F476958

General Info

Members Datasets Scaffolds Average Seq Length
714 288 715 89

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0029420|Ga0466969_0029420_1312_1635
Length 107
Sequence MPQPAAGPRLFPLKFLVKSMALMITDECINCDVCEPECPNDAIAMGQEIYVIDPSKCTECVGHFDEPQCRQVCPVDCIPINPEHVETRDQLLAKYRALQEHKEGSGT

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
212 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
213 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
281 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 3.36
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000759 3300002738 Bacteria 14362
2 JGI25157J39369_1000008 3300002741 Bacteria 211083
3 rootH1_10003280 3300003316 Bacteria 2631
4 rootH1_10003280 3300003323 Bacteria 3148
5 Ga0065712_10440649 3300005290 Bacteria 694
6 Ga0070658_10120193 3300005327 Bacteria 2183
7 Ga0070658_10269124 3300005327 Bacteria 1449
8 Ga0070658_10585171 3300005327 Bacteria 967
9 Ga0070676_10004641 3300005328 Bacteria 7256
10 Ga0070676_10063927 3300005328 Bacteria 2193
11 Ga0070676_10140447 3300005328 Bacteria 1537
12 Ga0070676_10423591 3300005328 Bacteria 931
13 Ga0070683_100062398 3300005329 Bacteria 3466
14 Ga0070683_100144385 3300005329 Bacteria 2255
15 Ga0070683_100188343 3300005329 Bacteria 1959
16 Ga0070690_100043614 3300005330 Bacteria 2845
17 Ga0070690_100096629 3300005330 Bacteria 1953
18 Ga0070670_100017326 3300005331 Bacteria 6178
19 Ga0070670_100128287 3300005331 Bacteria 2189
20 Ga0070670_100147629 3300005331 Bacteria 2035
21 Ga0070670_100254643 3300005331 Bacteria 1530
22 Ga0070670_100333836 3300005331 Bacteria 1330
23 Ga0068869_100007461 3300005334 Bacteria 6994
24 Ga0068869_100134026 3300005334 Bacteria 1907
25 Ga0068869_100159550 3300005334 Bacteria 1754
26 Ga0068869_100719307 3300005334 Bacteria 853
27 Ga0068869_100888967 3300005334 Bacteria 770
28 Ga0068869_101524698 3300005334 Bacteria 594
29 Ga0070666_10001230 3300005335 Bacteria 15468
30 Ga0070666_10019652 3300005335 Bacteria 4365
31 Ga0070666_10093476 3300005335 Bacteria 2068
32 Ga0070666_10420425 3300005335 Bacteria 963
33 Ga0070680_100091698 3300005336 Bacteria 2515
34 Ga0068868_100004809 3300005338 Bacteria 9477
35 Ga0068868_100009230 3300005338 Bacteria 7089
36 Ga0068868_100027870 3300005338 Bacteria 4312
37 Ga0068868_100772308 3300005338 Bacteria 865
38 Ga0068868_100776305 3300005338 Bacteria 863
39 Ga0070660_100002471 3300005339 Bacteria 12671
40 Ga0070660_100071292 3300005339 Bacteria 2713
41 Ga0070660_100230916 3300005339 Bacteria 1505
42 Ga0070660_100604638 3300005339 Bacteria 917
43 Ga0070689_100007760 3300005340 Bacteria 7517
44 Ga0070689_100110142 3300005340 Bacteria 2189
45 Ga0070689_100122599 3300005340 Bacteria 2077
46 Ga0070689_100126550 3300005340 Bacteria 2045
47 Ga0070687_100857270 3300005343 Bacteria 648
48 Ga0070661_100000785 3300005344 Bacteria 22858
49 Ga0070661_100009775 3300005344 Bacteria 6653
50 Ga0070661_100047224 3300005344 Bacteria 3150
51 Ga0070661_100519571 3300005344 Bacteria 955
52 Ga0070661_101872498 3300005344 Bacteria 510
53 Ga0070692_10105524 3300005345 Bacteria 1551
54 Ga0070668_100110996 3300005347 Bacteria 2182
55 Ga0070668_101975705 3300005347 Bacteria 538
56 Ga0070669_100001757 3300005353 Bacteria 15632
57 Ga0070669_100012988 3300005353 Bacteria 5914
58 Ga0070669_100108367 3300005353 Bacteria 2105
59 Ga0070669_100319997 3300005353 Bacteria 1252
60 Ga0070669_100876503 3300005353 Bacteria 766
61 Ga0070669_101377899 3300005353 Bacteria 612
62 Ga0070675_100007265 3300005354 Bacteria 8546
63 Ga0070675_100018828 3300005354 Bacteria 5497
64 Ga0070675_100038922 3300005354 Bacteria 3878
65 Ga0070675_100088072 3300005354 Bacteria 2597
66 Ga0070675_100160918 3300005354 Bacteria 1930
67 Ga0070675_100471981 3300005354 Bacteria 1127
68 Ga0070671_100003687 3300005355 Bacteria 12015
69 Ga0070671_100046594 3300005355 Bacteria 3606
70 Ga0070671_100107065 3300005355 Bacteria 2347
71 Ga0070671_100190312 3300005355 Bacteria 1739
72 Ga0070671_100410893 3300005355 Bacteria 1158
73 Ga0070671_101079366 3300005355 Bacteria 705
74 Ga0070674_100031169 3300005356 Bacteria 3530
75 Ga0070674_100538724 3300005356 Bacteria 978
76 Ga0070674_100842464 3300005356 Bacteria 795
77 Ga0070673_100001191 3300005364 Bacteria 14965
78 Ga0070673_100006593 3300005364 Bacteria 7557
79 Ga0070673_100012953 3300005364 Bacteria 5748
80 Ga0070673_100123618 3300005364 Bacteria 2162
81 Ga0070673_100330993 3300005364 Bacteria 1348
82 Ga0070673_101151183 3300005364 Bacteria 726
83 Ga0070673_101567873 3300005364 Bacteria 622
84 Ga0070688_100003852 3300005365 Bacteria 7778
85 Ga0070688_100094015 3300005365 Bacteria 1965
86 Ga0070688_100118034 3300005365 Bacteria 1773
87 Ga0070659_100015059 3300005366 Bacteria 5785
88 Ga0070659_100172176 3300005366 Bacteria 1774
89 Ga0070659_100231919 3300005366 Bacteria 1526
90 Ga0070659_100252883 3300005366 Bacteria 1461
91 Ga0070659_100376300 3300005366 Bacteria 1195
92 Ga0070659_100901085 3300005366 Bacteria 773
93 Ga0070659_101745808 3300005366 Bacteria 557
94 Ga0070659_101832160 3300005366 Bacteria 544
95 Ga0070667_100000716 3300005367 Bacteria 31923
96 Ga0070667_100007565 3300005367 Bacteria 9012
97 Ga0070667_100096629 3300005367 Bacteria 2548
98 Ga0070667_100147172 3300005367 Bacteria 2067
99 Ga0070667_101020981 3300005367 Bacteria 772
100 Ga0070703_10624365 3300005406 Bacteria 500
101 Ga0070709_11042667 3300005434 Bacteria 652
102 Ga0070714_100013821 3300005435 Bacteria 6473
103 Ga0070714_100559952 3300005435 Bacteria 1095
104 Ga0070701_10255983 3300005438 Bacteria 1059
105 Ga0070705_100032030 3300005440 Bacteria 2917
106 Ga0070705_101811455 3300005440 Bacteria 518
107 Ga0070700_101555775 3300005441 Bacteria 564
108 Ga0070694_100066381 3300005444 Bacteria 2475
109 Ga0070694_100574433 3300005444 Bacteria 905
110 Ga0070708_100000176 3300005445 Bacteria 45698
111 Ga0070663_100017475 3300005455 Bacteria 4682
112 Ga0070663_100110580 3300005455 Bacteria 2064
113 Ga0070663_100294014 3300005455 Bacteria 1298
114 Ga0070663_101735025 3300005455 Bacteria 559
115 Ga0070678_100009598 3300005456 Bacteria 5872
116 Ga0070678_100301934 3300005456 Bacteria 1361
117 Ga0070678_100411185 3300005456 Bacteria 1177
118 Ga0070678_101666321 3300005456 Bacteria 600
119 Ga0070662_100000258 3300005457 Bacteria 31405
120 Ga0070662_100175919 3300005457 Bacteria 1684
121 Ga0070662_100195724 3300005457 Bacteria 1601
122 Ga0070662_100558390 3300005457 Bacteria 960
123 Ga0070662_101970907 3300005457 Bacteria 505
124 Ga0070681_10009497 3300005458 Bacteria 9575
125 Ga0070681_10166976 3300005458 Bacteria 2123
126 Ga0070681_10363007 3300005458 Bacteria 1358
127 Ga0068867_100002291 3300005459 Bacteria 13451
128 Ga0068867_100004874 3300005459 Bacteria 9447
129 Ga0068867_100435100 3300005459 Bacteria 1114
130 Ga0070679_100000683 3300005530 Bacteria 29027
131 Ga0070679_100030395 3300005530 Bacteria 5333
132 Ga0070679_100088432 3300005530 Bacteria 3085
133 Ga0070679_101131920 3300005530 Bacteria 728
134 Ga0070679_101224906 3300005530 Bacteria 696
135 Ga0070684_100047181 3300005535 Bacteria 3733
136 Ga0070684_100105223 3300005535 Bacteria 2525
137 Ga0070684_102294683 3300005535 Bacteria 509
138 Ga0070697_101886844 3300005536 Bacteria 535
139 Ga0068853_100015034 3300005539 Bacteria 6359
140 Ga0068853_100099418 3300005539 Bacteria 2570
141 Ga0068853_100108701 3300005539 Bacteria 2460
142 Ga0068853_100159109 3300005539 Bacteria 2037
143 Ga0068853_100172532 3300005539 Bacteria 1957
144 Ga0068853_100742324 3300005539 Bacteria 938
145 Ga0068853_101916189 3300005539 Bacteria 575
146 Ga0070672_100004907 3300005543 Bacteria 8800
147 Ga0070672_100018279 3300005543 Bacteria 5063
148 Ga0070672_100086091 3300005543 Bacteria 2527
149 Ga0070672_100113318 3300005543 Bacteria 2213
150 Ga0070672_100174893 3300005543 Bacteria 1787
151 Ga0070696_100130350 3300005546 Bacteria 1829
152 Ga0070693_100737051 3300005547 Bacteria 725
153 Ga0070665_100028490 3300005548 Bacteria 5624
154 Ga0070665_100564346 3300005548 Bacteria 1151
155 Ga0070665_100907261 3300005548 Bacteria 894
156 Ga0070665_101108426 3300005548 Bacteria 803
157 Ga0070665_101235679 3300005548 Bacteria 758
158 Ga0070704_100283342 3300005549 Bacteria 1374
159 Ga0070704_100486918 3300005549 Bacteria 1068
160 Ga0070704_100697125 3300005549 Bacteria 900
161 Ga0068855_100004105 3300005563 Bacteria 17757
162 Ga0068855_100015373 3300005563 Bacteria 9214
163 Ga0068855_100017343 3300005563 Bacteria 8665
164 Ga0068855_100214285 3300005563 Bacteria 2163
165 Ga0068855_100646092 3300005563 Bacteria 1137
166 Ga0068855_101094096 3300005563 Bacteria 833
167 Ga0068855_102558464 3300005563 Bacteria 507
168 Ga0070664_100000205 3300005564 Bacteria 42407
169 Ga0070664_100000500 3300005564 Bacteria 29704
