Ga0099794_100071704 260
273 3300007265 Ga0099794_10033382 Ga0099794_100333822 260
274 3300009147 Ga0114129_10734822 Ga0114129_107348222 260
275 3300009174 Ga0105241_10001038 Ga0105241_100010382 260
276 3300011119 Ga0105246_10170521 Ga0105246_101705212 260
277 3300013100 Ga0157373_10000388 Ga0157373_1000038812 260
278 3300013102 Ga0157371_10107766 Ga0157371_101077662 260
279 3300013105 Ga0157369_10232425 Ga0157369_102324253 260
280 3300013307 Ga0157372_10000105 Ga0157372_1000010559 260
281 3300015262 Ga0182007_10037705 Ga0182007_100377052 260
282 3300025885 Ga0207653_10019880 Ga0207653_100198803 260
283 3300025901 Ga0207688_10012816 Ga0207688_100128164 260
284 3300025907 Ga0207645_10005499 Ga0207645_100054998 260
285 3300025908 Ga0207643_10001465 Ga0207643_100014652 260
286 3300025910 Ga0207684_10132276 Ga0207684_101322762 260
287 3300025910 Ga0207684_10359491 Ga0207684_103594912 260
288 3300025911 Ga0207654_10004154 Ga0207654_100041542 260
289 3300025912 Ga0207707_10000352 Ga0207707_100003529 260
290 3300025914 Ga0207671_10168526 Ga0207671_101685262 260
291 3300025916 Ga0207663_10207634 Ga0207663_102076342 260
292 3300025917 Ga0207660_10000334 Ga0207660_1000033419 260
293 3300025919 Ga0207657_10002597 Ga0207657_100025974 260
294 3300025920 Ga0207649_10006035 Ga0207649_100060352 260
295 3300025921 Ga0207652_10000466 Ga0207652_1000046621 260
296 3300025922 Ga0207646_10084314 Ga0207646_100843143 260
297 3300025922 Ga0207646_10283279 Ga0207646_102832792 260
298 3300025922 Ga0207646_10590039 Ga0207646_105900391 260
299 3300025923 Ga0207681_10013659 Ga0207681_100136594 260
300 3300025924 Ga0207694_10201692 Ga0207694_102016922 260
301 3300025925 Ga0207650_10025156 Ga0207650_100251563 260
302 3300025926 Ga0207659_10148540 Ga0207659_101485402 260
303 3300025932 Ga0207690_10041224 Ga0207690_100412242 260
304 3300025933 Ga0207706_10024583 Ga0207706_100245836 260
305 3300025936 Ga0207670_10088095 Ga0207670_100880952 260
306 3300025938 Ga0207704_10160750 Ga0207704_101607502 260
307 3300025939 Ga0207665_10114297 Ga0207665_101142972 260
308 3300025940 Ga0207691_10203962 Ga0207691_102039622 260
309 3300025942 Ga0207689_10003685 Ga0207689_100036855 260
310 3300025944 Ga0207661_10148620 Ga0207661_101486202 260
311 3300025945 Ga0207679_10000878 Ga0207679_100008787 260
312 3300025949 Ga0207667_10000497 Ga0207667_1000049721 260
313 3300025981 Ga0207640_10088641 Ga0207640_100886412 260
314 3300026023 Ga0207677_10422300 Ga0207677_104223002 260
315 3300026035 Ga0207703_10019303 Ga0207703_100193033 260
316 3300026041 Ga0207639_10002384 Ga0207639_1000238415 260
317 3300026067 Ga0207678_10013961 Ga0207678_100139613 260
318 3300026075 Ga0207708_10248471 Ga0207708_102484712 260
319 3300026078 Ga0207702_10008955 Ga0207702_100089552 260
320 3300026088 Ga0207641_10071148 Ga0207641_100711482 260
321 3300026089 Ga0207648_10015946 Ga0207648_100159462 260
322 3300026116 Ga0207674_10000550 Ga0207674_100005504 260
323 3300026118 Ga0207675_100005709 Ga0207675_10000570911 260
324 3300026142 Ga0207698_10116523 Ga0207698_101165232 260
325 3300028380 Ga0268265_10002923 Ga0268265_1000292315 260
326 3300028381 Ga0268264_10031393 Ga0268264_100313936 260
327 3300035088 Ga0373940_0017681 Ga0373940_0017681_12_824 260
328 3300035090 Ga0373949_0043019 Ga0373949_0043019_222_1034 260
329 3300035091 Ga0373951_0013500 Ga0373951_0013500_399_1211 260
330 3300035121 Ga0373960_0032466 Ga0373960_0032466_344_1156 260
331 3300042005 Ga0439448_0009418 Ga0439448_0009418_888_1700 260
332 3300042157 Ga0439458_0002296 Ga0439458_0002296_243_1055 260
333 3300042876 Ga0451577_0005206 Ga0451577_0005206_478_1290 260
