F476958
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 288 | 715 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0029420|Ga0466969_0029420_1312_1635 |
| Length | 107 |
| Sequence | MPQPAAGPRLFPLKFLVKSMALMITDECINCDVCEPECPNDAIAMGQEIYVIDPSKCTECVGHFDEPQCRQVCPVDCIPINPEHVETRDQLLAKYRALQEHKEGSGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 2 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 210 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 211 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 212 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 213 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 281 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 282 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 283 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 284 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 3.36 |
| Rhizosphere | 93.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000759 | 3300002738 | Bacteria | 14362 |
| 2 | JGI25157J39369_1000008 | 3300002741 | Bacteria | 211083 |
| 3 | rootH1_10003280 | 3300003316 | Bacteria | 2631 |
| 4 | rootH1_10003280 | 3300003323 | Bacteria | 3148 |
| 5 | Ga0065712_10440649 | 3300005290 | Bacteria | 694 |
| 6 | Ga0070658_10120193 | 3300005327 | Bacteria | 2183 |
| 7 | Ga0070658_10269124 | 3300005327 | Bacteria | 1449 |
| 8 | Ga0070658_10585171 | 3300005327 | Bacteria | 967 |
| 9 | Ga0070676_10004641 | 3300005328 | Bacteria | 7256 |
| 10 | Ga0070676_10063927 | 3300005328 | Bacteria | 2193 |
| 11 | Ga0070676_10140447 | 3300005328 | Bacteria | 1537 |
| 12 | Ga0070676_10423591 | 3300005328 | Bacteria | 931 |
| 13 | Ga0070683_100062398 | 3300005329 | Bacteria | 3466 |
| 14 | Ga0070683_100144385 | 3300005329 | Bacteria | 2255 |
| 15 | Ga0070683_100188343 | 3300005329 | Bacteria | 1959 |
| 16 | Ga0070690_100043614 | 3300005330 | Bacteria | 2845 |
| 17 | Ga0070690_100096629 | 3300005330 | Bacteria | 1953 |
| 18 | Ga0070670_100017326 | 3300005331 | Bacteria | 6178 |
| 19 | Ga0070670_100128287 | 3300005331 | Bacteria | 2189 |
| 20 | Ga0070670_100147629 | 3300005331 | Bacteria | 2035 |
| 21 | Ga0070670_100254643 | 3300005331 | Bacteria | 1530 |
| 22 | Ga0070670_100333836 | 3300005331 | Bacteria | 1330 |
| 23 | Ga0068869_100007461 | 3300005334 | Bacteria | 6994 |
| 24 | Ga0068869_100134026 | 3300005334 | Bacteria | 1907 |
| 25 | Ga0068869_100159550 | 3300005334 | Bacteria | 1754 |
| 26 | Ga0068869_100719307 | 3300005334 | Bacteria | 853 |
| 27 | Ga0068869_100888967 | 3300005334 | Bacteria | 770 |
| 28 | Ga0068869_101524698 | 3300005334 | Bacteria | 594 |
| 29 | Ga0070666_10001230 | 3300005335 | Bacteria | 15468 |
| 30 | Ga0070666_10019652 | 3300005335 | Bacteria | 4365 |
| 31 | Ga0070666_10093476 | 3300005335 | Bacteria | 2068 |
| 32 | Ga0070666_10420425 | 3300005335 | Bacteria | 963 |
| 33 | Ga0070680_100091698 | 3300005336 | Bacteria | 2515 |
| 34 | Ga0068868_100004809 | 3300005338 | Bacteria | 9477 |
| 35 | Ga0068868_100009230 | 3300005338 | Bacteria | 7089 |
| 36 | Ga0068868_100027870 | 3300005338 | Bacteria | 4312 |
| 37 | Ga0068868_100772308 | 3300005338 | Bacteria | 865 |
| 38 | Ga0068868_100776305 | 3300005338 | Bacteria | 863 |
| 39 | Ga0070660_100002471 | 3300005339 | Bacteria | 12671 |
| 40 | Ga0070660_100071292 | 3300005339 | Bacteria | 2713 |
| 41 | Ga0070660_100230916 | 3300005339 | Bacteria | 1505 |
| 42 | Ga0070660_100604638 | 3300005339 | Bacteria | 917 |
| 43 | Ga0070689_100007760 | 3300005340 | Bacteria | 7517 |
| 44 | Ga0070689_100110142 | 3300005340 | Bacteria | 2189 |
| 45 | Ga0070689_100122599 | 3300005340 | Bacteria | 2077 |
| 46 | Ga0070689_100126550 | 3300005340 | Bacteria | 2045 |
| 47 | Ga0070687_100857270 | 3300005343 | Bacteria | 648 |