170 Ga0070664_100030140 3300005564 Bacteria 4526
171 Ga0070664_100052899 3300005564 Bacteria 3441
172 Ga0070664_100259809 3300005564 Bacteria 1562
173 Ga0070664_100319236 3300005564 Bacteria 1407
174 Ga0068857_100004942 3300005577 Bacteria 11321
175 Ga0068857_100024151 3300005577 Bacteria 5351
176 Ga0068857_100119000 3300005577 Bacteria 2377
177 Ga0068857_100150732 3300005577 Bacteria 2106
178 Ga0068857_101216951 3300005577 Bacteria 730
179 Ga0068854_100024222 3300005578 Bacteria 4153
180 Ga0068854_100044853 3300005578 Bacteria 3141
181 Ga0068854_100110870 3300005578 Bacteria 2070
182 Ga0068854_100198460 3300005578 Bacteria 1576
183 Ga0068856_100000487 3300005614 Bacteria 43983
184 Ga0068856_100005622 3300005614 Bacteria 12334
185 Ga0068856_100014860 3300005614 Bacteria 7514
186 Ga0068856_100124311 3300005614 Bacteria 2582
187 Ga0068856_100292509 3300005614 Bacteria 1646
188 Ga0070702_100597197 3300005615 Bacteria 827
189 Ga0068852_100004594 3300005616 Bacteria 9777
190 Ga0068852_100019402 3300005616 Bacteria 5380
191 Ga0068852_100038154 3300005616 Bacteria 4035
192 Ga0068852_100081928 3300005616 Bacteria 2866
193 Ga0068852_100127927 3300005616 Bacteria 2335
194 Ga0068852_100275693 3300005616 Bacteria 1620
195 Ga0068852_100310452 3300005616 Bacteria 1529
196 Ga0068852_101371654 3300005616 Bacteria 729
197 Ga0068852_101635288 3300005616 Bacteria 666
198 Ga0068859_100000638 3300005617 Bacteria 34985
199 Ga0068859_100009973 3300005617 Bacteria 9583
200 Ga0068859_100150522 3300005617 Bacteria 2402
201 Ga0068859_100489877 3300005617 Bacteria 1325
202 Ga0068859_100771337 3300005617 Bacteria 1050
203 Ga0068864_100002774 3300005618 Bacteria 14467
204 Ga0068864_100007408 3300005618 Bacteria 9034
205 Ga0068864_100035918 3300005618 Bacteria 4221
206 Ga0068864_100447516 3300005618 Bacteria 1235
207 Ga0068866_10459742 3300005718 Bacteria 834
208 Ga0068861_100001272 3300005719 Bacteria 15754
209 Ga0068861_100115886 3300005719 Bacteria 2154
210 Ga0068861_100470687 3300005719 Bacteria 1130
211 Ga0068861_100547588 3300005719 Bacteria 1054
212 Ga0068861_100697871 3300005719 Bacteria 943
213 Ga0068861_102490552 3300005719 Bacteria 521
214 Ga0068851_10034148 3300005834 Bacteria 2538
215 Ga0068851_10847701 3300005834 Bacteria 570
216 Ga0068870_10009071 3300005840 Bacteria 4505
217 Ga0068870_10011654 3300005840 Bacteria 4085
218 Ga0068870_10051327 3300005840 Bacteria 2183
219 Ga0068863_100093698 3300005841 Bacteria 2850
220 Ga0068863_100252509 3300005841 Bacteria 1704
221 Ga0068863_100315452 3300005841 Bacteria 1518
222 Ga0068863_100443072 3300005841 Bacteria 1274
223 Ga0068863_100683562 3300005841 Bacteria 1019
224 Ga0068863_100973243 3300005841 Bacteria 851
225 Ga0068863_101283340 3300005841 Bacteria 739
226 Ga0068863_101340471 3300005841 Bacteria 723
227 Ga0068858_100025579 3300005842 Bacteria 5492
228 Ga0068858_100028541 3300005842 Bacteria 5182
229 Ga0068858_100396600 3300005842 Bacteria 1325
230 Ga0068858_100426940 3300005842 Bacteria 1275
231 Ga0068860_100003943 3300005843 Bacteria 15243
232 Ga0068860_100006112 3300005843 Bacteria 12110
233 Ga0068860_100521085 3300005843 Bacteria 1189
234 Ga0068860_100951762 3300005843 Bacteria 876
235 Ga0068860_101936172 3300005843 Bacteria 611
236 Ga0068862_100004934 3300005844 Bacteria 11233
237 Ga0068862_100120768 3300005844 Bacteria 2309
238 Ga0070717_10345772 3300006028 Bacteria 1329
239 Ga0075432_10111680 3300006058 Bacteria 1019
240 Ga0070715_10865156 3300006163 Bacteria 554
241 Ga0075367_11091498 3300006178 Bacteria 510
242 Ga0075369_10178223 3300006186 Bacteria 977
243 Ga0097621_100003143 3300006237 Bacteria 11333
244 Ga0097621_100010141 3300006237 Bacteria 6877
245 Ga0097621_100020362 3300006237 Bacteria 5110
246 Ga0097621_100623117 3300006237 Bacteria 988
247 Ga0075370_10000886 3300006353 Bacteria 12236
248 Ga0068871_100010536 3300006358 Bacteria 6753
249 Ga0068871_100091440 3300006358 Bacteria 2536
250 Ga0068871_100112370 3300006358 Bacteria 2292
251 Ga0068871_100393557 3300006358 Bacteria 1233
252 Ga0068871_101012871 3300006358 Bacteria 774
253 Ga0068871_101144036 3300006358 Bacteria 729
254 Ga0075428_100794878 3300006844 Bacteria 1006
255 Ga0075433_10055370 3300006852 Bacteria 3462
256 Ga0075433_10493006 3300006852 Bacteria 1079
257 Ga0075433_11615795 3300006852 Bacteria 559
258 Ga0068865_100006382 3300006881 Bacteria 7187
259 Ga0068865_100206659 3300006881 Bacteria 1527
260 Ga0068865_100722915 3300006881 Bacteria 853
261 Ga0097620_100000638 3300006931 Bacteria 34985
262 Ga0097620_100009973 3300006931 Bacteria 9583
263 Ga0097620_100150522 3300006931 Bacteria 2402
264 Ga0097620_100489901 3300006931 Bacteria 1325
265 Ga0097620_100771184 3300006931 Bacteria 1050
266 Ga0075435_100028374 3300007076 Bacteria 4389
267 Ga0105251_10231531 3300009011 Bacteria 832
268 Ga0105240_10037008 3300009093 Bacteria 6273
269 Ga0105240_10073361 3300009093 Bacteria 4226
270 Ga0105240_10294319 3300009093 Bacteria 1859
271 Ga0105245_10047077 3300009098 Bacteria 3855
272 Ga0105245_10288760 3300009098 Bacteria 1606
273 Ga0105245_11414059 3300009098 Bacteria 746
274 Ga0105245_11786626 3300009098 Bacteria 668
275 Ga0105247_10503076 3300009101 Bacteria 883
276 Ga0105243_10265943 3300009148 Bacteria 1538
277 Ga0105241_10027331 3300009174 Bacteria 4249
278 Ga0105241_11158392 3300009174 Bacteria 730
279 Ga0105241_11783467 3300009174 Bacteria 600
280 Ga0105242_10821436 3300009176 Bacteria 922
281 Ga0105248_10001222 3300009177 Bacteria 28675
282 Ga0105248_10022056 3300009177 Bacteria 7055
283 Ga0105248_10090985 3300009177 Bacteria 3436
284 Ga0105248_10168778 3300009177 Bacteria 2466
285 Ga0105248_10418119 3300009177 Bacteria 1510
286 Ga0105248_10716146 3300009177 Bacteria 1129
287 Ga0105248_10820765 3300009177 Bacteria 1050
288 Ga0105248_11306506 3300009177 Bacteria 820
289 Ga0105237_10067353 3300009545 Bacteria 3574
290 Ga0105237_11014655 3300009545 Bacteria 837
291 Ga0105238_10001723 3300009551 Bacteria 22037
292 Ga0105238_10080184 3300009551 Bacteria 3254
293 Ga0105238_10217803 3300009551 Bacteria 1885
294 Ga0105238_12664283 3300009551 Bacteria 536
295 Ga0105249_10338327 3300009553 Bacteria 1521
296 Ga0105249_10987269 3300009553 Bacteria 911
297 Ga0105249_13560933 3300009553 Bacteria 502
298 Ga0105249_13584910 3300009553 Bacteria 500
299 Ga0105239_10477713 3300010375 Bacteria 1416
300 Ga0105239_11372543 3300010375 Bacteria 816
301 Ga0105246_10302173 3300011119 Bacteria 1292
302 Ga0105246_11238289 3300011119 Bacteria 689
303 Ga0157373_10003392 3300013100 Bacteria 12052
304 Ga0157373_10006331 3300013100 Bacteria 8843
305 Ga0157373_10016743 3300013100 Bacteria 5343
306 Ga0157373_10110230 3300013100 Bacteria 1935
307 Ga0157373_11192806 3300013100 Bacteria 573
308 Ga0157371_10000365 3300013102 Bacteria 57144
309 Ga0157371_10089714 3300013102 Bacteria 2177
310 Ga0157371_10785278 3300013102 Bacteria 717
311 Ga0157370_10002179 3300013104 Bacteria 23894
312 Ga0157370_10055513 3300013104 Bacteria 3772
313 Ga0157370_10130729 3300013104 Bacteria 2342
314 Ga0157370_10225326 3300013104 Bacteria 1735
315 Ga0157370_10672044 3300013104 Bacteria 946
316 Ga0157369_10006741 3300013105 Bacteria 13254
317 Ga0157369_10018914 3300013105 Bacteria 7719
318 Ga0157369_10019036 3300013105 Bacteria 7688
319 Ga0157369_10096857 3300013105 Bacteria 3147
320 Ga0157369_10442735 3300013105 Bacteria 1346
321 Ga0157374_10003730 3300013296 Bacteria 12803
322 Ga0157374_10017807 3300013296 Bacteria 6259
323 Ga0157374_10072948 3300013296 Bacteria 3240
324 Ga0157374_10256674 3300013296 Bacteria 1721
325 Ga0157374_11121369 3300013296 Bacteria 807
326 Ga0157378_10023467 3300013297 Bacteria 5428
327 Ga0157378_10149202 3300013297 Bacteria 2177
328 Ga0157378_10152831 3300013297 Bacteria 2151
329 Ga0157378_10344976 3300013297 Bacteria 1453
330 Ga0157378_10554362 3300013297 Bacteria 1155
331 Ga0157378_10909694 3300013297 Bacteria 911
332 Ga0157378_12335308 3300013297 Bacteria 586
333 Ga0163162_10053479 3300013306 Bacteria 4058
334 Ga0163162_10155174 3300013306 Bacteria 2409
335 Ga0163162_10543796 3300013306 Bacteria 1290
336 Ga0163162_10707591 3300013306 Bacteria 1129
337 Ga0163162_10812500 3300013306 Bacteria 1052
338 Ga0163162_10837554 3300013306 Bacteria 1036
339 Ga0163162_11199103 3300013306 Bacteria 861
340 Ga0157372_10025043 3300013307 Bacteria 6484
341 Ga0157372_10039797 3300013307 Bacteria 5190
342 Ga0157372_10165010 3300013307 Bacteria 2561
343 Ga0157372_10221992 3300013307 Bacteria 2190
344 Ga0157372_10331504 3300013307 Bacteria 1772
345 Ga0157372_10771443 3300013307 Bacteria 1118
346 Ga0157372_10977766 3300013307 Bacteria 981
347 Ga0157372_10996673 3300013307 Bacteria 970
348 Ga0157372_12807186 3300013307 Bacteria 558
349 Ga0157375_10011973 3300013308 Bacteria 7681