334 3300042876 Ga0451577_0035839 Ga0451577_0035839_278_1090 260
335 3300044712 Ga0453684_0185691 Ga0453684_0185691_924_1736 260
336 3300045051 Ga0451576_0028871 Ga0451576_0028871_4795_5607 260
337 3300045051 Ga0451576_0278038 Ga0451576_0278038_665_1477 260
338 3300046472 Ga0495580_0224360 Ga0495580_0224360_138_950 260
339 3300048911 Ga0496108_0397804 Ga0496108_0397804_49_861 260
340 3300050507 nmdc:mga05p37_196355_c1 nmdc:mga05p37_196355_c1_153_965 260
341 3300050508 nmdc:mga09592_310142_c1 nmdc:mga09592_310142_c1_236_1048 260
342 3300050512 nmdc:mga0n895_43098_c1 nmdc:mga0n895_43098_c1_2107_2919 260
343 3300050514 nmdc:mga08x19_4220_c1 nmdc:mga08x19_4220_c1_2637_3449 260
344 3300050515 nmdc:mga0a205_123700_c1 nmdc:mga0a205_123700_c1_198_1010 260
345 3300025885 Ga0207653_10038407 Ga0207653_100384072 261
346 3300025922 Ga0207646_10008025 Ga0207646_1000802511 261
347 3300049580 Ga0501046_0074003 Ga0501046_0074003_31_873 261
348 3300005467 Ga0070706_100603264 Ga0070706_1006032641 262
349 3300005578 Ga0068854_100013613 Ga0068854_1000136135 262
350 3300027876 Ga0209974_10066276 Ga0209974_100662762 262
351 3300046664 Ga0495659_0061095 Ga0495659_0061095_378_1169 262
352 3300049570 Ga0501033_0008980 Ga0501033_0008980_3951_4799 262
353 3300049572 Ga0501036_0012481 Ga0501036_0012481_5952_6800 262
354 3300049573 Ga0501037_0064932 Ga0501037_0064932_33_881 262
355 3300049574 Ga0501038_0000777 Ga0501038_0000777_2902_3750 262
356 3300049575 Ga0501039_0001226 Ga0501039_0001226_5886_6734 262
357 3300049576 Ga0501040_0001715 Ga0501040_0001715_8598_9446 262
358 3300049577 Ga0501041_0000102 Ga0501041_0000102_9418_10266 262
359 3300049578 Ga0501042_0000777 Ga0501042_0000777_7088_7936 262
360 3300049579 Ga0501043_0029257 Ga0501043_0029257_1072_1920 262
361 3300049580 Ga0501046_0000609 Ga0501046_0000609_11975_12823 262
362 3300049582 Ga0501048_0018520 Ga0501048_0018520_378_1226 262
363 3300049584 Ga0501068_0030991 Ga0501068_0030991_1288_2136 262
364 3300049585 Ga0501069_0089197 Ga0501069_0089197_506_1354 262
365 3300049586 Ga0501070_0070558 Ga0501070_0070558_282_1130 262
366 3300049587 Ga0501071_0000736 Ga0501071_0000736_10836_11684 262
367 3300049588 Ga0501072_0002055 Ga0501072_0002055_7942_8790 262
368 3300049590 Ga0501074_0005624 Ga0501074_0005624_5522_6370 262
369 3300049591 Ga0501075_0000396 Ga0501075_0000396_5748_6596 262
370 3300049592 Ga0501076_0001680 Ga0501076_0001680_6298_7146 262
371 3300049593 Ga0501077_0000286 Ga0501077_0000286_16761_17609 262
372 3300049741 Ga0501079_0000134 Ga0501079_0000134_12373_13221 262
373 3300049742 Ga0501080_0000292 Ga0501080_0000292_25198_26046 262
374 3300049743 Ga0501081_0001499 Ga0501081_0001499_5654_6502 262
375 3300049744 Ga0501083_0103576 Ga0501083_0103576_974_1822 262
376 3300049822 Ga0501035_0006607 Ga0501035_0006607_6404_7252 262
377 3300049824 Ga0501045_0002290 Ga0501045_0002290_3795_4643 262
378 3300054114 Ga0501084_0001169 Ga0501084_0001169_5345_6193 262
379 3300060353 Ga0501082_0002631 Ga0501082_0002631_8335_9183 262
380 3300061734 Ga0530510_0001748 Ga0530510_0001748_8615_9463 262
381 3300003349 JGI26129J50193_1000967 JGI26129J50193_10009673 263
382 3300005440 Ga0070705_100101787 Ga0070705_1001017872 263
383 3300005444 Ga0070694_100182553 Ga0070694_1001825532 263
384 3300005445 Ga0070708_100055617 Ga0070708_1000556172 263
385 3300005445 Ga0070708_100159392 Ga0070708_1001593922 263
386 3300005467 Ga0070706_100047684 Ga0070706_1000476842 263
387 3300005468 Ga0070707_100103935 Ga0070707_1001039352 263
388 3300005468 Ga0070707_100113897 Ga0070707_1001138972 263
389 3300005471 Ga0070698_100094612 Ga0070698_1000946122 263
390 3300005471 Ga0070698_100161752 Ga0070698_1001617522 263