| 48 | Ga0070661_100000785 | 3300005344 | Bacteria | 22858 |
| 49 | Ga0070661_100009775 | 3300005344 | Bacteria | 6653 |
| 50 | Ga0070661_100047224 | 3300005344 | Bacteria | 3150 |
| 51 | Ga0070661_100519571 | 3300005344 | Bacteria | 955 |
| 52 | Ga0070661_101872498 | 3300005344 | Bacteria | 510 |
| 53 | Ga0070692_10105524 | 3300005345 | Bacteria | 1551 |
| 54 | Ga0070668_100110996 | 3300005347 | Bacteria | 2182 |
| 55 | Ga0070668_101975705 | 3300005347 | Bacteria | 538 |
| 56 | Ga0070669_100001757 | 3300005353 | Bacteria | 15632 |
| 57 | Ga0070669_100012988 | 3300005353 | Bacteria | 5914 |
| 58 | Ga0070669_100108367 | 3300005353 | Bacteria | 2105 |
| 59 | Ga0070669_100319997 | 3300005353 | Bacteria | 1252 |
| 60 | Ga0070669_100876503 | 3300005353 | Bacteria | 766 |
| 61 | Ga0070669_101377899 | 3300005353 | Bacteria | 612 |
| 62 | Ga0070675_100007265 | 3300005354 | Bacteria | 8546 |
| 63 | Ga0070675_100018828 | 3300005354 | Bacteria | 5497 |
| 64 | Ga0070675_100038922 | 3300005354 | Bacteria | 3878 |
| 65 | Ga0070675_100088072 | 3300005354 | Bacteria | 2597 |
| 66 | Ga0070675_100160918 | 3300005354 | Bacteria | 1930 |
| 67 | Ga0070675_100471981 | 3300005354 | Bacteria | 1127 |
| 68 | Ga0070671_100003687 | 3300005355 | Bacteria | 12015 |
| 69 | Ga0070671_100046594 | 3300005355 | Bacteria | 3606 |
| 70 | Ga0070671_100107065 | 3300005355 | Bacteria | 2347 |
| 71 | Ga0070671_100190312 | 3300005355 | Bacteria | 1739 |
| 72 | Ga0070671_100410893 | 3300005355 | Bacteria | 1158 |
| 73 | Ga0070671_101079366 | 3300005355 | Bacteria | 705 |
| 74 | Ga0070674_100031169 | 3300005356 | Bacteria | 3530 |
| 75 | Ga0070674_100538724 | 3300005356 | Bacteria | 978 |
| 76 | Ga0070674_100842464 | 3300005356 | Bacteria | 795 |
| 77 | Ga0070673_100001191 | 3300005364 | Bacteria | 14965 |
| 78 | Ga0070673_100006593 | 3300005364 | Bacteria | 7557 |
| 79 | Ga0070673_100012953 | 3300005364 | Bacteria | 5748 |
| 80 | Ga0070673_100123618 | 3300005364 | Bacteria | 2162 |
| 81 | Ga0070673_100330993 | 3300005364 | Bacteria | 1348 |
| 82 | Ga0070673_101151183 | 3300005364 | Bacteria | 726 |
| 83 | Ga0070673_101567873 | 3300005364 | Bacteria | 622 |
| 84 | Ga0070688_100003852 | 3300005365 | Bacteria | 7778 |
| 85 | Ga0070688_100094015 | 3300005365 | Bacteria | 1965 |
| 86 | Ga0070688_100118034 | 3300005365 | Bacteria | 1773 |
| 87 | Ga0070659_100015059 | 3300005366 | Bacteria | 5785 |
| 88 | Ga0070659_100172176 | 3300005366 | Bacteria | 1774 |
| 89 | Ga0070659_100231919 | 3300005366 | Bacteria | 1526 |
| 90 | Ga0070659_100252883 | 3300005366 | Bacteria | 1461 |
| 91 | Ga0070659_100376300 | 3300005366 | Bacteria | 1195 |
| 92 | Ga0070659_100901085 | 3300005366 | Bacteria | 773 |
| 93 | Ga0070659_101745808 | 3300005366 | Bacteria | 557 |
| 94 | Ga0070659_101832160 | 3300005366 | Bacteria | 544 |
| 95 | Ga0070667_100000716 | 3300005367 | Bacteria | 31923 |
| 96 | Ga0070667_100007565 | 3300005367 | Bacteria | 9012 |
| 97 | Ga0070667_100096629 | 3300005367 | Bacteria | 2548 |
| 98 | Ga0070667_100147172 | 3300005367 | Bacteria | 2067 |
| 99 | Ga0070667_101020981 | 3300005367 | Bacteria | 772 |
| 100 | Ga0070703_10624365 | 3300005406 | Bacteria | 500 |
| 101 | Ga0070709_11042667 | 3300005434 | Bacteria | 652 |
| 102 | Ga0070714_100013821 | 3300005435 | Bacteria | 6473 |
| 103 | Ga0070714_100559952 | 3300005435 | Bacteria | 1095 |
| 104 | Ga0070701_10255983 | 3300005438 | Bacteria | 1059 |
| 105 | Ga0070705_100032030 | 3300005440 | Bacteria | 2917 |
| 106 | Ga0070705_101811455 | 3300005440 | Bacteria | 518 |
| 107 | Ga0070700_101555775 | 3300005441 | Bacteria | 564 |
| 108 | Ga0070694_100066381 | 3300005444 | Bacteria | 2475 |
| 109 | Ga0070694_100574433 | 3300005444 | Bacteria | 905 |