350 Ga0157375_10015066 3300013308 Bacteria 6914
351 Ga0157375_10092999 3300013308 Bacteria 3080
352 Ga0157375_10135338 3300013308 Bacteria 2587
353 Ga0157375_10200138 3300013308 Bacteria 2153
354 Ga0157375_10610952 3300013308 Bacteria 1249
355 Ga0163163_10005582 3300014325 Bacteria 10899
356 Ga0163163_10909109 3300014325 Bacteria 944
357 Ga0157380_11182038 3300014326 Bacteria 808
358 Ga0157380_11551554 3300014326 Bacteria 717
359 Ga0157380_13516309 3300014326 Bacteria 502
360 Ga0182008_10217977 3300014497 Bacteria 976
361 Ga0157377_10931561 3300014745 Bacteria 652
362 Ga0157379_10001432 3300014968 Bacteria 19594
363 Ga0157379_10003011 3300014968 Bacteria 14227
364 Ga0157379_10046158 3300014968 Bacteria 3888
365 Ga0157379_11434233 3300014968 Bacteria 670
366 Ga0157376_10175529 3300014969 Bacteria 1954
367 Ga0157376_10366566 3300014969 Bacteria 1383
368 Ga0157376_10409600 3300014969 Bacteria 1313
369 Ga0157376_10579486 3300014969 Bacteria 1114
370 Ga0157376_11918145 3300014969 Bacteria 629
371 Ga0163161_11387878 3300017792 Bacteria 613
372 Ga0213872_10312706 3300021361 Bacteria 650
373 Ga0209646_1000039 3300025246 Bacteria 349637
374 Ga0209026_1000006 3300025250 Bacteria 677225
375 Ga0209677_100914 3300025253 Bacteria 14434
376 Ga0209759_1000020 3300025256 Bacteria 344904
377 Ga0207697_10007205 3300025315 Bacteria 4970
378 Ga0207656_10473145 3300025321 Bacteria 635
379 Ga0207713_1212763 3300025735 Bacteria 587
380 Ga0207642_10057739 3300025899 Bacteria 1787
381 Ga0207642_10241373 3300025899 Bacteria 1020
382 Ga0207710_10236747 3300025900 Bacteria 910
383 Ga0207688_10089483 3300025901 Bacteria 1766
384 Ga0207688_10173786 3300025901 Bacteria 1282
385 Ga0207680_10409345 3300025903 Bacteria 959
386 Ga0207647_10318264 3300025904 Bacteria 884
387 Ga0207645_10000867 3300025907 Bacteria 25160
388 Ga0207645_10013883 3300025907 Bacteria 5404
389 Ga0207645_10125489 3300025907 Bacteria 1668
390 Ga0207645_10552458 3300025907 Bacteria 781
391 Ga0207643_10036956 3300025908 Bacteria 2739
392 Ga0207643_10557962 3300025908 Bacteria 735
393 Ga0207705_10074796 3300025909 Bacteria 2459
394 Ga0207705_10081090 3300025909 Bacteria 2365
395 Ga0207705_10407838 3300025909 Bacteria 1051
396 Ga0207654_10119050 3300025911 Bacteria 1655
397 Ga0207654_10691308 3300025911 Bacteria 732
398 Ga0207707_10002721 3300025912 Bacteria 15790
399 Ga0207695_10104184 3300025913 Bacteria 2827
400 Ga0207695_10183388 3300025913 Bacteria 2013
401 Ga0207671_10032764 3300025914 Bacteria 3866
402 Ga0207663_11112999 3300025916 Bacteria 635
403 Ga0207660_10562897 3300025917 Bacteria 927
404 Ga0207657_10000967 3300025919 Bacteria 30457
405 Ga0207657_10066809 3300025919 Bacteria 3059
406 Ga0207657_10494951 3300025919 Bacteria 958
407 Ga0207649_10159379 3300025920 Bacteria 1562
408 Ga0207649_10453604 3300025920 Bacteria 968
409 Ga0207649_10525075 3300025920 Bacteria 903
410 Ga0207649_11024048 3300025920 Bacteria 650
411 Ga0207652_10000882 3300025921 Bacteria 28372
412 Ga0207681_10020008 3300025923 Bacteria 4239
413 Ga0207681_10034544 3300025923 Bacteria 3325
414 Ga0207681_10048752 3300025923 Bacteria 2860
415 Ga0207681_11211557 3300025923 Bacteria 634
416 Ga0207694_10095613 3300025924 Bacteria 2349
417 Ga0207694_11224054 3300025924 Bacteria 635
418 Ga0207650_10010149 3300025925 Bacteria 6455
419 Ga0207650_10011061 3300025925 Bacteria 6207
420 Ga0207659_10013628 3300025926 Bacteria 5214
421 Ga0207659_10100244 3300025926 Bacteria 2182
422 Ga0207659_10291320 3300025926 Bacteria 1338
423 Ga0207664_10822441 3300025929 Bacteria 835
424 Ga0207644_10013484 3300025931 Bacteria 5450
425 Ga0207644_10039263 3300025931 Bacteria 3341
426 Ga0207644_10081230 3300025931 Bacteria 2395
427 Ga0207644_10089114 3300025931 Bacteria 2296
428 Ga0207690_10000438 3300025932 Bacteria 27116
429 Ga0207690_10317504 3300025932 Bacteria 1224
430 Ga0207690_10432339 3300025932 Bacteria 1055
431 Ga0207690_11185349 3300025932 Bacteria 637
432 Ga0207706_10000024 3300025933 Bacteria 151942
433 Ga0207706_10085073 3300025933 Bacteria 2781
434 Ga0207706_10226861 3300025933 Bacteria 1635
435 Ga0207706_10714602 3300025933 Bacteria 855
436 Ga0207686_10083788 3300025934 Bacteria 2087
437 Ga0207686_10414787 3300025934 Bacteria 1029
438 Ga0207709_10488234 3300025935 Bacteria 959
439 Ga0207670_10013294 3300025936 Bacteria 4847
440 Ga0207670_10380942 3300025936 Bacteria 1124
441 Ga0207669_10046076 3300025937 Bacteria 2574
442 Ga0207704_10117960 3300025938 Bacteria 1809
443 Ga0207704_10252442 3300025938 Bacteria 1325
444 Ga0207691_10000328 3300025940 Bacteria 47302
445 Ga0207691_10010980 3300025940 Bacteria 8689
446 Ga0207691_10028115 3300025940 Bacteria 5267
447 Ga0207691_10039517 3300025940 Bacteria 4365
448 Ga0207691_10179539 3300025940 Bacteria 1850
449 Ga0207711_10015761 3300025941 Bacteria 6269
450 Ga0207711_10026765 3300025941 Bacteria 4840
451 Ga0207711_10043445 3300025941 Bacteria 3834
452 Ga0207711_10172502 3300025941 Bacteria 1963
453 Ga0207711_10715892 3300025941 Bacteria 933
454 Ga0207711_10847151 3300025941 Bacteria 851
455 Ga0207689_10000978 3300025942 Bacteria 27386
456 Ga0207689_10003815 3300025942 Bacteria 13737
457 Ga0207689_10110096 3300025942 Bacteria 2263
458 Ga0207689_10665233 3300025942 Bacteria 878
459 Ga0207661_10129937 3300025944 Bacteria 2156
460 Ga0207661_10135413 3300025944 Bacteria 2115
461 Ga0207679_10001794 3300025945 Bacteria 13364
462 Ga0207679_10046035 3300025945 Bacteria 3160
463 Ga0207679_10226757 3300025945 Bacteria 1575
464 Ga0207679_11085493 3300025945 Bacteria 734
465 Ga0207667_10002406 3300025949 Bacteria 23427
466 Ga0207667_10031658 3300025949 Bacteria 5708
467 Ga0207667_10100540 3300025949 Bacteria 2983
468 Ga0207667_10174500 3300025949 Bacteria 2209
469 Ga0207667_10332986 3300025949 Bacteria 1550
470 Ga0207667_10473498 3300025949 Bacteria 1272
471 Ga0207667_10483639 3300025949 Bacteria 1257
472 Ga0207667_11288131 3300025949 Bacteria 708
473 Ga0207651_10004469 3300025960 Bacteria 7054
474 Ga0207651_10017821 3300025960 Bacteria 4207
475 Ga0207651_10068842 3300025960 Bacteria 2497
476 Ga0207651_10205844 3300025960 Bacteria 1580
477 Ga0207651_10380903 3300025960 Bacteria 1195
478 Ga0207712_10539464 3300025961 Bacteria 1002
479 Ga0207712_10679884 3300025961 Bacteria 897
480 Ga0207668_10014932 3300025972 Bacteria 4816
481 Ga0207668_10029422 3300025972 Bacteria 3600
482 Ga0207668_10037570 3300025972 Bacteria 3242
483 Ga0207640_10050956 3300025981 Bacteria 2689
484 Ga0207640_10365750 3300025981 Bacteria 1164
485 Ga0207658_10006246 3300025986 Bacteria 8141
486 Ga0207658_10026736 3300025986 Bacteria 4048
487 Ga0207658_10086633 3300025986 Bacteria 2416
488 Ga0207658_10363691 3300025986 Bacteria 1263
489 Ga0207658_11999601 3300025986 Bacteria 527
490 Ga0207677_10039527 3300026023 Bacteria 3103
491 Ga0207677_10118183 3300026023 Bacteria 1988
492 Ga0207677_11480381 3300026023 Bacteria 627
493 Ga0207703_10011529 3300026035 Bacteria 6877
494 Ga0207703_10017883 3300026035 Bacteria 5536
495 Ga0207703_10077338 3300026035 Bacteria 2762
496 Ga0207703_10173499 3300026035 Bacteria 1898
497 Ga0207703_10239466 3300026035 Bacteria 1631
498 Ga0207639_10034366 3300026041 Bacteria 3746
499 Ga0207639_10061090 3300026041 Bacteria 2909
500 Ga0207639_10128935 3300026041 Bacteria 2091
501 Ga0207639_10505870 3300026041 Bacteria 1104
502 Ga0207678_10017556 3300026067 Bacteria 6285
503 Ga0207678_10139321 3300026067 Bacteria 2070
504 Ga0207678_10962332 3300026067 Bacteria 755
505 Ga0207708_10242072 3300026075 Bacteria 1451
506 Ga0207708_10918721 3300026075 Bacteria 758
507 Ga0207702_10000310 3300026078 Bacteria 55596
508 Ga0207702_10007209 3300026078 Bacteria 9515
509 Ga0207702_10167053 3300026078 Bacteria 2014
510 Ga0207641_10005581 3300026088 Bacteria 10721
511 Ga0207641_10009917 3300026088 Bacteria 7842
512 Ga0207641_10140326 3300026088 Bacteria 2180
513 Ga0207641_10515446 3300026088 Bacteria 1163
514 Ga0207641_10875119 3300026088 Bacteria 891
515 Ga0207641_10943063 3300026088 Bacteria 858
516 Ga0207648_10000726 3300026089 Bacteria 36910
517 Ga0207648_10001220 3300026089 Bacteria 28819
518 Ga0207676_10003141 3300026095 Bacteria 11789
519 Ga0207676_10051112 3300026095 Bacteria 3225
520 Ga0207676_10152353 3300026095 Bacteria 1993
521 Ga0207674_10028559 3300026116 Bacteria 5886
522 Ga0207674_10067479 3300026116 Bacteria 3601
523 Ga0207674_10078312 3300026116 Bacteria 3310
524 Ga0207674_10080603 3300026116 Bacteria 3258
525 Ga0207675_100001344 3300026118 Bacteria 24662
526 Ga0207675_100021731 3300026118 Bacteria 5972
527 Ga0207675_100088142 3300026118 Bacteria 2915
528 Ga0207675_100198307 3300026118 Bacteria 1927
529 Ga0207675_101968851 3300026118 Bacteria 602
530 Ga0207675_101984349 3300026118 Bacteria 600