391 3300005518 Ga0070699_100013457 Ga0070699_1000134574 263
392 3300005518 Ga0070699_100020088 Ga0070699_1000200882 263
393 3300005518 Ga0070699_100302754 Ga0070699_1003027542 263
394 3300005536 Ga0070697_100023932 Ga0070697_1000239322 263
395 3300005536 Ga0070697_100065632 Ga0070697_1000656322 263
396 3300005545 Ga0070695_100003891 Ga0070695_1000038913 263
397 3300005549 Ga0070704_100103095 Ga0070704_1001030952 263
398 3300005844 Ga0068862_100080533 Ga0068862_1000805332 263
399 3300005937 Ga0081455_10001810 Ga0081455_100018102 263
400 3300006846 Ga0075430_100061652 Ga0075430_1000616523 263
401 3300006846 Ga0075430_100212495 Ga0075430_1002124951 263
402 3300006847 Ga0075431_100503852 Ga0075431_1005038522 263
403 3300006852 Ga0075433_10166688 Ga0075433_101666882 263
404 3300006852 Ga0075433_10281102 Ga0075433_102811022 263
405 3300006871 Ga0075434_100031633 Ga0075434_1000316332 263
406 3300006871 Ga0075434_100033398 Ga0075434_1000333984 263
407 3300006871 Ga0075434_100156094 Ga0075434_1001560943 263
408 3300006880 Ga0075429_100010038 Ga0075429_1000100389 263
409 3300006880 Ga0075429_100030148 Ga0075429_1000301486 263
410 3300006914 Ga0075436_100414469 Ga0075436_1004144692 263
411 3300007076 Ga0075435_100057817 Ga0075435_1000578172 263
412 3300007076 Ga0075435_100485406 Ga0075435_1004854062 263
413 3300009094 Ga0111539_10481786 Ga0111539_104817862 263
414 3300009147 Ga0114129_10008441 Ga0114129_1000844110 263
415 3300009147 Ga0114129_10009875 Ga0114129_100098752 263
416 3300009147 Ga0114129_10119347 Ga0114129_101193473 263
417 3300009147 Ga0114129_10753981 Ga0114129_107539812 263
418 3300013307 Ga0157372_10072881 Ga0157372_100728815 263
419 3300025910 Ga0207684_10019692 Ga0207684_100196925 263
420 3300025910 Ga0207684_10073541 Ga0207684_100735412 263
421 3300025917 Ga0207660_10570966 Ga0207660_105709661 263
422 3300025922 Ga0207646_10028619 Ga0207646_100286192 263
423 3300025922 Ga0207646_10108278 Ga0207646_101082783 263
424 3300026088 Ga0207641_10082607 Ga0207641_100826072 263
425 3300026089 Ga0207648_10202775 Ga0207648_102027752 263
426 3300027378 Ga0209981_1000490 Ga0209981_10004905 263
427 3300027395 Ga0209996_1000338 Ga0209996_10003385 263
428 3300027471 Ga0209995_1002164 Ga0209995_10021642 263
429 3300027526 Ga0209968_1000579 Ga0209968_10005795 263
430 3300027543 Ga0209999_1000243 Ga0209999_10002439 263
431 3300027552 Ga0209982_1001041 Ga0209982_10010414 263
432 3300027617 Ga0210002_1017292 Ga0210002_10172922 263
433 3300027665 Ga0209983_1000034 Ga0209983_10000347 263
434 3300027682 Ga0209971_1000028 Ga0209971_100002814 263
435 3300027695 Ga0209966_1000073 Ga0209966_10000736 263
436 3300027717 Ga0209998_10000001 Ga0209998_10000001154 263
437 3300027876 Ga0209974_10000369 Ga0209974_100003697 263
438 3300027907 Ga0207428_10000176 Ga0207428_1000017680 263
439 3300028380 Ga0268265_10268221 Ga0268265_102682212 263
440 3300035112 Ga0373932_0003143 Ga0373932_0003143_2588_3382 263
441 3300035114 Ga0373939_0007077 Ga0373939_0007077_1789_2583 263
442 3300035691 Ga0373931_0008836 Ga0373931_0008836_2880_3674 263
443 3300042012 Ga0439455_0013689 Ga0439455_0013689_737_1558 263
444 3300044712 Ga0453684_0435913 Ga0453684_0435913_325_1119 263
445 3300045051 Ga0451576_0024239 Ga0451576_0024239_1123_1917 263
446 3300045051 Ga0451576_0026201 Ga0451576_0026201_1683_2504 263
447 3300045051 Ga0451576_0263638 Ga0451576_0263638_674_1468 263
448 3300046472 Ga0495580_0029596 Ga0495580_0029596_2620_3414 263
449 3300046491 Ga0495584_0041628 Ga0495584_0041628_1206_2027 263
450 3300046491 Ga0495584_0213351 Ga0495584_0213351_141_962 263
451 3300049570 Ga0501033_0082046 Ga0501033_0082046_118_966 263