| 110 | Ga0070708_100000176 | 3300005445 | Bacteria | 45698 |
| 111 | Ga0070663_100017475 | 3300005455 | Bacteria | 4682 |
| 112 | Ga0070663_100110580 | 3300005455 | Bacteria | 2064 |
| 113 | Ga0070663_100294014 | 3300005455 | Bacteria | 1298 |
| 114 | Ga0070663_101735025 | 3300005455 | Bacteria | 559 |
| 115 | Ga0070678_100009598 | 3300005456 | Bacteria | 5872 |
| 116 | Ga0070678_100301934 | 3300005456 | Bacteria | 1361 |
| 117 | Ga0070678_100411185 | 3300005456 | Bacteria | 1177 |
| 118 | Ga0070678_101666321 | 3300005456 | Bacteria | 600 |
| 119 | Ga0070662_100000258 | 3300005457 | Bacteria | 31405 |
| 120 | Ga0070662_100175919 | 3300005457 | Bacteria | 1684 |
| 121 | Ga0070662_100195724 | 3300005457 | Bacteria | 1601 |
| 122 | Ga0070662_100558390 | 3300005457 | Bacteria | 960 |
| 123 | Ga0070662_101970907 | 3300005457 | Bacteria | 505 |
| 124 | Ga0070681_10009497 | 3300005458 | Bacteria | 9575 |
| 125 | Ga0070681_10166976 | 3300005458 | Bacteria | 2123 |
| 126 | Ga0070681_10363007 | 3300005458 | Bacteria | 1358 |
| 127 | Ga0068867_100002291 | 3300005459 | Bacteria | 13451 |
| 128 | Ga0068867_100004874 | 3300005459 | Bacteria | 9447 |
| 129 | Ga0068867_100435100 | 3300005459 | Bacteria | 1114 |
| 130 | Ga0070679_100000683 | 3300005530 | Bacteria | 29027 |
| 131 | Ga0070679_100030395 | 3300005530 | Bacteria | 5333 |
| 132 | Ga0070679_100088432 | 3300005530 | Bacteria | 3085 |
| 133 | Ga0070679_101131920 | 3300005530 | Bacteria | 728 |
| 134 | Ga0070679_101224906 | 3300005530 | Bacteria | 696 |
| 135 | Ga0070684_100047181 | 3300005535 | Bacteria | 3733 |
| 136 | Ga0070684_100105223 | 3300005535 | Bacteria | 2525 |
| 137 | Ga0070684_102294683 | 3300005535 | Bacteria | 509 |
| 138 | Ga0070697_101886844 | 3300005536 | Bacteria | 535 |
| 139 | Ga0068853_100015034 | 3300005539 | Bacteria | 6359 |
| 140 | Ga0068853_100099418 | 3300005539 | Bacteria | 2570 |
| 141 | Ga0068853_100108701 | 3300005539 | Bacteria | 2460 |
| 142 | Ga0068853_100159109 | 3300005539 | Bacteria | 2037 |
| 143 | Ga0068853_100172532 | 3300005539 | Bacteria | 1957 |
| 144 | Ga0068853_100742324 | 3300005539 | Bacteria | 938 |
| 145 | Ga0068853_101916189 | 3300005539 | Bacteria | 575 |
| 146 | Ga0070672_100004907 | 3300005543 | Bacteria | 8800 |
| 147 | Ga0070672_100018279 | 3300005543 | Bacteria | 5063 |
| 148 | Ga0070672_100086091 | 3300005543 | Bacteria | 2527 |
| 149 | Ga0070672_100113318 | 3300005543 | Bacteria | 2213 |
| 150 | Ga0070672_100174893 | 3300005543 | Bacteria | 1787 |
| 151 | Ga0070696_100130350 | 3300005546 | Bacteria | 1829 |
| 152 | Ga0070693_100737051 | 3300005547 | Bacteria | 725 |
| 153 | Ga0070665_100028490 | 3300005548 | Bacteria | 5624 |
| 154 | Ga0070665_100564346 | 3300005548 | Bacteria | 1151 |
| 155 | Ga0070665_100907261 | 3300005548 | Bacteria | 894 |
| 156 | Ga0070665_101108426 | 3300005548 | Bacteria | 803 |
| 157 | Ga0070665_101235679 | 3300005548 | Bacteria | 758 |
| 158 | Ga0070704_100283342 | 3300005549 | Bacteria | 1374 |
| 159 | Ga0070704_100486918 | 3300005549 | Bacteria | 1068 |
| 160 | Ga0070704_100697125 | 3300005549 | Bacteria | 900 |
| 161 | Ga0068855_100004105 | 3300005563 | Bacteria | 17757 |
| 162 | Ga0068855_100015373 | 3300005563 | Bacteria | 9214 |
| 163 | Ga0068855_100017343 | 3300005563 | Bacteria | 8665 |
| 164 | Ga0068855_100214285 | 3300005563 | Bacteria | 2163 |
| 165 | Ga0068855_100646092 | 3300005563 | Bacteria | 1137 |
| 166 | Ga0068855_101094096 | 3300005563 | Bacteria | 833 |
| 167 | Ga0068855_102558464 | 3300005563 | Bacteria | 507 |
| 168 | Ga0070664_100000205 | 3300005564 | Bacteria | 42407 |
| 169 | Ga0070664_100000500 | 3300005564 | Bacteria | 29704 |
| 170 | Ga0070664_100030140 | 3300005564 | Bacteria | 4526 |
| 171 | Ga0070664_100052899 | 3300005564 | Bacteria | 3441 |