531 Ga0207675_102377388 3300026118 Bacteria 542
532 Ga0207683_10000807 3300026121 Bacteria 28669
533 Ga0207683_10079818 3300026121 Bacteria 2902
534 Ga0207683_10339286 3300026121 Bacteria 1378
535 Ga0207683_11283609 3300026121 Bacteria 678
536 Ga0207698_10017978 3300026142 Bacteria 4807
537 Ga0207698_10068036 3300026142 Bacteria 2811
538 Ga0207698_10350955 3300026142 Bacteria 1393
539 Ga0207698_10658000 3300026142 Bacteria 1038
540 Ga0207698_11153052 3300026142 Bacteria 788
541 Ga0209996_1026298 3300027395 Bacteria 834
542 Ga0209995_1002494 3300027471 Bacteria 2911
543 Ga0209968_1088468 3300027526 Bacteria 561
544 Ga0209999_1009637 3300027543 Bacteria 1743
545 Ga0209970_1020437 3300027614 Bacteria 1119
546 Ga0209966_1006452 3300027695 Bacteria 2038
547 Ga0209974_10000041 3300027876 Bacteria 31325
548 Ga0209974_10013052 3300027876 Bacteria 2770
549 Ga0207428_10393414 3300027907 Bacteria 1015
550 Ga0268266_11562769 3300028379 Bacteria 635
551 Ga0268265_10033997 3300028380 Bacteria 3712
552 Ga0268264_10009963 3300028381 Bacteria 7870
553 Ga0268264_10011189 3300028381 Bacteria 7411
554 Ga0268264_11307719 3300028381 Bacteria 735
555 Ga0307408_100012040 3300031548 Bacteria 5726
556 Ga0265342_10242554 3300031712 Bacteria 964
557 Ga0307405_10009517 3300031731 Bacteria 4985
558 Ga0307413_10006886 3300031824 Bacteria 5230
559 Ga0307413_11927412 3300031824 Bacteria 531
560 Ga0307410_10006796 3300031852 Bacteria 6208
561 Ga0307410_10736014 3300031852 Bacteria 834
562 Ga0307406_10001453 3300031901 Bacteria 13100
563 Ga0307407_10006443 3300031903 Bacteria 5217
564 Ga0307407_10199927 3300031903 Bacteria 1339
565 Ga0307412_10022460 3300031911 Bacteria 3868
566 Ga0307412_10269425 3300031911 Bacteria 1332
567 Ga0307412_10346995 3300031911 Bacteria 1190
568 Ga0307409_100013622 3300031995 Bacteria 5245
569 Ga0307409_100204427 3300031995 Bacteria 1770
570 Ga0307409_102428258 3300031995 Bacteria 553
571 Ga0307416_100006433 3300032002 Bacteria 7358
572 Ga0307416_100928746 3300032002 Bacteria 971
573 Ga0307414_10137857 3300032004 Bacteria 1905
574 Ga0307411_10000456 3300032005 Bacteria 14093
575 Ga0307415_100080891 3300032126 Bacteria 2319
576 Ga0307415_100741191 3300032126 Bacteria 891
577 Ga0373934_0191341 3300035086 Bacteria 842
578 Ga0373953_0297824 3300035117 Bacteria 704
579 Ga0373957_0030941 3300035120 Bacteria 1964
580 Ga0373955_0128794 3300035172 Bacteria 1476
581 Ga0373955_0255228 3300035172 Bacteria 1052
582 Ga0373961_0157475 3300035241 Bacteria 778
583 Ga0373931_0189560 3300035691 Bacteria 1223
584 Ga0373935_0077542 3300035692 Bacteria 2154
585 Ga0395900_0358506 3300037418 Bacteria 1430
586 Ga0395905_0029632 3300037471 Bacteria 5158
587 Ga0395905_0286839 3300037471 Bacteria 1533
588 Ga0395905_0396436 3300037471 Bacteria 1275
589 Ga0395901_0082541 3300038443 Bacteria 3358
590 Ga0395901_1259029 3300038443 Bacteria 703
591 Ga0242420_076421 3300038996 Bacteria 687
592 Ga0436361_0962106 3300039447 Bacteria 1356
593 Ga0439465_0097522 3300041413 Bacteria 1012
594 Ga0451804_0410469 3300041463 Bacteria 681
595 Ga0451837_1437381 3300041494 Bacteria 556
596 Ga0451853_2798496 3300041512 Bacteria 1185
597 Ga0439441_176034 3300042001 Bacteria 513
598 Ga0450896_004241 3300042133 Bacteria 1941
599 Ga0450898_125407 3300042134 Bacteria 550
600 Ga0439446_0376820 3300042156 Bacteria 509
601 Ga0439444_0078373 3300042437 Bacteria 719
602 Ga0451577_0183458 3300042876 Bacteria 1887
603 Ga0451577_0437630 3300042876 Bacteria 1187
604 Ga0466969_0029420 3300044656 Bacteria 2804
605 Ga0466980_0259552 3300044668 Bacteria 1073
606 Ga0453683_0520212 3300044673 Bacteria 773
607 Ga0466965_0086054 3300044683 Bacteria 1594
608 Ga0466966_0026828 3300044684 Bacteria 3758
609 Ga0466966_0218177 3300044684 Bacteria 1152
610 Ga0466961_0054494 3300044693 Bacteria 2550
611 Ga0466961_0341621 3300044693 Bacteria 912
612 Ga0453684_0397304 3300044712 Bacteria 1545
613 Ga0453684_0779249 3300044712 Bacteria 1033
614 Ga0466971_0203093 3300044719 Bacteria 936
615 Ga0466970_0226356 3300044765 Bacteria 1044
616 Ga0466957_0031256 3300044842 Bacteria 3181
617 Ga0466957_0452812 3300044842 Bacteria 885
618 Ga0466959_0012017 3300045049 Bacteria 6245
619 Ga0451576_0427578 3300045051 Bacteria 1390
620 Ga0466958_0432522 3300045836 Bacteria 851
621 Ga0495592_0305150 3300046454 Bacteria 1033
622 Ga0495651_0070347 3300046462 Bacteria 2663
623 Ga0495608_0013310 3300046511 Bacteria 5707
624 Ga0495628_0070524 3300046516 Bacteria 2725
625 Ga0495587_0175271 3300046536 Bacteria 1217
626 Ga0495621_0250034 3300046539 Bacteria 724
627 Ga0495667_0090853 3300046559 Bacteria 1978
628 Ga0495635_0354361 3300046663 Bacteria 979
629 Ga0495657_0441877 3300046675 Bacteria 762
630 Ga0495623_0032712 3300046679 Bacteria 3341
631 Ga0495658_0488500 3300046683 Bacteria 787
632 Ga0495658_1018286 3300046683 Bacteria 529
633 Ga0495600_0275561 3300046809 Bacteria 1066
634 Ga0495684_0191930 3300047471 Bacteria 1510
635 Ga0495602_0227371 3300048088 Bacteria 1404
636 Ga0496100_0387926 3300048903 Bacteria 1062
637 Ga0496101_0821129 3300048904 Bacteria 733
638 Ga0496101_1584087 3300048904 Bacteria 509
639 Ga0496102_0019973 3300048905 Bacteria 5910
640 Ga0496102_0031073 3300048905 Bacteria 4787
641 Ga0496102_0566374 3300048905 Bacteria 1059
642 Ga0496103_0010672 3300048906 Bacteria 5435
643 Ga0496106_0042223 3300048909 Bacteria 3420
644 Ga0496106_0043122 3300048909 Bacteria 3384
645 Ga0496106_0503832 3300048909 Bacteria 972
646 Ga0496106_0965233 3300048909 Bacteria 671
647 Ga0496107_0002463 3300048910 Bacteria 12009
648 Ga0496107_0155747 3300048910 Bacteria 1692
649 Ga0496108_0092966 3300048911 Bacteria 2565
650 Ga0496108_0257919 3300048911 Bacteria 1517
651 Ga0496108_1228064 3300048911 Bacteria 633
652 Ga0496109_1183987 3300048912 Bacteria 701
653 Ga0496109_1221697 3300048912 Bacteria 688
654 Ga0496110_0510561 3300048913 Bacteria 1094
655 Ga0496110_1410153 3300048913 Bacteria 606
656 Ga0496110_1841710 3300048913 Bacteria 515
657 Ga0496112_1305975 3300048915 Bacteria 641
658 Ga0496114_0857914 3300048917 Bacteria 788
659 Ga0496126_0005752 3300048929 Bacteria 14027
660 Ga0496126_0036269 3300048929 Bacteria 4611
661 Ga0501034_0014114 3300049571 Bacteria 8232
662 Ga0501034_0070809 3300049571 Bacteria 3498
663 Ga0501034_0387494 3300049571 Bacteria 1322
664 Ga0501046_0274123 3300049580 Bacteria 1237
665 Ga0501047_0004566 3300049581 Bacteria 13022
666 Ga0501047_0023350 3300049581 Bacteria 5939
667 Ga0501047_0485179 3300049581 Bacteria 1063
668 Ga0501047_0565800 3300049581 Unclassified 960
669 Ga0501048_0658102 3300049582 Bacteria 752
670 Ga0501067_0003639 3300049583 Bacteria 8491
671 Ga0501067_0103722 3300049583 Bacteria 1580
672 Ga0501068_0007747 3300049584 Bacteria 5947
673 Ga0501069_0007681 3300049585 Bacteria 5658
674 Ga0501069_0136668 3300049585 Bacteria 1405
675 Ga0501070_0005698 3300049586 Bacteria 10619
676 Ga0501070_0132421 3300049586 Bacteria 2059
677 Ga0501072_0012097 3300049588 Bacteria 6593
678 Ga0501073_0002490 3300049589 Bacteria 13749
679 Ga0501073_0009577 3300049589 Bacteria 7144
680 Ga0501074_0001555 3300049590 Bacteria 15520
681 Ga0501074_0019444 3300049590 Bacteria 4933
682 Ga0501077_1033310 3300049593 Bacteria 529
683 Ga0501079_0011145 3300049741 Bacteria 6856
684 Ga0501079_0867276 3300049741 Bacteria 711
685 Ga0501080_0016096 3300049742 Bacteria 6903
686 Ga0501080_0024511 3300049742 Bacteria 5592
687 Ga0501080_0039895 3300049742 Bacteria 4381
688 Ga0501080_0188975 3300049742 Bacteria 1893
689 Ga0501083_0003639 3300049744 Bacteria 10819
690 Ga0501083_0015423 3300049744 Bacteria 5351
691 Ga0501083_0055475 3300049744 Bacteria 2656
692 Ga0501035_0181555 3300049822 Bacteria 1813
693 Ga0501035_0192526 3300049822 Bacteria 1753
694 Ga0501035_0541592 3300049822 Bacteria 954
695 Ga0501044_0088928 3300049823 Bacteria 3118
696 nmdc:mga06z11_917056_c1 3300050494 Bacteria 534
697 nmdc:mga07m45_257_c1 3300050496 Bacteria 21611
698 nmdc:mga08x19_424194_c1 3300050514 Bacteria 934
699 nmdc:mga0a205_66931_c1 3300050515 Bacteria 3470
700 Ga0495601_0116042 3300053077 Bacteria 1736
701 Ga0495595_0168288 3300053084 Bacteria 1084
702 Ga0495595_0287598 3300053084 Bacteria 826
703 Ga0495619_0012027 3300053085 Bacteria 5453
704 Ga0495619_0272528 3300053085 Bacteria 1173
705 Ga0500646_0000709 3300053090 Bacteria 9479
706 Ga0500555_136848 3300053103 Bacteria 605
707 Ga0500642_0458646 3300053130 Bacteria 545
708 Ga0500568_0029148 3300053139 Bacteria 2293
709 Ga0500604_0007191 3300053151 Bacteria 2947
710 Ga0501084_0061508 3300054114 Bacteria 3144
711 Ga0590071_061993 3300059421 Bacteria 915
712 Ga0501082_0030848 3300060353 Bacteria 4621
713 Ga0501082_0056471 3300060353 Bacteria 3382
714 Ga0466962_0571458 3300061719 Bacteria 575
715 Ga0466962_0634592 3300061719 Bacteria 546