452 3300049570 Ga0501033_0231964 Ga0501033_0231964_141_962 263
453 3300049574 Ga0501038_0035789 Ga0501038_0035789_1251_2099 263
454 3300049575 Ga0501039_0006761 Ga0501039_0006761_1510_2358 263
455 3300049576 Ga0501040_0019396 Ga0501040_0019396_1000_1848 263
456 3300049576 Ga0501040_0113952 Ga0501040_0113952_13_834 263
457 3300049577 Ga0501041_0075614 Ga0501041_0075614_823_1644 263
458 3300049577 Ga0501041_0115390 Ga0501041_0115390_526_1374 263
459 3300049578 Ga0501042_0007483 Ga0501042_0007483_912_1760 263
460 3300049578 Ga0501042_0178235 Ga0501042_0178235_68_889 263
461 3300049582 Ga0501048_0009507 Ga0501048_0009507_4732_5580 263
462 3300049587 Ga0501071_0006665 Ga0501071_0006665_984_1832 263
463 3300049587 Ga0501071_0157789 Ga0501071_0157789_325_1146 263
464 3300049590 Ga0501074_0182597 Ga0501074_0182597_201_1022 263
465 3300049591 Ga0501075_0000122 Ga0501075_0000122_15950_16798 263
466 3300049591 Ga0501075_0062305 Ga0501075_0062305_531_1352 263
467 3300049592 Ga0501076_0000012 Ga0501076_0000012_48574_49422 263
468 3300049592 Ga0501076_0130234 Ga0501076_0130234_676_1497 263
469 3300049593 Ga0501077_0009995 Ga0501077_0009995_4107_4928 263
470 3300049593 Ga0501077_0045440 Ga0501077_0045440_1281_2129 263
471 3300049741 Ga0501079_0008164 Ga0501079_0008164_6735_7556 263
472 3300049741 Ga0501079_0041859 Ga0501079_0041859_1160_2008 263
473 3300049742 Ga0501080_0113479 Ga0501080_0113479_598_1419 263
474 3300049743 Ga0501081_0006424 Ga0501081_0006424_5236_6084 263
475 3300049743 Ga0501081_0008697 Ga0501081_0008697_2305_3126 263
476 3300049822 Ga0501035_0048808 Ga0501035_0048808_1490_2338 263
477 3300050507 nmdc:mga05p37_21565_c1 nmdc:mga05p37_21565_c1_6425_7246 263
478 3300050507 nmdc:mga05p37_238148_c1 nmdc:mga05p37_238148_c1_720_1538 263
479 3300050507 nmdc:mga05p37_85453_c1 nmdc:mga05p37_85453_c1_942_1736 263
480 3300050508 nmdc:mga09592_144514_c1 nmdc:mga09592_144514_c1_367_1185 263
481 3300050509 nmdc:mga0qj67_272243_c1 nmdc:mga0qj67_272243_c1_502_1323 263
482 3300050509 nmdc:mga0qj67_43339_c1 nmdc:mga0qj67_43339_c1_2389_3183 263
483 3300050510 nmdc:mga06r32_790916_c1 nmdc:mga06r32_790916_c1_52_846 263
484 3300050510 nmdc:mga06r32_87705_c1 nmdc:mga06r32_87705_c1_1384_2178 263
485 3300050511 nmdc:mga08y16_2945_c1 nmdc:mga08y16_2945_c1_1341_2138 263
486 3300050512 nmdc:mga0n895_41940_c1 nmdc:mga0n895_41940_c1_1630_2424 263
487 3300050512 nmdc:mga0n895_61867_c1 nmdc:mga0n895_61867_c1_2413_3207 263
488 3300050514 nmdc:mga08x19_153171_c1 nmdc:mga08x19_153171_c1_742_1536 263
489 3300050514 nmdc:mga08x19_397209_c1 nmdc:mga08x19_397209_c1_134_928 263
490 3300050515 nmdc:mga0a205_156982_c1 nmdc:mga0a205_156982_c1_1276_2073 263
491 3300050515 nmdc:mga0a205_205119_c1 nmdc:mga0a205_205119_c1_150_944 263
492 3300050515 nmdc:mga0a205_5896_c1 nmdc:mga0a205_5896_c1_4440_5234 263
493 3300050515 nmdc:mga0a205_66914_c2 nmdc:mga0a205_66914_c2_1311_2129 263
494 3300054114 Ga0501084_0001730 Ga0501084_0001730_14925_15773 263
495 3300054114 Ga0501084_0015809 Ga0501084_0015809_3613_4434 263
496 3300054114 Ga0501084_0097754 Ga0501084_0097754_475_1314 263
497 3300060353 Ga0501082_0009410 Ga0501082_0009410_2330_3178 263
498 3300060353 Ga0501082_0056973 Ga0501082_0056973_1143_1964 263
499 3300061734 Ga0530510_0000015 Ga0530510_0000015_79174_80022 263
500 3300005549 Ga0070704_100047238 Ga0070704_1000472381 264
501 3300009094 Ga0111539_10082769 Ga0111539_100827692 264
502 3300009174 Ga0105241_10212150 Ga0105241_102121502 264
503 3300013306 Ga0163162_10015647 Ga0163162_100156472 264
504 3300035112 Ga0373932_0026642 Ga0373932_0026642_339_1136 264
505 3300035114 Ga0373939_0039678 Ga0373939_0039678_164_961 264