| 172 | Ga0070664_100259809 | 3300005564 | Bacteria | 1562 |
| 173 | Ga0070664_100319236 | 3300005564 | Bacteria | 1407 |
| 174 | Ga0068857_100004942 | 3300005577 | Bacteria | 11321 |
| 175 | Ga0068857_100024151 | 3300005577 | Bacteria | 5351 |
| 176 | Ga0068857_100119000 | 3300005577 | Bacteria | 2377 |
| 177 | Ga0068857_100150732 | 3300005577 | Bacteria | 2106 |
| 178 | Ga0068857_101216951 | 3300005577 | Bacteria | 730 |
| 179 | Ga0068854_100024222 | 3300005578 | Bacteria | 4153 |
| 180 | Ga0068854_100044853 | 3300005578 | Bacteria | 3141 |
| 181 | Ga0068854_100110870 | 3300005578 | Bacteria | 2070 |
| 182 | Ga0068854_100198460 | 3300005578 | Bacteria | 1576 |
| 183 | Ga0068856_100000487 | 3300005614 | Bacteria | 43983 |
| 184 | Ga0068856_100005622 | 3300005614 | Bacteria | 12334 |
| 185 | Ga0068856_100014860 | 3300005614 | Bacteria | 7514 |
| 186 | Ga0068856_100124311 | 3300005614 | Bacteria | 2582 |
| 187 | Ga0068856_100292509 | 3300005614 | Bacteria | 1646 |
| 188 | Ga0070702_100597197 | 3300005615 | Bacteria | 827 |
| 189 | Ga0068852_100004594 | 3300005616 | Bacteria | 9777 |
| 190 | Ga0068852_100019402 | 3300005616 | Bacteria | 5380 |
| 191 | Ga0068852_100038154 | 3300005616 | Bacteria | 4035 |
| 192 | Ga0068852_100081928 | 3300005616 | Bacteria | 2866 |
| 193 | Ga0068852_100127927 | 3300005616 | Bacteria | 2335 |
| 194 | Ga0068852_100275693 | 3300005616 | Bacteria | 1620 |
| 195 | Ga0068852_100310452 | 3300005616 | Bacteria | 1529 |
| 196 | Ga0068852_101371654 | 3300005616 | Bacteria | 729 |
| 197 | Ga0068852_101635288 | 3300005616 | Bacteria | 666 |
| 198 | Ga0068859_100000638 | 3300005617 | Bacteria | 34985 |
| 199 | Ga0068859_100009973 | 3300005617 | Bacteria | 9583 |
| 200 | Ga0068859_100150522 | 3300005617 | Bacteria | 2402 |
| 201 | Ga0068859_100489877 | 3300005617 | Bacteria | 1325 |
| 202 | Ga0068859_100771337 | 3300005617 | Bacteria | 1050 |
| 203 | Ga0068864_100002774 | 3300005618 | Bacteria | 14467 |
| 204 | Ga0068864_100007408 | 3300005618 | Bacteria | 9034 |
| 205 | Ga0068864_100035918 | 3300005618 | Bacteria | 4221 |
| 206 | Ga0068864_100447516 | 3300005618 | Bacteria | 1235 |
| 207 | Ga0068866_10459742 | 3300005718 | Bacteria | 834 |
| 208 | Ga0068861_100001272 | 3300005719 | Bacteria | 15754 |
| 209 | Ga0068861_100115886 | 3300005719 | Bacteria | 2154 |
| 210 | Ga0068861_100470687 | 3300005719 | Bacteria | 1130 |
| 211 | Ga0068861_100547588 | 3300005719 | Bacteria | 1054 |
| 212 | Ga0068861_100697871 | 3300005719 | Bacteria | 943 |
| 213 | Ga0068861_102490552 | 3300005719 | Bacteria | 521 |
| 214 | Ga0068851_10034148 | 3300005834 | Bacteria | 2538 |
| 215 | Ga0068851_10847701 | 3300005834 | Bacteria | 570 |
| 216 | Ga0068870_10009071 | 3300005840 | Bacteria | 4505 |
| 217 | Ga0068870_10011654 | 3300005840 | Bacteria | 4085 |
| 218 | Ga0068870_10051327 | 3300005840 | Bacteria | 2183 |
| 219 | Ga0068863_100093698 | 3300005841 | Bacteria | 2850 |
| 220 | Ga0068863_100252509 | 3300005841 | Bacteria | 1704 |
| 221 | Ga0068863_100315452 | 3300005841 | Bacteria | 1518 |
| 222 | Ga0068863_100443072 | 3300005841 | Bacteria | 1274 |
| 223 | Ga0068863_100683562 | 3300005841 | Bacteria | 1019 |
| 224 | Ga0068863_100973243 | 3300005841 | Bacteria | 851 |
| 225 | Ga0068863_101283340 | 3300005841 | Bacteria | 739 |
| 226 | Ga0068863_101340471 | 3300005841 | Bacteria | 723 |
| 227 | Ga0068858_100025579 | 3300005842 | Bacteria | 5492 |
| 228 | Ga0068858_100028541 | 3300005842 | Bacteria | 5182 |
| 229 | Ga0068858_100396600 | 3300005842 | Bacteria | 1325 |
| 230 | Ga0068858_100426940 | 3300005842 | Bacteria | 1275 |
| 231 | Ga0068860_100003943 | 3300005843 | Bacteria | 15243 |
| 232 | Ga0068860_100006112 | 3300005843 | Bacteria | 12110 |