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100028374 Ga0075435_1000283742 83
2 3300005334 Ga0068869_101524698 Ga0068869_1015246981 84
3 3300005353 Ga0070669_100876503 Ga0070669_1008765032 84
4 3300005354 Ga0070675_100160918 Ga0070675_1001609181 84
5 3300005356 Ga0070674_100538724 Ga0070674_1005387242 84
6 3300005364 Ga0070673_100123618 Ga0070673_1001236182 84
7 3300005548 Ga0070665_101235679 Ga0070665_1012356792 84
8 3300005578 Ga0068854_100198460 Ga0068854_1001984602 84
9 3300005616 Ga0068852_100310452 Ga0068852_1003104522 84
10 3300006844 Ga0075428_100794878 Ga0075428_1007948781 84
11 3300031852 Ga0307410_10736014 Ga0307410_107360142 84
12 3300005329 Ga0070683_100144385 Ga0070683_1001443852 85
13 3300005331 Ga0070670_100147629 Ga0070670_1001476294 85
14 3300005336 Ga0070680_100091698 Ga0070680_1000916984 85
15 3300005339 Ga0070660_100071292 Ga0070660_1000712922 85
16 3300005344 Ga0070661_100000785 Ga0070661_1000007854 85
17 3300005366 Ga0070659_100901085 Ga0070659_1009010852 85
18 3300005435 Ga0070714_100013821 Ga0070714_1000138213 85
19 3300005458 Ga0070681_10166976 Ga0070681_101669762 85
20 3300005530 Ga0070679_100030395 Ga0070679_1000303954 85
21 3300005535 Ga0070684_100047181 Ga0070684_1000471812 85
22 3300005539 Ga0068853_100108701 Ga0068853_1001087013 85
23 3300005546 Ga0070696_100130350 Ga0070696_1001303502 85
24 3300005548 Ga0070665_100564346 Ga0070665_1005643462 85
25 3300005563 Ga0068855_100015373 Ga0068855_1000153732 85
26 3300005563 Ga0068855_102558464 Ga0068855_1025584642 85
27 3300005564 Ga0070664_100000500 Ga0070664_10000050021 85
28 3300005577 Ga0068857_100119000 Ga0068857_1001190004 85
29 3300005578 Ga0068854_100044853 Ga0068854_1000448534 85
30 3300005614 Ga0068856_100005622 Ga0068856_10000562212 85
31 3300005616 Ga0068852_100004594 Ga0068852_1000045949 85
32 3300005618 Ga0068864_100447516 Ga0068864_1004475161 85
33 3300005841 Ga0068863_100252509 Ga0068863_1002525092 85
34 3300005841 Ga0068863_100443072 Ga0068863_1004430722 85
35 3300005844 Ga0068862_100120768 Ga0068862_1001207683 85
36 3300006186 Ga0075369_10178223 Ga0075369_101782233 85
37 3300009093 Ga0105240_10037008 Ga0105240_100370082 85
38 3300009545 Ga0105237_11014655 Ga0105237_110146552 85
39 3300009551 Ga0105238_10001723 Ga0105238_1000172320 85
40 3300013100 Ga0157373_10016743 Ga0157373_100167437 85
41 3300013102 Ga0157371_10089714 Ga0157371_100897145 85
42 3300013104 Ga0157370_10130729 Ga0157370_101307293 85
43 3300013105 Ga0157369_10018914 Ga0157369_100189147 85
44 3300013296 Ga0157374_11121369 Ga0157374_111213692 85
45 3300013307 Ga0157372_10221992 Ga0157372_102219923 85
46 3300014326 Ga0157380_13516309 Ga0157380_135163091 85
47 3300014968 Ga0157379_11434233 Ga0157379_114342331 85
48 3300053090 Ga0500646_0000709 Ga0500646_0000709_4507_4809 85
49 3300053103 Ga0500555_136848 Ga0500555_136848_111_413 85
50 3300053130 Ga0500642_0458646 Ga0500642_0458646_132_434 85
51 3300053139 Ga0500568_0029148 Ga0500568_0029148_1854_2156 85
52 3300053151 Ga0500604_0007191 Ga0500604_0007191_2580_2882 85
53 3300005290 Ga0065712_10440649 Ga0065712_104406491 86
54 3300005327 Ga0070658_10269124 Ga0070658_102691243 86
55 3300005328 Ga0070676_10004641 Ga0070676_100046418 86
56 3300005329 Ga0070683_100062398 Ga0070683_1000623983 86
57 3300005330 Ga0070690_100043614 Ga0070690_1000436142 86
58 3300005331 Ga0070670_100254643 Ga0070670_1002546432 86
59 3300005334 Ga0068869_100134026 Ga0068869_1001340264 86
60 3300005334 Ga0068869_100159550 Ga0068869_1001595504 86
61 3300005335 Ga0070666_10001230 Ga0070666_1000123014 86
62 3300005338 Ga0068868_100004809 Ga0068868_1000048094 86
63 3300005340 Ga0070689_100007760 Ga0070689_1000077608 86
64 3300005340 Ga0070689_100110142 Ga0070689_1001101423 86
65 3300005343 Ga0070687_100857270 Ga0070687_1008572702 86
66 3300005344 Ga0070661_100519571 Ga0070661_1005195712 86
67 3300005353 Ga0070669_100001757 Ga0070669_1000017577 86
68 3300005353 Ga0070669_101377899 Ga0070669_1013778991 86
69 3300005354 Ga0070675_100007265 Ga0070675_1000072657 86
70 3300005354 Ga0070675_100038922 Ga0070675_1000389222 86
71 3300005354 Ga0070675_100471981 Ga0070675_1004719812 86
72 3300005355 Ga0070671_100046594 Ga0070671_1000465944 86
73 3300005355 Ga0070671_100190312 Ga0070671_1001903122 86
74 3300005355 Ga0070671_101079366 Ga0070671_1010793662 86
75 3300005356 Ga0070674_100031169 Ga0070674_1000311695 86
76 3300005356 Ga0070674_100842464 Ga0070674_1008424642 86
77 3300005364 Ga0070673_100006593 Ga0070673_1000065933 86
78 3300005364 Ga0070673_100330993 Ga0070673_1003309933 86
79 3300005364 Ga0070673_101567873 Ga0070673_1015678731 86
80 3300005365 Ga0070688_100003852 Ga0070688_1000038524 86
81 3300005365 Ga0070688_100094015 Ga0070688_1000940153 86
82 3300005366 Ga0070659_100172176 Ga0070659_1001721762 86
83 3300005366 Ga0070659_100231919 Ga0070659_1002319192 86
84 3300005366 Ga0070659_101832160 Ga0070659_1018321601 86
85 3300005367 Ga0070667_100007565 Ga0070667_1000075658 86
86 3300005367 Ga0070667_101020981 Ga0070667_1010209812 86
87 3300005434 Ga0070709_11042667 Ga0070709_110426671 86
88 3300005435 Ga0070714_100559952 Ga0070714_1005599522 86
89 3300005438 Ga0070701_10255983 Ga0070701_102559832 86
90 3300005440 Ga0070705_101811455 Ga0070705_1018114551 86
91 3300005441 Ga0070700_101555775 Ga0070700_1015557752 86
92 3300005444 Ga0070694_100066381 Ga0070694_1000663812 86
93 3300005445 Ga0070708_100000176 Ga0070708_10000017626 86
94 3300005455 Ga0070663_100110580 Ga0070663_1001105803 86
95 3300005456 Ga0070678_100009598 Ga0070678_1000095986 86
96 3300005459 Ga0068867_100004874 Ga0068867_1000048748 86
97 3300005459 Ga0068867_100435100 Ga0068867_1004351001 86
98 3300005530 Ga0070679_100088432 Ga0070679_1000884323 86
99 3300005530 Ga0070679_101131920 Ga0070679_1011319202 86
100 3300005535 Ga0070684_102294683 Ga0070684_1022946832 86
101 3300005536 Ga0070697_101886844 Ga0070697_1018868441 86
102 3300005539 Ga0068853_100172532 Ga0068853_1001725322 86
103 3300005539 Ga0068853_100742324 Ga0068853_1007423242 86
104 3300005543 Ga0070672_100004907 Ga0070672_1000049078 86
105 3300005543 Ga0070672_100086091 Ga0070672_1000860914 86
106 3300005547 Ga0070693_100737051 Ga0070693_1007370512 86
107 3300005548 Ga0070665_100028490 Ga0070665_1000284905 86
108 3300005548 Ga0070665_101108426 Ga0070665_1011084262 86
109 3300005549 Ga0070704_100697125 Ga0070704_1006971252 86
110 3300005563 Ga0068855_100017343 Ga0068855_1000173434 86
111 3300005564 Ga0070664_100052899 Ga0070664_1000528992 86
112 3300005577 Ga0068857_100150732 Ga0068857_1001507324 86
113 3300005616 Ga0068852_100019402 Ga0068852_1000194027 86
114 3300005617 Ga0068859_100009973 Ga0068859_1000099735 86
115 3300005617 Ga0068859_100150522 Ga0068859_1001505224 86
116 3300005618 Ga0068864_100007408 Ga0068864_1000074084 86
117 3300005719 Ga0068861_100115886 Ga0068861_1001158862 86
118 3300005719 Ga0068861_100470687 Ga0068861_1004706872 86
119 3300005719 Ga0068861_100547588 Ga0068861_1005475883 86
120 3300005719 Ga0068861_102490552 Ga0068861_1024905522 86
121 3300005840 Ga0068870_10009071 Ga0068870_100090714 86
122 3300005840 Ga0068870_10051327 Ga0068870_100513273 86
123 3300005841 Ga0068863_100093698 Ga0068863_1000936985 86
124 3300005842 Ga0068858_100025579 Ga0068858_1000255794 86
125 3300005842 Ga0068858_100396600 Ga0068858_1003966002 86
126 3300005843 Ga0068860_100006112 Ga0068860_1000061129 86
127 3300005843 Ga0068860_100521085 Ga0068860_1005210852 86
128 3300005843 Ga0068860_101936172 Ga0068860_1019361722 86
129 3300006028 Ga0070717_10345772 Ga0070717_103457723 86
130 3300006058 Ga0075432_10111680 Ga0075432_101116803 86
131 3300006163 Ga0070715_10865156 Ga0070715_108651562 86
132 3300006178 Ga0075367_11091498 Ga0075367_110914982 86
133 3300006237 Ga0097621_100003143 Ga0097621_1000031431 86
134 3300006358 Ga0068871_100010536 Ga0068871_1000105364 86
135 3300006358 Ga0068871_101012871 Ga0068871_1010128712 86
136 3300006852 Ga0075433_10055370 Ga0075433_100553703 86
137 3300006881 Ga0068865_100006382 Ga0068865_1000063825 86
138 3300006931 Ga0097620_100009973 Ga0097620_1000099735 86
139 3300006931 Ga0097620_100150522 Ga0097620_1001505224 86
140 3300009093 Ga0105240_10073361 Ga0105240_100733614 86
141 3300009098 Ga0105245_10288760 Ga0105245_102887602 86
142 3300009174 Ga0105241_11158392 Ga0105241_111583922 86
143 3300009177 Ga0105248_10001222 Ga0105248_1000122212 86
144 3300009177 Ga0105248_10716146 Ga0105248_107161463 86
145 3300009177 Ga0105248_11306506 Ga0105248_113065061 86
146 3300009551 Ga0105238_10080184 Ga0105238_100801842 86
147 3300009553 Ga0105249_10338327 Ga0105249_103383272 86
148 3300009553 Ga0105249_10987269 Ga0105249_109872692 86
149 3300013105 Ga0157369_10006741 Ga0157369_1000674110 86
150 3300013296 Ga0157374_10003730 Ga0157374_100037305 86
151 3300013297 Ga0157378_10152831 Ga0157378_101528313 86
152 3300013297 Ga0157378_10909694 Ga0157378_109096942 86
153 3300013297 Ga0157378_12335308 Ga0157378_123353082 86
154 3300013306 Ga0163162_10155174 Ga0163162_101551742 86
155 3300013306 Ga0163162_10543796 Ga0163162_105437962 86
156 3300013306 Ga0163162_10707591 Ga0163162_107075912 86
157 3300013307 Ga0157372_10331504 Ga0157372_103315043 86
158 3300013308 Ga0157375_10092999 Ga0157375_100929993 86
159 3300013308 Ga0157375_10200138 Ga0157375_102001384 86
160 3300014326 Ga0157380_11182038 Ga0157380_111820381 86
161 3300014326 Ga0157380_11551554 Ga0157380_115515542 86
162 3300014745 Ga0157377_10931561 Ga0157377_109315612 86
163 3300014968 Ga0157379_10003011 Ga0157379_100030116 86
164 3300014969 Ga0157376_10175529 Ga0157376_101755292 86
165 3300014969 Ga0157376_11918145 Ga0157376_119181452 86
166 3300021361 Ga0213872_10312706 Ga0213872_103127061 86
167 3300025315 Ga0207697_10007205 Ga0207697_100072054 86
168 3300025899 Ga0207642_10241373 Ga0207642_102413733 86
169 3300025901 Ga0207688_10089483 Ga0207688_100894834 86
170 3300025901 Ga0207688_10173786 Ga0207688_101737862 86
171 3300025903 Ga0207680_10409345 Ga0207680_104093452 86
172 3300025907 Ga0207645_10000867 Ga0207645_100008678 86
173 3300025908 Ga0207643_10557962 Ga0207643_105579622 86
174 3300025909 Ga0207705_10081090 Ga0207705_100810902 86
175 3300025909 Ga0207705_10407838 Ga0207705_104078383 86
176 3300025913 Ga0207695_10183388 Ga0207695_101833882 86
177 3300025916 Ga0207663_11112999 Ga0207663_111129992 86
178 3300025920 Ga0207649_10453604 Ga0207649_104536042 86
179 3300025923 Ga0207681_10034544 Ga0207681_100345444 86
180 3300025923 Ga0207681_11211557 Ga0207681_112115572 86
181 3300025924 Ga0207694_10095613 Ga0207694_100956133 86
182 3300025925 Ga0207650_10011061 Ga0207650_100110613 86