506 3300046684 Ga0495669_0032522 Ga0495669_0032522_1282_2079 264
507 3300048905 Ga0496102_0001871 Ga0496102_0001871_4526_5323 264
508 3300049574 Ga0501038_0110847 Ga0501038_0110847_1364_2158 264
509 3300049576 Ga0501040_0067285 Ga0501040_0067285_484_1278 264
510 3300049577 Ga0501041_0170777 Ga0501041_0170777_294_1088 264
511 3300049578 Ga0501042_0126960 Ga0501042_0126960_592_1386 264
512 3300049588 Ga0501072_0025773 Ga0501072_0025773_2796_3590 264
513 3300049592 Ga0501076_0065644 Ga0501076_0065644_1005_1799 264
514 3300049743 Ga0501081_0112229 Ga0501081_0112229_191_985 264
515 3300049824 Ga0501045_0062629 Ga0501045_0062629_94_888 264
516 3300050507 nmdc:mga05p37_14582_c1 nmdc:mga05p37_14582_c1_8040_8837 264
517 3300050509 nmdc:mga0qj67_343_c1 nmdc:mga0qj67_343_c1_24400_25197 264
518 3300050510 nmdc:mga06r32_469340_c1 nmdc:mga06r32_469340_c1_253_1047 264
519 3300050511 nmdc:mga08y16_108945_c1 nmdc:mga08y16_108945_c1_1423_2220 264
520 3300061734 Ga0530510_0136055 Ga0530510_0136055_604_1398 264
521 3300009147 Ga0114129_10000115 Ga0114129_1000011554 265
522 3300009147 Ga0114129_10102712 Ga0114129_101027125 265
523 3300037418 Ga0395900_0062032 Ga0395900_0062032_103_906 265
524 3300037466 Ga0395898_0079077 Ga0395898_0079077_2339_3142 265
525 3300038443 Ga0395901_0029677 Ga0395901_0029677_144_947 265
526 3300050507 nmdc:mga05p37_23238_c1 nmdc:mga05p37_23238_c1_1580_2377 265
527 3300050507 nmdc:mga05p37_300449_c1 nmdc:mga05p37_300449_c1_244_1041 265
528 3300050507 nmdc:mga05p37_89_c1 nmdc:mga05p37_89_c1_58775_59572 265
529 3300050508 nmdc:mga09592_1406_c1 nmdc:mga09592_1406_c1_17852_18649 265
530 3300050512 nmdc:mga0n895_203_c1 nmdc:mga0n895_203_c1_19551_20348 265
531 3300050513 nmdc:mga0rr50_694_c1 nmdc:mga0rr50_694_c1_12909_13706 265
532 3300050514 nmdc:mga08x19_470_c1 nmdc:mga08x19_470_c1_14316_15113 265
533 3300050515 nmdc:mga0a205_420270_c1 nmdc:mga0a205_420270_c1_254_1057 265
534 3300005518 Ga0070699_100230631 Ga0070699_1002306311 267
535 3300005546 Ga0070696_100272373 Ga0070696_1002723732 267
536 3300006914 Ga0075436_100015235 Ga0075436_1000152355 267
537 3300009147 Ga0114129_10529845 Ga0114129_105298452 267
538 3300025939 Ga0207665_10165423 Ga0207665_101654232 267
539 3300031548 Ga0307408_100145291 Ga0307408_1001452912 267
540 3300031731 Ga0307405_10240301 Ga0307405_102403012 267
541 3300031852 Ga0307410_10059238 Ga0307410_100592383 267
542 3300032002 Ga0307416_100599922 Ga0307416_1005999222 267
543 3300032005 Ga0307411_10063789 Ga0307411_100637892 267
544 3300049575 Ga0501039_0168675 Ga0501039_0168675_356_1162 267
545 3300049576 Ga0501040_0111631 Ga0501040_0111631_244_1050 267
546 3300049577 Ga0501041_0009513 Ga0501041_0009513_2024_2830 267
547 3300049578 Ga0501042_0030821 Ga0501042_0030821_2172_2978 267
548 3300049584 Ga0501068_0087739 Ga0501068_0087739_809_1615 267
549 3300049587 Ga0501071_0124817 Ga0501071_0124817_166_972 267
550 3300049590 Ga0501074_0102039 Ga0501074_0102039_708_1514 267
551 3300049592 Ga0501076_0002878 Ga0501076_0002878_1497_2303 267
552 3300049593 Ga0501077_0018034 Ga0501077_0018034_510_1316 267
553 3300049741 Ga0501079_0011862 Ga0501079_0011862_1968_2774 267
554 3300049742 Ga0501080_0059941 Ga0501080_0059941_1928_2734 267
555 3300049743 Ga0501081_0003182 Ga0501081_0003182_2932_3738 267
556 3300049824 Ga0501045_0024468 Ga0501045_0024468_1010_1816 267
557 3300050510 nmdc:mga06r32_204473_c1 nmdc:mga06r32_204473_c1_625_1431 267
558 3300050514 nmdc:mga08x19_29864_c1 nmdc:mga08x19_29864_c1_312_1154 267
559 3300054114 Ga0501084_0055736 Ga0501084_0055736_1485_2291 267
560 3300060353 Ga0501082_0351825 Ga0501082_0351825_254_1060 267