| 233 | Ga0068860_100521085 | 3300005843 | Bacteria | 1189 |
| 234 | Ga0068860_100951762 | 3300005843 | Bacteria | 876 |
| 235 | Ga0068860_101936172 | 3300005843 | Bacteria | 611 |
| 236 | Ga0068862_100004934 | 3300005844 | Bacteria | 11233 |
| 237 | Ga0068862_100120768 | 3300005844 | Bacteria | 2309 |
| 238 | Ga0070717_10345772 | 3300006028 | Bacteria | 1329 |
| 239 | Ga0075432_10111680 | 3300006058 | Bacteria | 1019 |
| 240 | Ga0070715_10865156 | 3300006163 | Bacteria | 554 |
| 241 | Ga0075367_11091498 | 3300006178 | Bacteria | 510 |
| 242 | Ga0075369_10178223 | 3300006186 | Bacteria | 977 |
| 243 | Ga0097621_100003143 | 3300006237 | Bacteria | 11333 |
| 244 | Ga0097621_100010141 | 3300006237 | Bacteria | 6877 |
| 245 | Ga0097621_100020362 | 3300006237 | Bacteria | 5110 |
| 246 | Ga0097621_100623117 | 3300006237 | Bacteria | 988 |
| 247 | Ga0075370_10000886 | 3300006353 | Bacteria | 12236 |
| 248 | Ga0068871_100010536 | 3300006358 | Bacteria | 6753 |
| 249 | Ga0068871_100091440 | 3300006358 | Bacteria | 2536 |
| 250 | Ga0068871_100112370 | 3300006358 | Bacteria | 2292 |
| 251 | Ga0068871_100393557 | 3300006358 | Bacteria | 1233 |
| 252 | Ga0068871_101012871 | 3300006358 | Bacteria | 774 |
| 253 | Ga0068871_101144036 | 3300006358 | Bacteria | 729 |
| 254 | Ga0075428_100794878 | 3300006844 | Bacteria | 1006 |
| 255 | Ga0075433_10055370 | 3300006852 | Bacteria | 3462 |
| 256 | Ga0075433_10493006 | 3300006852 | Bacteria | 1079 |
| 257 | Ga0075433_11615795 | 3300006852 | Bacteria | 559 |
| 258 | Ga0068865_100006382 | 3300006881 | Bacteria | 7187 |
| 259 | Ga0068865_100206659 | 3300006881 | Bacteria | 1527 |
| 260 | Ga0068865_100722915 | 3300006881 | Bacteria | 853 |
| 261 | Ga0097620_100000638 | 3300006931 | Bacteria | 34985 |
| 262 | Ga0097620_100009973 | 3300006931 | Bacteria | 9583 |
| 263 | Ga0097620_100150522 | 3300006931 | Bacteria | 2402 |
| 264 | Ga0097620_100489901 | 3300006931 | Bacteria | 1325 |
| 265 | Ga0097620_100771184 | 3300006931 | Bacteria | 1050 |
| 266 | Ga0075435_100028374 | 3300007076 | Bacteria | 4389 |
| 267 | Ga0105251_10231531 | 3300009011 | Bacteria | 832 |
| 268 | Ga0105240_10037008 | 3300009093 | Bacteria | 6273 |
| 269 | Ga0105240_10073361 | 3300009093 | Bacteria | 4226 |
| 270 | Ga0105240_10294319 | 3300009093 | Bacteria | 1859 |
| 271 | Ga0105245_10047077 | 3300009098 | Bacteria | 3855 |
| 272 | Ga0105245_10288760 | 3300009098 | Bacteria | 1606 |
| 273 | Ga0105245_11414059 | 3300009098 | Bacteria | 746 |
| 274 | Ga0105245_11786626 | 3300009098 | Bacteria | 668 |
| 275 | Ga0105247_10503076 | 3300009101 | Bacteria | 883 |
| 276 | Ga0105243_10265943 | 3300009148 | Bacteria | 1538 |
| 277 | Ga0105241_10027331 | 3300009174 | Bacteria | 4249 |
| 278 | Ga0105241_11158392 | 3300009174 | Bacteria | 730 |
| 279 | Ga0105241_11783467 | 3300009174 | Bacteria | 600 |
| 280 | Ga0105242_10821436 | 3300009176 | Bacteria | 922 |
| 281 | Ga0105248_10001222 | 3300009177 | Bacteria | 28675 |
| 282 | Ga0105248_10022056 | 3300009177 | Bacteria | 7055 |
| 283 | Ga0105248_10090985 | 3300009177 | Bacteria | 3436 |
| 284 | Ga0105248_10168778 | 3300009177 | Bacteria | 2466 |
| 285 | Ga0105248_10418119 | 3300009177 | Bacteria | 1510 |
| 286 | Ga0105248_10716146 | 3300009177 | Bacteria | 1129 |
| 287 | Ga0105248_10820765 | 3300009177 | Bacteria | 1050 |
| 288 | Ga0105248_11306506 | 3300009177 | Bacteria | 820 |
| 289 | Ga0105237_10067353 | 3300009545 | Bacteria | 3574 |
| 290 | Ga0105237_11014655 | 3300009545 | Bacteria | 837 |
| 291 | Ga0105238_10001723 | 3300009551 | Bacteria | 22037 |
| 292 | Ga0105238_10080184 | 3300009551 | Bacteria | 3254 |
| 293 | Ga0105238_10217803 | 3300009551 | Bacteria | 1885 |
| 294 | Ga0105238_12664283 | 3300009551 | Bacteria | 536 |