183 3300025926 Ga0207659_10013628 Ga0207659_100136282 86
184 3300025926 Ga0207659_10100244 Ga0207659_101002444 86
185 3300025931 Ga0207644_10081230 Ga0207644_100812304 86
186 3300025931 Ga0207644_10089114 Ga0207644_100891142 86
187 3300025932 Ga0207690_10317504 Ga0207690_103175042 86
188 3300025932 Ga0207690_10432339 Ga0207690_104323392 86
189 3300025933 Ga0207706_10714602 Ga0207706_107146021 86
190 3300025936 Ga0207670_10013294 Ga0207670_100132944 86
191 3300025937 Ga0207669_10046076 Ga0207669_100460764 86
192 3300025940 Ga0207691_10000328 Ga0207691_1000032835 86
193 3300025940 Ga0207691_10010980 Ga0207691_100109806 86
194 3300025941 Ga0207711_10015761 Ga0207711_100157616 86
195 3300025941 Ga0207711_10715892 Ga0207711_107158921 86
196 3300025941 Ga0207711_10847151 Ga0207711_108471511 86
197 3300025942 Ga0207689_10003815 Ga0207689_100038159 86
198 3300025944 Ga0207661_10135413 Ga0207661_101354132 86
199 3300025945 Ga0207679_10046035 Ga0207679_100460352 86
200 3300025949 Ga0207667_10031658 Ga0207667_100316582 86
201 3300025960 Ga0207651_10004469 Ga0207651_100044692 86
202 3300025960 Ga0207651_10068842 Ga0207651_100688423 86
203 3300025961 Ga0207712_10539464 Ga0207712_105394642 86
204 3300025972 Ga0207668_10014932 Ga0207668_100149321 86
205 3300025972 Ga0207668_10029422 Ga0207668_100294222 86
206 3300025986 Ga0207658_10006246 Ga0207658_100062464 86
207 3300025986 Ga0207658_11999601 Ga0207658_119996012 86
208 3300026023 Ga0207677_10118183 Ga0207677_101181833 86
209 3300026035 Ga0207703_10017883 Ga0207703_100178835 86
210 3300026035 Ga0207703_10077338 Ga0207703_100773382 86
211 3300026041 Ga0207639_10128935 Ga0207639_101289352 86
212 3300026041 Ga0207639_10505870 Ga0207639_105058702 86
213 3300026067 Ga0207678_10139321 Ga0207678_101393213 86
214 3300026075 Ga0207708_10242072 Ga0207708_102420722 86
215 3300026075 Ga0207708_10918721 Ga0207708_109187212 86
216 3300026088 Ga0207641_10005581 Ga0207641_1000558111 86
217 3300026089 Ga0207648_10001220 Ga0207648_1000122014 86
218 3300026095 Ga0207676_10051112 Ga0207676_100511121 86
219 3300026095 Ga0207676_10152353 Ga0207676_101523531 86
220 3300026116 Ga0207674_10067479 Ga0207674_100674792 86
221 3300026118 Ga0207675_100021731 Ga0207675_1000217316 86
222 3300026118 Ga0207675_101968851 Ga0207675_1019688512 86
223 3300026118 Ga0207675_102377388 Ga0207675_1023773882 86
224 3300026121 Ga0207683_10000807 Ga0207683_1000080711 86
225 3300026121 Ga0207683_10079818 Ga0207683_100798184 86
226 3300027907 Ga0207428_10393414 Ga0207428_103934141 86
227 3300028381 Ga0268264_10011189 Ga0268264_100111892 86
228 3300028381 Ga0268264_11307719 Ga0268264_113077192 86
229 3300031903 Ga0307407_10199927 Ga0307407_101999273 86
230 3300031911 Ga0307412_10269425 Ga0307412_102694252 86
231 3300031911 Ga0307412_10346995 Ga0307412_103469952 86
232 3300031995 Ga0307409_102428258 Ga0307409_1024282582 86
233 3300032002 Ga0307416_100928746 Ga0307416_1009287462 86
234 3300032126 Ga0307415_100741191 Ga0307415_1007411912 86
235 3300035117 Ga0373953_0297824 Ga0373953_0297824_94_354 86
236 3300035172 Ga0373955_0255228 Ga0373955_0255228_574_834 86
237 3300037471 Ga0395905_0286839 Ga0395905_0286839_661_921 86
238 3300038443 Ga0395901_1259029 Ga0395901_1259029_370_630 86
239 3300039447 Ga0436361_0962106 Ga0436361_0962106_820_1080 86
240 3300041413 Ga0439465_0097522 Ga0439465_0097522_647_910 86
241 3300041463 Ga0451804_0410469 Ga0451804_0410469_252_512 86
242 3300041512 Ga0451853_2798496 Ga0451853_2798496_759_1019 86
243 3300042134 Ga0450898_125407 Ga0450898_125407_69_332 86
244 3300042156 Ga0439446_0376820 Ga0439446_0376820_68_331 86
245 3300046539 Ga0495621_0250034 Ga0495621_0250034_162_422 86
246 3300046663 Ga0495635_0354361 Ga0495635_0354361_22_282 86
247 3300046683 Ga0495658_0488500 Ga0495658_0488500_311_571 86
248 3300046683 Ga0495658_1018286 Ga0495658_1018286_212_472 86
249 3300048904 Ga0496101_1584087 Ga0496101_1584087_202_462 86
250 3300048910 Ga0496107_0155747 Ga0496107_0155747_1283_1543 86
251 3300048911 Ga0496108_1228064 Ga0496108_1228064_22_282 86
252 3300048917 Ga0496114_0857914 Ga0496114_0857914_48_308 86
253 3300048929 Ga0496126_0005752 Ga0496126_0005752_5426_5686 86
254 3300048929 Ga0496126_0036269 Ga0496126_0036269_2033_2293 86
255 3300050494 nmdc:mga06z11_917056_c1 nmdc:mga06z11_917056_c1_239_505 86
256 3300050515 nmdc:mga0a205_66931_c1 nmdc:mga0a205_66931_c1_2458_2718 86
257 3300053084 Ga0495595_0287598 Ga0495595_0287598_539_799 86
258 3300059421 Ga0590071_061993 Ga0590071_061993_149_409 86
259 3300005331 Ga0070670_100128287 Ga0070670_1001282873 87
260 3300005334 Ga0068869_100888967 Ga0068869_1008889671 87
261 3300005335 Ga0070666_10093476 Ga0070666_100934762 87
262 3300005338 Ga0068868_100009230 Ga0068868_1000092304 87
263 3300005344 Ga0070661_100047224 Ga0070661_1000472244 87
264 3300005345 Ga0070692_10105524 Ga0070692_101055242 87
265 3300005353 Ga0070669_100319997 Ga0070669_1003199972 87
266 3300005354 Ga0070675_100018828 Ga0070675_1000188285 87
267 3300005355 Ga0070671_100107065 Ga0070671_1001070654 87
268 3300005367 Ga0070667_100096629 Ga0070667_1000966294 87
269 3300005406 Ga0070703_10624365 Ga0070703_106243652 87
270 3300005444 Ga0070694_100574433 Ga0070694_1005744332 87
271 3300005455 Ga0070663_100294014 Ga0070663_1002940142 87
272 3300005456 Ga0070678_100411185 Ga0070678_1004111852 87
273 3300005457 Ga0070662_100175919 Ga0070662_1001759193 87
274 3300005458 Ga0070681_10009497 Ga0070681_100094976 87
275 3300005530 Ga0070679_100000683 Ga0070679_10000068311 87
276 3300005535 Ga0070684_100105223 Ga0070684_1001052234 87
277 3300005539 Ga0068853_100099418 Ga0068853_1000994181 87
278 3300005539 Ga0068853_100159109 Ga0068853_1001591093 87
279 3300005543 Ga0070672_100113318 Ga0070672_1001133183 87
280 3300005548 Ga0070665_100907261 Ga0070665_1009072612 87
281 3300005549 Ga0070704_100283342 Ga0070704_1002833422 87
282 3300005564 Ga0070664_100259809 Ga0070664_1002598092 87
283 3300005564 Ga0070664_100319236 Ga0070664_1003192362 87
284 3300005578 Ga0068854_100024222 Ga0068854_1000242224 87
285 3300005615 Ga0070702_100597197 Ga0070702_1005971972 87
286 3300005616 Ga0068852_100038154 Ga0068852_1000381543 87
287 3300005617 Ga0068859_100771337 Ga0068859_1007713372 87
288 3300005618 Ga0068864_100035918 Ga0068864_1000359185 87
289 3300005834 Ga0068851_10034148 Ga0068851_100341483 87
290 3300005841 Ga0068863_100315452 Ga0068863_1003154522 87
291 3300005841 Ga0068863_100683562 Ga0068863_1006835622 87
292 3300006237 Ga0097621_100010141 Ga0097621_1000101412 87
293 3300006237 Ga0097621_100020362 Ga0097621_1000203624 87
294 3300006358 Ga0068871_100091440 Ga0068871_1000914405 87
295 3300006358 Ga0068871_100112370 Ga0068871_1001123702 87
296 3300006881 Ga0068865_100722915 Ga0068865_1007229151 87
297 3300006931 Ga0097620_100771184 Ga0097620_1007711842 87
298 3300009098 Ga0105245_10047077 Ga0105245_100470774 87
299 3300009148 Ga0105243_10265943 Ga0105243_102659432 87
300 3300009177 Ga0105248_10168778 Ga0105248_101687782 87
301 3300009177 Ga0105248_10418119 Ga0105248_104181192 87
302 3300009553 Ga0105249_13560933 Ga0105249_135609332 87
303 3300009553 Ga0105249_13584910 Ga0105249_135849101 87
304 3300013100 Ga0157373_10006331 Ga0157373_100063314 87
305 3300013102 Ga0157371_10785278 Ga0157371_107852782 87
306 3300013104 Ga0157370_10002179 Ga0157370_100021794 87
307 3300013104 Ga0157370_10055513 Ga0157370_100555135 87
308 3300013104 Ga0157370_10225326 Ga0157370_102253262 87
309 3300013296 Ga0157374_10017807 Ga0157374_100178076 87
310 3300013296 Ga0157374_10072948 Ga0157374_100729483 87
311 3300013297 Ga0157378_10149202 Ga0157378_101492023 87
312 3300013306 Ga0163162_10053479 Ga0163162_100534792 87
313 3300013306 Ga0163162_10812500 Ga0163162_108125002 87
314 3300013307 Ga0157372_10039797 Ga0157372_100397973 87
315 3300013307 Ga0157372_10165010 Ga0157372_101650102 87
316 3300013308 Ga0157375_10015066 Ga0157375_100150666 87
317 3300013308 Ga0157375_10135338 Ga0157375_101353383 87
318 3300014497 Ga0182008_10217977 Ga0182008_102179772 87
319 3300014968 Ga0157379_10046158 Ga0157379_100461584 87
320 3300014969 Ga0157376_10409600 Ga0157376_104096002 87
321 3300025912 Ga0207707_10002721 Ga0207707_100027219 87
322 3300025920 Ga0207649_11024048 Ga0207649_110240482 87
323 3300025921 Ga0207652_10000882 Ga0207652_1000088221 87
324 3300025934 Ga0207686_10083788 Ga0207686_100837882 87
325 3300025935 Ga0207709_10488234 Ga0207709_104882343 87
326 3300025938 Ga0207704_10252442 Ga0207704_102524423 87
327 3300025941 Ga0207711_10026765 Ga0207711_100267652 87
328 3300025941 Ga0207711_10172502 Ga0207711_101725022 87
329 3300025945 Ga0207679_10226757 Ga0207679_102267573 87
330 3300025961 Ga0207712_10679884 Ga0207712_106798841 87
331 3300026035 Ga0207703_10173499 Ga0207703_101734992 87
332 3300026041 Ga0207639_10061090 Ga0207639_100610904 87
333 3300026067 Ga0207678_10962332 Ga0207678_109623321 87
334 3300026088 Ga0207641_10515446 Ga0207641_105154462 87
335 3300026116 Ga0207674_10078312 Ga0207674_100783123 87
336 3300035086 Ga0373934_0191341 Ga0373934_0191341_349_612 87
337 3300035120 Ga0373957_0030941 Ga0373957_0030941_549_812 87
338 3300035172 Ga0373955_0128794 Ga0373955_0128794_274_537 87
339 3300035692 Ga0373935_0077542 Ga0373935_0077542_613_876 87
340 3300042001 Ga0439441_176034 Ga0439441_176034_15_278 87
341 3300044656 Ga0466969_0029420 Ga0466969_0029420_1312_1635 87
342 3300044668 Ga0466980_0259552 Ga0466980_0259552_281_604 87
343 3300044684 Ga0466966_0026828 Ga0466966_0026828_2012_2335 87
344 3300044684 Ga0466966_0218177 Ga0466966_0218177_368_631 87
345 3300044693 Ga0466961_0054494 Ga0466961_0054494_1334_1657 87
346 3300044693 Ga0466961_0341621 Ga0466961_0341621_627_890 87
347 3300044712 Ga0453684_0779249 Ga0453684_0779249_474_737 87
348 3300044765 Ga0466970_0226356 Ga0466970_0226356_142_465 87
349 3300044842 Ga0466957_0031256 Ga0466957_0031256_2309_2572 87
350 3300045049 Ga0466959_0012017 Ga0466959_0012017_3912_4235 87
351 3300045836 Ga0466958_0432522 Ga0466958_0432522_504_767 87
352 3300046454 Ga0495592_0305150 Ga0495592_0305150_681_944 87
353 3300046462 Ga0495651_0070347 Ga0495651_0070347_372_635 87
354 3300046511 Ga0495608_0013310 Ga0495608_0013310_5147_5410 87
355 3300046516 Ga0495628_0070524 Ga0495628_0070524_765_1028 87
356 3300046536 Ga0495587_0175271 Ga0495587_0175271_119_382 87
357 3300046559 Ga0495667_0090853 Ga0495667_0090853_1041_1304 87
358 3300046675 Ga0495657_0441877 Ga0495657_0441877_241_504 87
359 3300046679 Ga0495623_0032712 Ga0495623_0032712_1569_1832 87
360 3300046809 Ga0495600_0275561 Ga0495600_0275561_168_431 87
361 3300047471 Ga0495684_0191930 Ga0495684_0191930_578_841 87