561 3300061734 Ga0530510_0063379 Ga0530510_0063379_1211_2017 267
562 3300005336 Ga0070680_100049260 Ga0070680_1000492603 268
563 3300005341 Ga0070691_10111549 Ga0070691_101115491 268
564 3300005440 Ga0070705_100122966 Ga0070705_1001229662 268
565 3300005459 Ga0068867_100194989 Ga0068867_1001949892 268
566 3300005467 Ga0070706_100224884 Ga0070706_1002248842 268
567 3300005518 Ga0070699_100279410 Ga0070699_1002794102 268
568 3300005530 Ga0070679_100203873 Ga0070679_1002038732 268
569 3300005546 Ga0070696_100108775 Ga0070696_1001087752 268
570 3300005549 Ga0070704_100015876 Ga0070704_1000158762 268
571 3300005617 Ga0068859_100089345 Ga0068859_1000893452 268
572 3300005718 Ga0068866_10060874 Ga0068866_100608742 268
573 3300005843 Ga0068860_100315180 Ga0068860_1003151802 268
574 3300005844 Ga0068862_100546214 Ga0068862_1005462142 268
575 3300006844 Ga0075428_100001380 Ga0075428_10000138014 268
576 3300006844 Ga0075428_100054921 Ga0075428_1000549213 268
577 3300006844 Ga0075428_100197674 Ga0075428_1001976743 268
578 3300006844 Ga0075428_100624849 Ga0075428_1006248492 268
579 3300006846 Ga0075430_100000019 Ga0075430_10000001926 268
580 3300006846 Ga0075430_100000487 Ga0075430_10000048712 268
581 3300006847 Ga0075431_100002180 Ga0075431_1000021808 268
582 3300006847 Ga0075431_100011273 Ga0075431_1000112732 268
583 3300006847 Ga0075431_100072397 Ga0075431_1000723973 268
584 3300006871 Ga0075434_100459999 Ga0075434_1004599992 268
585 3300006880 Ga0075429_100000859 Ga0075429_10000085918 268
586 3300006880 Ga0075429_100021240 Ga0075429_1000212404 268
587 3300006880 Ga0075429_100424371 Ga0075429_1004243712 268
588 3300006931 Ga0097620_100089342 Ga0097620_1000893422 268
589 3300007265 Ga0099794_10016643 Ga0099794_100166432 268
590 3300007265 Ga0099794_10119145 Ga0099794_101191452 268
591 3300009094 Ga0111539_10192811 Ga0111539_101928112 268
592 3300009147 Ga0114129_10114996 Ga0114129_101149963 268
593 3300009147 Ga0114129_10738955 Ga0114129_107389552 268
594 3300009147 Ga0114129_10919193 Ga0114129_109191932 268
595 3300013297 Ga0157378_10339128 Ga0157378_103391282 268
596 3300025923 Ga0207681_10166559 Ga0207681_101665592 268
597 3300025933 Ga0207706_10080188 Ga0207706_100801882 268
598 3300025936 Ga0207670_10320547 Ga0207670_103205472 268
599 3300026075 Ga0207708_10570979 Ga0207708_105709792 268
600 3300026089 Ga0207648_10153126 Ga0207648_101531263 268
601 3300026089 Ga0207648_10295593 Ga0207648_102955932 268
602 3300026118 Ga0207675_100132891 Ga0207675_1001328912 268
603 3300027671 Ga0209588_1017370 Ga0209588_10173702 268
604 3300027907 Ga0207428_10123151 Ga0207428_101231512 268
605 3300031548 Ga0307408_100048113 Ga0307408_1000481132 268
606 3300031548 Ga0307408_100353624 Ga0307408_1003536242 268
607 3300037312 Ga0395899_0005401 Ga0395899_0005401_4782_5594 268
608 3300042876 Ga0451577_0250202 Ga0451577_0250202_139_981 268
609 3300049588 Ga0501072_0059434 Ga0501072_0059434_993_1805 268
610 3300049591 Ga0501075_0076372 Ga0501075_0076372_1553_2365 268
611 3300049592 Ga0501076_0332088 Ga0501076_0332088_313_1125 268
612 3300050507 nmdc:mga05p37_331825_c1 nmdc:mga05p37_331825_c1_699_1553 268
613 3300050507 nmdc:mga05p37_35596_c1 nmdc:mga05p37_35596_c1_2643_3455 268
614 3300050507 nmdc:mga05p37_743528_c1 nmdc:mga05p37_743528_c1_75_929 268
615 3300050508 nmdc:mga09592_837_c1 nmdc:mga09592_837_c1_4733_5545 268
616 3300050509 nmdc:mga0qj67_798_c1 nmdc:mga0qj67_798_c1_6370_7182 268
617 3300050510 nmdc:mga06r32_10348_c1 nmdc:mga06r32_10348_c1_3944_4756 268
618 3300050510 nmdc:mga06r32_176697_c1 nmdc:mga06r32_176697_c1_1101_1955 268
619 3300050511 nmdc:mga08y16_163309_c1 nmdc:mga08y16_163309_c1_245_1099 268