| 295 | Ga0105249_10338327 | 3300009553 | Bacteria | 1521 |
| 296 | Ga0105249_10987269 | 3300009553 | Bacteria | 911 |
| 297 | Ga0105249_13560933 | 3300009553 | Bacteria | 502 |
| 298 | Ga0105249_13584910 | 3300009553 | Bacteria | 500 |
| 299 | Ga0105239_10477713 | 3300010375 | Bacteria | 1416 |
| 300 | Ga0105239_11372543 | 3300010375 | Bacteria | 816 |
| 301 | Ga0105246_10302173 | 3300011119 | Bacteria | 1292 |
| 302 | Ga0105246_11238289 | 3300011119 | Bacteria | 689 |
| 303 | Ga0157373_10003392 | 3300013100 | Bacteria | 12052 |
| 304 | Ga0157373_10006331 | 3300013100 | Bacteria | 8843 |
| 305 | Ga0157373_10016743 | 3300013100 | Bacteria | 5343 |
| 306 | Ga0157373_10110230 | 3300013100 | Bacteria | 1935 |
| 307 | Ga0157373_11192806 | 3300013100 | Bacteria | 573 |
| 308 | Ga0157371_10000365 | 3300013102 | Bacteria | 57144 |
| 309 | Ga0157371_10089714 | 3300013102 | Bacteria | 2177 |
| 310 | Ga0157371_10785278 | 3300013102 | Bacteria | 717 |
| 311 | Ga0157370_10002179 | 3300013104 | Bacteria | 23894 |
| 312 | Ga0157370_10055513 | 3300013104 | Bacteria | 3772 |
| 313 | Ga0157370_10130729 | 3300013104 | Bacteria | 2342 |
| 314 | Ga0157370_10225326 | 3300013104 | Bacteria | 1735 |
| 315 | Ga0157370_10672044 | 3300013104 | Bacteria | 946 |
| 316 | Ga0157369_10006741 | 3300013105 | Bacteria | 13254 |
| 317 | Ga0157369_10018914 | 3300013105 | Bacteria | 7719 |
| 318 | Ga0157369_10019036 | 3300013105 | Bacteria | 7688 |
| 319 | Ga0157369_10096857 | 3300013105 | Bacteria | 3147 |
| 320 | Ga0157369_10442735 | 3300013105 | Bacteria | 1346 |
| 321 | Ga0157374_10003730 | 3300013296 | Bacteria | 12803 |
| 322 | Ga0157374_10017807 | 3300013296 | Bacteria | 6259 |
| 323 | Ga0157374_10072948 | 3300013296 | Bacteria | 3240 |
| 324 | Ga0157374_10256674 | 3300013296 | Bacteria | 1721 |
| 325 | Ga0157374_11121369 | 3300013296 | Bacteria | 807 |
| 326 | Ga0157378_10023467 | 3300013297 | Bacteria | 5428 |
| 327 | Ga0157378_10149202 | 3300013297 | Bacteria | 2177 |
| 328 | Ga0157378_10152831 | 3300013297 | Bacteria | 2151 |
| 329 | Ga0157378_10344976 | 3300013297 | Bacteria | 1453 |
| 330 | Ga0157378_10554362 | 3300013297 | Bacteria | 1155 |
| 331 | Ga0157378_10909694 | 3300013297 | Bacteria | 911 |
| 332 | Ga0157378_12335308 | 3300013297 | Bacteria | 586 |
| 333 | Ga0163162_10053479 | 3300013306 | Bacteria | 4058 |
| 334 | Ga0163162_10155174 | 3300013306 | Bacteria | 2409 |
| 335 | Ga0163162_10543796 | 3300013306 | Bacteria | 1290 |
| 336 | Ga0163162_10707591 | 3300013306 | Bacteria | 1129 |
| 337 | Ga0163162_10812500 | 3300013306 | Bacteria | 1052 |
| 338 | Ga0163162_10837554 | 3300013306 | Bacteria | 1036 |
| 339 | Ga0163162_11199103 | 3300013306 | Bacteria | 861 |
| 340 | Ga0157372_10025043 | 3300013307 | Bacteria | 6484 |
| 341 | Ga0157372_10039797 | 3300013307 | Bacteria | 5190 |
| 342 | Ga0157372_10165010 | 3300013307 | Bacteria | 2561 |
| 343 | Ga0157372_10221992 | 3300013307 | Bacteria | 2190 |
| 344 | Ga0157372_10331504 | 3300013307 | Bacteria | 1772 |
| 345 | Ga0157372_10771443 | 3300013307 | Bacteria | 1118 |
| 346 | Ga0157372_10977766 | 3300013307 | Bacteria | 981 |
| 347 | Ga0157372_10996673 | 3300013307 | Bacteria | 970 |
| 348 | Ga0157372_12807186 | 3300013307 | Bacteria | 558 |
| 349 | Ga0157375_10011973 | 3300013308 | Bacteria | 7681 |
| 350 | Ga0157375_10015066 | 3300013308 | Bacteria | 6914 |
| 351 | Ga0157375_10092999 | 3300013308 | Bacteria | 3080 |
| 352 | Ga0157375_10135338 | 3300013308 | Bacteria | 2587 |
| 353 | Ga0157375_10200138 | 3300013308 | Bacteria | 2153 |
| 354 | Ga0157375_10610952 | 3300013308 | Bacteria | 1249 |
| 355 | Ga0163163_10005582 | 3300014325 | Bacteria | 10899 |
| 356 | Ga0163163_10909109 | 3300014325 | Bacteria | 944 |