362 3300048088 Ga0495602_0227371 Ga0495602_0227371_319_582 87
363 3300049744 Ga0501083_0015423 Ga0501083_0015423_4466_4729 87
364 3300053077 Ga0495601_0116042 Ga0495601_0116042_474_737 87
365 3300053084 Ga0495595_0168288 Ga0495595_0168288_69_332 87
366 3300053085 Ga0495619_0012027 Ga0495619_0012027_176_439 87
367 3300053085 Ga0495619_0272528 Ga0495619_0272528_65_328 87
368 3300061719 Ga0466962_0571458 Ga0466962_0571458_293_556 87
369 3300005327 Ga0070658_10120193 Ga0070658_101201932 88
370 3300005327 Ga0070658_10585171 Ga0070658_105851712 88
371 3300005328 Ga0070676_10140447 Ga0070676_101404472 88
372 3300005328 Ga0070676_10423591 Ga0070676_104235912 88
373 3300005331 Ga0070670_100333836 Ga0070670_1003338361 88
374 3300005338 Ga0068868_100772308 Ga0068868_1007723081 88
375 3300005339 Ga0070660_100002471 Ga0070660_1000024716 88
376 3300005339 Ga0070660_100604638 Ga0070660_1006046382 88
377 3300005344 Ga0070661_100009775 Ga0070661_1000097752 88
378 3300005353 Ga0070669_100108367 Ga0070669_1001083674 88
379 3300005354 Ga0070675_100088072 Ga0070675_1000880722 88
380 3300005355 Ga0070671_100003687 Ga0070671_1000036875 88
381 3300005364 Ga0070673_101151183 Ga0070673_1011511831 88
382 3300005366 Ga0070659_100015059 Ga0070659_1000150592 88
383 3300005366 Ga0070659_100252883 Ga0070659_1002528832 88
384 3300005366 Ga0070659_100376300 Ga0070659_1003763002 88
385 3300005367 Ga0070667_100147172 Ga0070667_1001471724 88
386 3300005455 Ga0070663_100017475 Ga0070663_1000174756 88
387 3300005455 Ga0070663_101735025 Ga0070663_1017350252 88
388 3300005457 Ga0070662_100000258 Ga0070662_10000025817 88
389 3300005457 Ga0070662_101970907 Ga0070662_1019709071 88
390 3300005458 Ga0070681_10363007 Ga0070681_103630072 88
391 3300005530 Ga0070679_101224906 Ga0070679_1012249061 88
392 3300005539 Ga0068853_100015034 Ga0068853_1000150342 88
393 3300005539 Ga0068853_101916189 Ga0068853_1019161892 88
394 3300005563 Ga0068855_100004105 Ga0068855_10000410514 88
395 3300005563 Ga0068855_100214285 Ga0068855_1002142852 88
396 3300005563 Ga0068855_100646092 Ga0068855_1006460922 88
397 3300005563 Ga0068855_101094096 Ga0068855_1010940962 88
398 3300005564 Ga0070664_100000205 Ga0070664_10000020527 88
399 3300005564 Ga0070664_100030140 Ga0070664_1000301403 88
400 3300005577 Ga0068857_101216951 Ga0068857_1012169512 88
401 3300005578 Ga0068854_100110870 Ga0068854_1001108702 88
402 3300005614 Ga0068856_100000487 Ga0068856_10000048731 88
403 3300005614 Ga0068856_100292509 Ga0068856_1002925092 88
404 3300005616 Ga0068852_100081928 Ga0068852_1000819282 88
405 3300005616 Ga0068852_100275693 Ga0068852_1002756933 88
406 3300005616 Ga0068852_101371654 Ga0068852_1013716542 88
407 3300005841 Ga0068863_101340471 Ga0068863_1013404711 88
408 3300006237 Ga0097621_100623117 Ga0097621_1006231172 88
409 3300006358 Ga0068871_100393557 Ga0068871_1003935572 88
410 3300009174 Ga0105241_11783467 Ga0105241_117834671 88
411 3300013100 Ga0157373_10003392 Ga0157373_100033922 88
412 3300013102 Ga0157371_10000365 Ga0157371_1000036535 88
413 3300013104 Ga0157370_10672044 Ga0157370_106720442 88
414 3300013105 Ga0157369_10019036 Ga0157369_100190362 88
415 3300013105 Ga0157369_10442735 Ga0157369_104427352 88
416 3300013296 Ga0157374_10256674 Ga0157374_102566744 88
417 3300013297 Ga0157378_10344976 Ga0157378_103449762 88
418 3300013307 Ga0157372_10025043 Ga0157372_100250432 88
419 3300013307 Ga0157372_10996673 Ga0157372_109966732 88
420 3300013307 Ga0157372_12807186 Ga0157372_128071861 88
421 3300014969 Ga0157376_10366566 Ga0157376_103665662 88
422 3300025904 Ga0207647_10318264 Ga0207647_103182642 88
423 3300025907 Ga0207645_10013883 Ga0207645_100138834 88
424 3300025907 Ga0207645_10125489 Ga0207645_101254893 88
425 3300025909 Ga0207705_10074796 Ga0207705_100747962 88
426 3300025917 Ga0207660_10562897 Ga0207660_105628972 88
427 3300025919 Ga0207657_10000967 Ga0207657_1000096730 88
428 3300025920 Ga0207649_10159379 Ga0207649_101593792 88
429 3300025923 Ga0207681_10048752 Ga0207681_100487524 88
430 3300025926 Ga0207659_10291320 Ga0207659_102913202 88
431 3300025929 Ga0207664_10822441 Ga0207664_108224412 88
432 3300025931 Ga0207644_10013484 Ga0207644_100134844 88
433 3300025932 Ga0207690_10000438 Ga0207690_1000043824 88
434 3300025933 Ga0207706_10000024 Ga0207706_10000024130 88
435 3300025940 Ga0207691_10039517 Ga0207691_100395172 88
436 3300025942 Ga0207689_10665233 Ga0207689_106652332 88
437 3300025945 Ga0207679_10001794 Ga0207679_1000179415 88
438 3300025945 Ga0207679_11085493 Ga0207679_110854932 88
439 3300025949 Ga0207667_10002406 Ga0207667_100024063 88
440 3300025949 Ga0207667_10473498 Ga0207667_104734981 88
441 3300025949 Ga0207667_10483639 Ga0207667_104836392 88
442 3300025960 Ga0207651_10205844 Ga0207651_102058443 88
443 3300025981 Ga0207640_10050956 Ga0207640_100509562 88
444 3300025981 Ga0207640_10365750 Ga0207640_103657502 88
445 3300025986 Ga0207658_10086633 Ga0207658_100866332 88
446 3300026023 Ga0207677_11480381 Ga0207677_114803812 88
447 3300026041 Ga0207639_10034366 Ga0207639_100343663 88
448 3300026067 Ga0207678_10017556 Ga0207678_100175567 88
449 3300026078 Ga0207702_10007209 Ga0207702_100072096 88
450 3300026088 Ga0207641_10140326 Ga0207641_101403262 88
451 3300026118 Ga0207675_101984349 Ga0207675_1019843492 88
452 3300026142 Ga0207698_10017978 Ga0207698_100179782 88
453 3300027876 Ga0209974_10013052 Ga0209974_100130524 88
454 3300031548 Ga0307408_100012040 Ga0307408_1000120404 88
455 3300031712 Ga0265342_10242554 Ga0265342_102425541 88
456 3300031731 Ga0307405_10009517 Ga0307405_100095172 88
457 3300031824 Ga0307413_10006886 Ga0307413_100068864 88
458 3300031824 Ga0307413_11927412 Ga0307413_119274122 88
459 3300031852 Ga0307410_10006796 Ga0307410_100067962 88
460 3300031901 Ga0307406_10001453 Ga0307406_1000145310 88
461 3300031903 Ga0307407_10006443 Ga0307407_100064435 88
462 3300031911 Ga0307412_10022460 Ga0307412_100224604 88
463 3300031995 Ga0307409_100013622 Ga0307409_1000136222 88
464 3300031995 Ga0307409_100204427 Ga0307409_1002044274 88
465 3300032002 Ga0307416_100006433 Ga0307416_1000064332 88
466 3300032004 Ga0307414_10137857 Ga0307414_101378574 88
467 3300032005 Ga0307411_10000456 Ga0307411_1000045611 88
468 3300032126 Ga0307415_100080891 Ga0307415_1000808913 88
469 3300035241 Ga0373961_0157475 Ga0373961_0157475_254_520 88
470 3300038996 Ga0242420_076421 Ga0242420_076421_83_349 88
471 3300042133 Ga0450896_004241 Ga0450896_004241_1215_1481 88
472 3300042437 Ga0439444_0078373 Ga0439444_0078373_315_581 88
473 3300042876 Ga0451577_0183458 Ga0451577_0183458_850_1116 88
474 3300044673 Ga0453683_0520212 Ga0453683_0520212_39_305 88
475 3300048905 Ga0496102_0031073 Ga0496102_0031073_4161_4427 88
476 3300048906 Ga0496103_0010672 Ga0496103_0010672_2070_2336 88
477 3300048909 Ga0496106_0043122 Ga0496106_0043122_986_1252 88
478 3300048910 Ga0496107_0002463 Ga0496107_0002463_4576_4842 88
479 3300048912 Ga0496109_1183987 Ga0496109_1183987_385_651 88
480 3300048913 Ga0496110_1410153 Ga0496110_1410153_272_538 88
481 3300048915 Ga0496112_1305975 Ga0496112_1305975_286_552 88
482 3300049571 Ga0501034_0014114 Ga0501034_0014114_5781_6047 88
483 3300049571 Ga0501034_0387494 Ga0501034_0387494_673_939 88
484 3300049580 Ga0501046_0274123 Ga0501046_0274123_132_398 88
485 3300049581 Ga0501047_0004566 Ga0501047_0004566_8202_8468 88
486 3300049581 Ga0501047_0023350 Ga0501047_0023350_2724_2990 88
487 3300049581 Ga0501047_0485179 Ga0501047_0485179_86_352 88
488 3300049581 Ga0501047_0565800 Ga0501047_0565800_677_943 88
489 3300049582 Ga0501048_0658102 Ga0501048_0658102_353_619 88
490 3300049583 Ga0501067_0003639 Ga0501067_0003639_3356_3622 88
491 3300049583 Ga0501067_0103722 Ga0501067_0103722_243_509 88
492 3300049584 Ga0501068_0007747 Ga0501068_0007747_4617_4883 88
493 3300049585 Ga0501069_0007681 Ga0501069_0007681_4617_4883 88
494 3300049585 Ga0501069_0136668 Ga0501069_0136668_762_1028 88
495 3300049586 Ga0501070_0005698 Ga0501070_0005698_4695_4961 88
496 3300049586 Ga0501070_0132421 Ga0501070_0132421_897_1163 88
497 3300049588 Ga0501072_0012097 Ga0501072_0012097_1167_1433 88
498 3300049589 Ga0501073_0002490 Ga0501073_0002490_8647_8913 88
499 3300049589 Ga0501073_0009577 Ga0501073_0009577_5626_5892 88
500 3300049590 Ga0501074_0001555 Ga0501074_0001555_4838_5104 88
501 3300049590 Ga0501074_0019444 Ga0501074_0019444_2833_3099 88
502 3300049593 Ga0501077_1033310 Ga0501077_1033310_147_413 88
503 3300049741 Ga0501079_0011145 Ga0501079_0011145_5518_5784 88
504 3300049741 Ga0501079_0867276 Ga0501079_0867276_43_309 88
505 3300049742 Ga0501080_0016096 Ga0501080_0016096_3443_3709 88
506 3300049742 Ga0501080_0024511 Ga0501080_0024511_1070_1336 88
507 3300049742 Ga0501080_0039895 Ga0501080_0039895_3151_3417 88
508 3300049742 Ga0501080_0188975 Ga0501080_0188975_1207_1473 88
509 3300049744 Ga0501083_0003639 Ga0501083_0003639_3852_4118 88
510 3300049744 Ga0501083_0055475 Ga0501083_0055475_886_1152 88
511 3300049822 Ga0501035_0181555 Ga0501035_0181555_1099_1365 88
512 3300049822 Ga0501035_0192526 Ga0501035_0192526_1184_1450 88
513 3300049822 Ga0501035_0541592 Ga0501035_0541592_419_685 88
514 3300049823 Ga0501044_0088928 Ga0501044_0088928_1551_1817 88
515 3300054114 Ga0501084_0061508 Ga0501084_0061508_1807_2073 88
516 3300060353 Ga0501082_0030848 Ga0501082_0030848_4211_4477 88
517 3300060353 Ga0501082_0056471 Ga0501082_0056471_2715_2981 88
518 3300005328 Ga0070676_10063927 Ga0070676_100639272 89
519 3300005331 Ga0070670_100017326 Ga0070670_1000173268 89
520 3300005334 Ga0068869_100007461 Ga0068869_1000074616 89
521 3300005335 Ga0070666_10420425 Ga0070666_104204251 89
522 3300005338 Ga0068868_100027870 Ga0068868_1000278702 89
523 3300005340 Ga0070689_100126550 Ga0070689_1001265501 89
524 3300005347 Ga0070668_100110996 Ga0070668_1001109962 89
525 3300005353 Ga0070669_100012988 Ga0070669_1000129887 89
526 3300005364 Ga0070673_100012953 Ga0070673_1000129533 89
527 3300005365 Ga0070688_100118034 Ga0070688_1001180342 89
528 3300005367 Ga0070667_100000716 Ga0070667_10000071624 89
529 3300005440 Ga0070705_100032030 Ga0070705_1000320302 89
530 3300005456 Ga0070678_100301934 Ga0070678_1003019343 89
531 3300005457 Ga0070662_100195724 Ga0070662_1001957242 89
532 3300005459 Ga0068867_100002291 Ga0068867_1000022913 89
533 3300005543 Ga0070672_100018279 Ga0070672_1000182792 89
534 3300005549 Ga0070704_100486918 Ga0070704_1004869181 89
535 3300005577 Ga0068857_100024151 Ga0068857_1000241512 89
536 3300005616 Ga0068852_101635288 Ga0068852_1016352882 89
537 3300005617 Ga0068859_100000638 Ga0068859_10000063823 89
538 3300005618 Ga0068864_100002774 Ga0068864_10000277415 89