620 3300050511 nmdc:mga08y16_420122_c1 nmdc:mga08y16_420122_c1_41_853 268
621 3300061734 Ga0530510_0221293 Ga0530510_0221293_226_1032 268
622 3300003203 JGI25406J46586_10017390 JGI25406J46586_100173902 269
623 3300005445 Ga0070708_100016216 Ga0070708_1000162165 269
624 3300005467 Ga0070706_100077558 Ga0070706_1000775583 269
625 3300005468 Ga0070707_100593067 Ga0070707_1005930672 269
626 3300005471 Ga0070698_100014980 Ga0070698_1000149803 269
627 3300005518 Ga0070699_100015560 Ga0070699_1000155602 269
628 3300005536 Ga0070697_100349732 Ga0070697_1003497321 269
629 3300005536 Ga0070697_100449415 Ga0070697_1004494151 269
630 3300005985 Ga0081539_10000005 Ga0081539_10000005380 269
631 3300006058 Ga0075432_10024663 Ga0075432_100246632 269
632 3300006844 Ga0075428_100000924 Ga0075428_10000092421 269
633 3300006844 Ga0075428_100030517 Ga0075428_1000305174 269
634 3300006844 Ga0075428_100182861 Ga0075428_1001828611 269
635 3300006844 Ga0075428_100224837 Ga0075428_1002248372 269
636 3300006846 Ga0075430_100016723 Ga0075430_1000167233 269
637 3300006846 Ga0075430_100046733 Ga0075430_1000467335 269
638 3300006846 Ga0075430_100147154 Ga0075430_1001471542 269
639 3300006847 Ga0075431_100000797 Ga0075431_1000007972 269
640 3300006847 Ga0075431_100002229 Ga0075431_10000222916 269
641 3300006847 Ga0075431_100008469 Ga0075431_1000084695 269
642 3300006847 Ga0075431_100168828 Ga0075431_1001688282 269
643 3300006847 Ga0075431_100340726 Ga0075431_1003407261 269
644 3300006852 Ga0075433_10006420 Ga0075433_100064205 269
645 3300006871 Ga0075434_100022146 Ga0075434_1000221466 269
646 3300006871 Ga0075434_100232081 Ga0075434_1002320813 269
647 3300006880 Ga0075429_100027920 Ga0075429_1000279202 269
648 3300006880 Ga0075429_100144176 Ga0075429_1001441762 269
649 3300006914 Ga0075436_100001157 Ga0075436_1000011577 269
650 3300007076 Ga0075435_100015296 Ga0075435_1000152964 269
651 3300009147 Ga0114129_10001631 Ga0114129_100016314 269
652 3300009147 Ga0114129_10036324 Ga0114129_100363244 269
653 3300009147 Ga0114129_10563662 Ga0114129_105636622 269
654 3300025910 Ga0207684_10000115 Ga0207684_100001159 269
655 3300025922 Ga0207646_10003851 Ga0207646_1000385110 269
656 3300027682 Ga0209971_1005708 Ga0209971_10057083 269
657 3300027695 Ga0209966_1009155 Ga0209966_10091552 269
658 3300031548 Ga0307408_100034524 Ga0307408_1000345242 269
659 3300031852 Ga0307410_10193742 Ga0307410_101937422 269
660 3300032005 Ga0307411_10334865 Ga0307411_103348652 269
661 3300037418 Ga0395900_0333236 Ga0395900_0333236_665_1474 269
662 3300037471 Ga0395905_0139761 Ga0395905_0139761_876_1685 269
663 3300049570 Ga0501033_0204541 Ga0501033_0204541_82_897 269
664 3300049572 Ga0501036_0025187 Ga0501036_0025187_1885_2700 269
665 3300049572 Ga0501036_0207057 Ga0501036_0207057_297_1112 269
666 3300049572 Ga0501036_0306586 Ga0501036_0306586_410_1225 269
667 3300049574 Ga0501038_0197507 Ga0501038_0197507_53_868 269
668 3300049575 Ga0501039_0164062 Ga0501039_0164062_736_1551 269
669 3300049576 Ga0501040_0016619 Ga0501040_0016619_840_1655 269
670 3300049577 Ga0501041_0031877 Ga0501041_0031877_1802_2617 269
671 3300049578 Ga0501042_0160808 Ga0501042_0160808_166_981 269
672 3300049579 Ga0501043_0180607 Ga0501043_0180607_568_1383 269
673 3300049582 Ga0501048_0021144 Ga0501048_0021144_3168_3983 269
674 3300049582 Ga0501048_0076147 Ga0501048_0076147_1201_2016 269
675 3300049583 Ga0501067_0048491 Ga0501067_0048491_773_1588 269
676 3300049584 Ga0501068_0047035 Ga0501068_0047035_735_1550 269
677 3300049584 Ga0501068_0167374 Ga0501068_0167374_26_841 269
678 3300049585 Ga0501069_0007927 Ga0501069_0007927_3261_4076 269
679 3300049588 Ga0501072_0015809 Ga0501072_0015809_871_1686 269