| 357 | Ga0157380_11182038 | 3300014326 | Bacteria | 808 |
| 358 | Ga0157380_11551554 | 3300014326 | Bacteria | 717 |
| 359 | Ga0157380_13516309 | 3300014326 | Bacteria | 502 |
| 360 | Ga0182008_10217977 | 3300014497 | Bacteria | 976 |
| 361 | Ga0157377_10931561 | 3300014745 | Bacteria | 652 |
| 362 | Ga0157379_10001432 | 3300014968 | Bacteria | 19594 |
| 363 | Ga0157379_10003011 | 3300014968 | Bacteria | 14227 |
| 364 | Ga0157379_10046158 | 3300014968 | Bacteria | 3888 |
| 365 | Ga0157379_11434233 | 3300014968 | Bacteria | 670 |
| 366 | Ga0157376_10175529 | 3300014969 | Bacteria | 1954 |
| 367 | Ga0157376_10366566 | 3300014969 | Bacteria | 1383 |
| 368 | Ga0157376_10409600 | 3300014969 | Bacteria | 1313 |
| 369 | Ga0157376_10579486 | 3300014969 | Bacteria | 1114 |
| 370 | Ga0157376_11918145 | 3300014969 | Bacteria | 629 |
| 371 | Ga0163161_11387878 | 3300017792 | Bacteria | 613 |
| 372 | Ga0213872_10312706 | 3300021361 | Bacteria | 650 |
| 373 | Ga0209646_1000039 | 3300025246 | Bacteria | 349637 |
| 374 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 375 | Ga0209677_100914 | 3300025253 | Bacteria | 14434 |
| 376 | Ga0209759_1000020 | 3300025256 | Bacteria | 344904 |
| 377 | Ga0207697_10007205 | 3300025315 | Bacteria | 4970 |
| 378 | Ga0207656_10473145 | 3300025321 | Bacteria | 635 |
| 379 | Ga0207713_1212763 | 3300025735 | Bacteria | 587 |
| 380 | Ga0207642_10057739 | 3300025899 | Bacteria | 1787 |
| 381 | Ga0207642_10241373 | 3300025899 | Bacteria | 1020 |
| 382 | Ga0207710_10236747 | 3300025900 | Bacteria | 910 |
| 383 | Ga0207688_10089483 | 3300025901 | Bacteria | 1766 |
| 384 | Ga0207688_10173786 | 3300025901 | Bacteria | 1282 |
| 385 | Ga0207680_10409345 | 3300025903 | Bacteria | 959 |
| 386 | Ga0207647_10318264 | 3300025904 | Bacteria | 884 |
| 387 | Ga0207645_10000867 | 3300025907 | Bacteria | 25160 |
| 388 | Ga0207645_10013883 | 3300025907 | Bacteria | 5404 |
| 389 | Ga0207645_10125489 | 3300025907 | Bacteria | 1668 |
| 390 | Ga0207645_10552458 | 3300025907 | Bacteria | 781 |
| 391 | Ga0207643_10036956 | 3300025908 | Bacteria | 2739 |
| 392 | Ga0207643_10557962 | 3300025908 | Bacteria | 735 |
| 393 | Ga0207705_10074796 | 3300025909 | Bacteria | 2459 |
| 394 | Ga0207705_10081090 | 3300025909 | Bacteria | 2365 |
| 395 | Ga0207705_10407838 | 3300025909 | Bacteria | 1051 |
| 396 | Ga0207654_10119050 | 3300025911 | Bacteria | 1655 |
| 397 | Ga0207654_10691308 | 3300025911 | Bacteria | 732 |
| 398 | Ga0207707_10002721 | 3300025912 | Bacteria | 15790 |
| 399 | Ga0207695_10104184 | 3300025913 | Bacteria | 2827 |
| 400 | Ga0207695_10183388 | 3300025913 | Bacteria | 2013 |
| 401 | Ga0207671_10032764 | 3300025914 | Bacteria | 3866 |
| 402 | Ga0207663_11112999 | 3300025916 | Bacteria | 635 |
| 403 | Ga0207660_10562897 | 3300025917 | Bacteria | 927 |
| 404 | Ga0207657_10000967 | 3300025919 | Bacteria | 30457 |
| 405 | Ga0207657_10066809 | 3300025919 | Bacteria | 3059 |
| 406 | Ga0207657_10494951 | 3300025919 | Bacteria | 958 |
| 407 | Ga0207649_10159379 | 3300025920 | Bacteria | 1562 |
| 408 | Ga0207649_10453604 | 3300025920 | Bacteria | 968 |
| 409 | Ga0207649_10525075 | 3300025920 | Bacteria | 903 |
| 410 | Ga0207649_11024048 | 3300025920 | Bacteria | 650 |
| 411 | Ga0207652_10000882 | 3300025921 | Bacteria | 28372 |
| 412 | Ga0207681_10020008 | 3300025923 | Bacteria | 4239 |
| 413 | Ga0207681_10034544 | 3300025923 | Bacteria | 3325 |
| 414 | Ga0207681_10048752 | 3300025923 | Bacteria | 2860 |
| 415 | Ga0207681_11211557 | 3300025923 | Bacteria | 634 |
| 416 | Ga0207694_10095613 | 3300025924 | Bacteria | 2349 |
| 417 | Ga0207694_11224054 | 3300025924 | Bacteria | 635 |
| 418 | Ga0207650_10010149 | 3300025925 | Bacteria | 6455 |
| 419 | Ga0207650_10011061 | 3300025925 | Bacteria | 6207 |