539 3300005718 Ga0068866_10459742 Ga0068866_104597422 89
540 3300005719 Ga0068861_100001272 Ga0068861_1000012723 89
541 3300005840 Ga0068870_10011654 Ga0068870_100116544 89
542 3300005842 Ga0068858_100028541 Ga0068858_1000285417 89
543 3300005843 Ga0068860_100003943 Ga0068860_1000039433 89
544 3300005844 Ga0068862_100004934 Ga0068862_1000049343 89
545 3300006852 Ga0075433_10493006 Ga0075433_104930062 89
546 3300006852 Ga0075433_11615795 Ga0075433_116157951 89
547 3300006881 Ga0068865_100206659 Ga0068865_1002066592 89
548 3300006931 Ga0097620_100000638 Ga0097620_10000063823 89
549 3300009011 Ga0105251_10231531 Ga0105251_102315312 89
550 3300009098 Ga0105245_11414059 Ga0105245_114140592 89
551 3300009101 Ga0105247_10503076 Ga0105247_105030762 89
552 3300009177 Ga0105248_10022056 Ga0105248_100220563 89
553 3300010375 Ga0105239_11372543 Ga0105239_113725432 89
554 3300011119 Ga0105246_11238289 Ga0105246_112382891 89
555 3300013100 Ga0157373_10110230 Ga0157373_101102303 89
556 3300013297 Ga0157378_10023467 Ga0157378_100234674 89
557 3300013306 Ga0163162_10837554 Ga0163162_108375542 89
558 3300013307 Ga0157372_10771443 Ga0157372_107714431 89
559 3300014325 Ga0163163_10005582 Ga0163163_100055825 89
560 3300014968 Ga0157379_10001432 Ga0157379_100014323 89
561 3300025735 Ga0207713_1212763 Ga0207713_12127632 89
562 3300025899 Ga0207642_10057739 Ga0207642_100577392 89
563 3300025900 Ga0207710_10236747 Ga0207710_102367472 89
564 3300025907 Ga0207645_10552458 Ga0207645_105524582 89
565 3300025908 Ga0207643_10036956 Ga0207643_100369562 89
566 3300025911 Ga0207654_10691308 Ga0207654_106913082 89
567 3300025919 Ga0207657_10494951 Ga0207657_104949512 89
568 3300025923 Ga0207681_10020008 Ga0207681_100200082 89
569 3300025925 Ga0207650_10010149 Ga0207650_100101493 89
570 3300025933 Ga0207706_10226861 Ga0207706_102268612 89
571 3300025938 Ga0207704_10117960 Ga0207704_101179602 89
572 3300025940 Ga0207691_10028115 Ga0207691_100281152 89
573 3300025941 Ga0207711_10043445 Ga0207711_100434452 89
574 3300025942 Ga0207689_10000978 Ga0207689_100009788 89
575 3300025949 Ga0207667_10100540 Ga0207667_101005402 89
576 3300025949 Ga0207667_11288131 Ga0207667_112881311 89
577 3300025960 Ga0207651_10017821 Ga0207651_100178213 89
578 3300025972 Ga0207668_10037570 Ga0207668_100375702 89
579 3300025986 Ga0207658_10026736 Ga0207658_100267364 89
580 3300026023 Ga0207677_10039527 Ga0207677_100395272 89
581 3300026035 Ga0207703_10011529 Ga0207703_100115296 89
582 3300026088 Ga0207641_10009917 Ga0207641_100099173 89
583 3300026089 Ga0207648_10000726 Ga0207648_100007263 89
584 3300026095 Ga0207676_10003141 Ga0207676_100031411 89
585 3300026116 Ga0207674_10028559 Ga0207674_100285596 89
586 3300026118 Ga0207675_100001344 Ga0207675_1000013443 89
587 3300026121 Ga0207683_10339286 Ga0207683_103392863 89
588 3300026142 Ga0207698_11153052 Ga0207698_111530522 89
589 3300028380 Ga0268265_10033997 Ga0268265_100339974 89
590 3300028381 Ga0268264_10009963 Ga0268264_100099633 89
591 3300035691 Ga0373931_0189560 Ga0373931_0189560_63_332 89
592 3300042876 Ga0451577_0437630 Ga0451577_0437630_58_327 89
593 3300044712 Ga0453684_0397304 Ga0453684_0397304_884_1153 89
594 3300045051 Ga0451576_0427578 Ga0451576_0427578_142_411 89
595 3300048905 Ga0496102_0019973 Ga0496102_0019973_779_1048 89
596 3300048909 Ga0496106_0503832 Ga0496106_0503832_72_341 89
597 3300048909 Ga0496106_0965233 Ga0496106_0965233_37_306 89
598 3300048911 Ga0496108_0092966 Ga0496108_0092966_1672_1941 89
599 3300048913 Ga0496110_1841710 Ga0496110_1841710_114_383 89
600 3300049571 Ga0501034_0070809 Ga0501034_0070809_206_475 89
601 3300050514 nmdc:mga08x19_424194_c1 nmdc:mga08x19_424194_c1_547_816 89
602 3300005335 Ga0070666_10019652 Ga0070666_100196523 90
603 3300005355 Ga0070671_100410893 Ga0070671_1004108933 90
604 3300005364 Ga0070673_100001191 Ga0070673_1000011914 90
605 3300005366 Ga0070659_101745808 Ga0070659_1017458082 90
606 3300005457 Ga0070662_100558390 Ga0070662_1005583902 90
607 3300005543 Ga0070672_100174893 Ga0070672_1001748931 90
608 3300005617 Ga0068859_100489877 Ga0068859_1004898772 90
609 3300005719 Ga0068861_100697871 Ga0068861_1006978712 90
610 3300005834 Ga0068851_10847701 Ga0068851_108477011 90
611 3300005841 Ga0068863_100973243 Ga0068863_1009732431 90
612 3300005841 Ga0068863_101283340 Ga0068863_1012833402 90
613 3300005842 Ga0068858_100426940 Ga0068858_1004269402 90
614 3300006931 Ga0097620_100489901 Ga0097620_1004899012 90
615 3300009098 Ga0105245_11786626 Ga0105245_117866262 90
616 3300009177 Ga0105248_10090985 Ga0105248_100909855 90
617 3300009177 Ga0105248_10820765 Ga0105248_108207652 90
618 3300009551 Ga0105238_12664283 Ga0105238_126642832 90
619 3300013306 Ga0163162_11199103 Ga0163162_111991031 90
620 3300013308 Ga0157375_10011973 Ga0157375_100119733 90
621 3300025321 Ga0207656_10473145 Ga0207656_104731451 90
622 3300025931 Ga0207644_10039263 Ga0207644_100392634 90
623 3300025932 Ga0207690_11185349 Ga0207690_111853492 90
624 3300025933 Ga0207706_10085073 Ga0207706_100850732 90
625 3300025940 Ga0207691_10179539 Ga0207691_101795393 90
626 3300025960 Ga0207651_10380903 Ga0207651_103809033 90
627 3300025986 Ga0207658_10363691 Ga0207658_103636911 90
628 3300026035 Ga0207703_10239466 Ga0207703_102394662 90
629 3300026088 Ga0207641_10875119 Ga0207641_108751192 90
630 3300026118 Ga0207675_100198307 Ga0207675_1001983072 90
631 3300026142 Ga0207698_10068036 Ga0207698_100680364 90
632 3300028379 Ga0268266_11562769 Ga0268266_115627692 90
633 3300041494 Ga0451837_1437381 Ga0451837_1437381_253_525 90
634 3300048903 Ga0496100_0387926 Ga0496100_0387926_546_818 90
635 3300048904 Ga0496101_0821129 Ga0496101_0821129_81_353 90
636 3300048905 Ga0496102_0566374 Ga0496102_0566374_195_467 90
637 3300048909 Ga0496106_0042223 Ga0496106_0042223_665_937 90
638 3300048911 Ga0496108_0257919 Ga0496108_0257919_371_643 90
639 3300048912 Ga0496109_1221697 Ga0496109_1221697_133_405 90
640 3300048913 Ga0496110_0510561 Ga0496110_0510561_535_807 90
641 3300005347 Ga0070668_101975705 Ga0070668_1019757051 91
642 3300006353 Ga0075370_10000886 Ga0075370_1000088615 91
643 3300017792 Ga0163161_11387878 Ga0163161_113878781 91
644 3300027395 Ga0209996_1026298 Ga0209996_10262981 91
645 3300027471 Ga0209995_1002494 Ga0209995_10024942 91
646 3300027526 Ga0209968_1088468 Ga0209968_10884681 91
647 3300027543 Ga0209999_1009637 Ga0209999_10096372 91
648 3300027614 Ga0209970_1020437 Ga0209970_10204371 91
649 3300027695 Ga0209966_1006452 Ga0209966_10064522 91
650 3300027876 Ga0209974_10000041 Ga0209974_1000004115 91
651 3300050496 nmdc:mga07m45_257_c1 nmdc:mga07m45_257_c1_20101_20391 91
652 3300026142 Ga0207698_10658000 Ga0207698_106580002 92
653 3300025949 Ga0207667_10332986 Ga0207667_103329862 93
654 3300037418 Ga0395900_0358506 Ga0395900_0358506_318_599 93
655 3300037471 Ga0395905_0029632 Ga0395905_0029632_319_600 93
656 3300038443 Ga0395901_0082541 Ga0395901_0082541_1790_2071 93
657 3300044683 Ga0466965_0086054 Ga0466965_0086054_1096_1380 94
658 3300044719 Ga0466971_0203093 Ga0466971_0203093_313_597 94
659 3300044842 Ga0466957_0452812 Ga0466957_0452812_355_639 94
660 3300061719 Ga0466962_0634592 Ga0466962_0634592_26_310 94
661 3300005344 Ga0070661_101872498 Ga0070661_1018724981 95
662 3300005614 Ga0068856_100124311 Ga0068856_1001243113 95
663 3300013100 Ga0157373_11192806 Ga0157373_111928062 95
664 3300025920 Ga0207649_10525075 Ga0207649_105250752 95
665 3300026078 Ga0207702_10167053 Ga0207702_101670532 95
666 3300003323 rootH1_10003280 rootH1_100032803 101
667 3300002738 JGI25154J39366_1000759 JGI25154J39366_100075916 102
668 3300002741 JGI25157J39369_1000008 JGI25157J39369_1000008117 102
669 3300005329 Ga0070683_100188343 Ga0070683_1001883432 102
670 3300005330 Ga0070690_100096629 Ga0070690_1000966293 102
671 3300005334 Ga0068869_100719307 Ga0068869_1007193071 102
672 3300005338 Ga0068868_100776305 Ga0068868_1007763052 102
673 3300005339 Ga0070660_100230916 Ga0070660_1002309162 102
674 3300005340 Ga0070689_100122599 Ga0070689_1001225992 102
675 3300005456 Ga0070678_101666321 Ga0070678_1016663211 102
676 3300005577 Ga0068857_100004942 Ga0068857_10000494210 102
677 3300005614 Ga0068856_100014860 Ga0068856_1000148608 102
678 3300005616 Ga0068852_100127927 Ga0068852_1001279272 102
679 3300005843 Ga0068860_100951762 Ga0068860_1009517622 102
680 3300006358 Ga0068871_101144036 Ga0068871_1011440362 102
681 3300009093 Ga0105240_10294319 Ga0105240_102943192 102
682 3300009174 Ga0105241_10027331 Ga0105241_100273315 102
683 3300009176 Ga0105242_10821436 Ga0105242_108214361 102
684 3300009545 Ga0105237_10067353 Ga0105237_100673534 102
685 3300009551 Ga0105238_10217803 Ga0105238_102178032 102
686 3300010375 Ga0105239_10477713 Ga0105239_104777132 102
687 3300011119 Ga0105246_10302173 Ga0105246_103021732 102
688 3300013105 Ga0157369_10096857 Ga0157369_100968574 102
689 3300013297 Ga0157378_10554362 Ga0157378_105543622 102
690 3300013307 Ga0157372_10977766 Ga0157372_109777662 102
691 3300013308 Ga0157375_10610952 Ga0157375_106109522 102
692 3300014325 Ga0163163_10909109 Ga0163163_109091091 102
693 3300014969 Ga0157376_10579486 Ga0157376_105794861 102
694 3300025246 Ga0209646_1000039 Ga0209646_1000039140 102
695 3300025250 Ga0209026_1000006 Ga0209026_1000006461 102
696 3300025253 Ga0209677_100914 Ga0209677_1009143 102
697 3300025256 Ga0209759_1000020 Ga0209759_1000020116 102
698 3300025911 Ga0207654_10119050 Ga0207654_101190502 102
699 3300025913 Ga0207695_10104184 Ga0207695_101041843 102
700 3300025914 Ga0207671_10032764 Ga0207671_100327642 102
701 3300025919 Ga0207657_10066809 Ga0207657_100668093 102
702 3300025924 Ga0207694_11224054 Ga0207694_112240541 102
703 3300025934 Ga0207686_10414787 Ga0207686_104147871 102
704 3300025936 Ga0207670_10380942 Ga0207670_103809422 102
705 3300025942 Ga0207689_10110096 Ga0207689_101100963 102
706 3300025944 Ga0207661_10129937 Ga0207661_101299373 102
707 3300025949 Ga0207667_10174500 Ga0207667_101745003 102
708 3300026078 Ga0207702_10000310 Ga0207702_1000031047 102
709 3300026088 Ga0207641_10943063 Ga0207641_109430631 102
710 3300026116 Ga0207674_10080603 Ga0207674_100806033 102
711 3300026118 Ga0207675_100088142 Ga0207675_1000881424 102
712 3300026121 Ga0207683_11283609 Ga0207683_112836092 102
713 3300026142 Ga0207698_10350955 Ga0207698_103509552 102
714 3300037471 Ga0395905_0396436 Ga0395905_0396436_642_950 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

22

44

0.94

PF12838

Fer4_7

4Fe-4S dicluster domain

27

77

0.91

Feature Viewer

pLDDT pTM Quality
64.33 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map