680 3300049588 Ga0501072_0124331 Ga0501072_0124331_872_1687 269
681 3300049590 Ga0501074_0021260 Ga0501074_0021260_2495_3310 269
682 3300049591 Ga0501075_0014948 Ga0501075_0014948_3266_4081 269
683 3300049591 Ga0501075_0121655 Ga0501075_0121655_1092_1907 269
684 3300049592 Ga0501076_0024534 Ga0501076_0024534_2539_3354 269
685 3300049592 Ga0501076_0110518 Ga0501076_0110518_813_1628 269
686 3300049593 Ga0501077_0009924 Ga0501077_0009924_2103_2918 269
687 3300049593 Ga0501077_0092273 Ga0501077_0092273_113_928 269
688 3300049593 Ga0501077_0118791 Ga0501077_0118791_155_970 269
689 3300049741 Ga0501079_0017090 Ga0501079_0017090_3286_4101 269
690 3300049741 Ga0501079_0018925 Ga0501079_0018925_2216_3031 269
691 3300049741 Ga0501079_0333676 Ga0501079_0333676_179_994 269
692 3300049742 Ga0501080_0122207 Ga0501080_0122207_1129_1944 269
693 3300049742 Ga0501080_0312189 Ga0501080_0312189_356_1171 269
694 3300049743 Ga0501081_0001033 Ga0501081_0001033_13077_13892 269
695 3300049743 Ga0501081_0021956 Ga0501081_0021956_1828_2643 269
696 3300049743 Ga0501081_0036313 Ga0501081_0036313_716_1531 269
697 3300049744 Ga0501083_0113204 Ga0501083_0113204_881_1696 269
698 3300049824 Ga0501045_0073786 Ga0501045_0073786_107_922 269
699 3300050507 nmdc:mga05p37_28205_c1 nmdc:mga05p37_28205_c1_3542_4357 269
700 3300050508 nmdc:mga09592_6345_c1 nmdc:mga09592_6345_c1_6293_7102 269
701 3300050509 nmdc:mga0qj67_167798_c1 nmdc:mga0qj67_167798_c1_505_1314 269
702 3300050509 nmdc:mga0qj67_22992_c1 nmdc:mga0qj67_22992_c1_2702_3517 269
703 3300050510 nmdc:mga06r32_32294_c1 nmdc:mga06r32_32294_c1_3235_4044 269
704 3300050510 nmdc:mga06r32_4631_c1 nmdc:mga06r32_4631_c1_4932_5747 269
705 3300050512 nmdc:mga0n895_88977_c1 nmdc:mga0n895_88977_c1_326_1141 269
706 3300054114 Ga0501084_0024553 Ga0501084_0024553_19_834 269
707 3300054114 Ga0501084_0053423 Ga0501084_0053423_524_1339 269
708 3300054114 Ga0501084_0199873 Ga0501084_0199873_583_1398 269
709 3300059421 Ga0590071_010281 Ga0590071_010281_873_1688 269
710 3300059424 Ga0590075_007138 Ga0590075_007138_322_1137 269
711 3300061734 Ga0530510_0015625 Ga0530510_0015625_1031_1846 269
712 3300061734 Ga0530510_0179918 Ga0530510_0179918_368_1183 269
713 3300061734 Ga0530510_0188761 Ga0530510_0188761_421_1236 269
714 3300061734 Ga0530510_0236658 Ga0530510_0236658_283_1098 269

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7958 17 269
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7471 17 269
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.486 80 262
7jh6-assembly4.cif.gz_D de novo designed two-domain di-zn(ii) and porphyrin-binding protein 0.4842 92 263
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.4716 80 262
ID Description Score Start End Superfamily
af_Q4DSB3_1_115_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.583 97 255 1.20.58.400
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5353 94 261 1.20.120.1770
af_Q4DSB3_1_115_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.5099 97 255 1.20.58.400
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5051 92 262 1.20.950.20
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5027 94 261 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A6B1FLJ0-F1-model_v4 deleted 0.968 180 269
AF-A0A6B1FLJ0-F1-model_v4 deleted 0.9576 180 269
AF-A0A2V7RLD6-F1-model_v4 Succinate dehydrogenase 0.9508 152 269 GO:0016020
AF-A0A292Z6H2-F1-model_v4 Putative succinate dehydrogenase 0.9368 161 269 GO:0016020
AF-A0A2V6H4D2-F1-model_v4 Succinate dehydrogenase 0.9366 168 269 GO:0016020

Feature Viewer

pLDDT pTM Quality
70.51 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map