| 420 | Ga0207659_10013628 | 3300025926 | Bacteria | 5214 |
| 421 | Ga0207659_10100244 | 3300025926 | Bacteria | 2182 |
| 422 | Ga0207659_10291320 | 3300025926 | Bacteria | 1338 |
| 423 | Ga0207664_10822441 | 3300025929 | Bacteria | 835 |
| 424 | Ga0207644_10013484 | 3300025931 | Bacteria | 5450 |
| 425 | Ga0207644_10039263 | 3300025931 | Bacteria | 3341 |
| 426 | Ga0207644_10081230 | 3300025931 | Bacteria | 2395 |
| 427 | Ga0207644_10089114 | 3300025931 | Bacteria | 2296 |
| 428 | Ga0207690_10000438 | 3300025932 | Bacteria | 27116 |
| 429 | Ga0207690_10317504 | 3300025932 | Bacteria | 1224 |
| 430 | Ga0207690_10432339 | 3300025932 | Bacteria | 1055 |
| 431 | Ga0207690_11185349 | 3300025932 | Bacteria | 637 |
| 432 | Ga0207706_10000024 | 3300025933 | Bacteria | 151942 |
| 433 | Ga0207706_10085073 | 3300025933 | Bacteria | 2781 |
| 434 | Ga0207706_10226861 | 3300025933 | Bacteria | 1635 |
| 435 | Ga0207706_10714602 | 3300025933 | Bacteria | 855 |
| 436 | Ga0207686_10083788 | 3300025934 | Bacteria | 2087 |
| 437 | Ga0207686_10414787 | 3300025934 | Bacteria | 1029 |
| 438 | Ga0207709_10488234 | 3300025935 | Bacteria | 959 |
| 439 | Ga0207670_10013294 | 3300025936 | Bacteria | 4847 |
| 440 | Ga0207670_10380942 | 3300025936 | Bacteria | 1124 |
| 441 | Ga0207669_10046076 | 3300025937 | Bacteria | 2574 |
| 442 | Ga0207704_10117960 | 3300025938 | Bacteria | 1809 |
| 443 | Ga0207704_10252442 | 3300025938 | Bacteria | 1325 |
| 444 | Ga0207691_10000328 | 3300025940 | Bacteria | 47302 |
| 445 | Ga0207691_10010980 | 3300025940 | Bacteria | 8689 |
| 446 | Ga0207691_10028115 | 3300025940 | Bacteria | 5267 |
| 447 | Ga0207691_10039517 | 3300025940 | Bacteria | 4365 |
| 448 | Ga0207691_10179539 | 3300025940 | Bacteria | 1850 |
| 449 | Ga0207711_10015761 | 3300025941 | Bacteria | 6269 |
| 450 | Ga0207711_10026765 | 3300025941 | Bacteria | 4840 |
| 451 | Ga0207711_10043445 | 3300025941 | Bacteria | 3834 |
| 452 | Ga0207711_10172502 | 3300025941 | Bacteria | 1963 |
| 453 | Ga0207711_10715892 | 3300025941 | Bacteria | 933 |
| 454 | Ga0207711_10847151 | 3300025941 | Bacteria | 851 |
| 455 | Ga0207689_10000978 | 3300025942 | Bacteria | 27386 |
| 456 | Ga0207689_10003815 | 3300025942 | Bacteria | 13737 |
| 457 | Ga0207689_10110096 | 3300025942 | Bacteria | 2263 |
| 458 | Ga0207689_10665233 | 3300025942 | Bacteria | 878 |
| 459 | Ga0207661_10129937 | 3300025944 | Bacteria | 2156 |
| 460 | Ga0207661_10135413 | 3300025944 | Bacteria | 2115 |
| 461 | Ga0207679_10001794 | 3300025945 | Bacteria | 13364 |
| 462 | Ga0207679_10046035 | 3300025945 | Bacteria | 3160 |
| 463 | Ga0207679_10226757 | 3300025945 | Bacteria | 1575 |
| 464 | Ga0207679_11085493 | 3300025945 | Bacteria | 734 |
| 465 | Ga0207667_10002406 | 3300025949 | Bacteria | 23427 |
| 466 | Ga0207667_10031658 | 3300025949 | Bacteria | 5708 |
| 467 | Ga0207667_10100540 | 3300025949 | Bacteria | 2983 |
| 468 | Ga0207667_10174500 | 3300025949 | Bacteria | 2209 |
| 469 | Ga0207667_10332986 | 3300025949 | Bacteria | 1550 |
| 470 | Ga0207667_10473498 | 3300025949 | Bacteria | 1272 |
| 471 | Ga0207667_10483639 | 3300025949 | Bacteria | 1257 |
| 472 | Ga0207667_11288131 | 3300025949 | Bacteria | 708 |
| 473 | Ga0207651_10004469 | 3300025960 | Bacteria | 7054 |
| 474 | Ga0207651_10017821 | 3300025960 | Bacteria | 4207 |
| 475 | Ga0207651_10068842 | 3300025960 | Bacteria | 2497 |
| 476 | Ga0207651_10205844 | 3300025960 | Bacteria | 1580 |
| 477 | Ga0207651_10380903 | 3300025960 | Bacteria | 1195 |
| 478 | Ga0207712_10539464 | 3300025961 | Bacteria | 1002 |
| 479 | Ga0207712_10679884 | 3300025961 | Bacteria | 897 |
| 480 | Ga0207668_10014932 | 3300025972 | Bacteria | 4816 |
| 481 | Ga0207668_10029422 | 3300025972 | Bacteria | 3600 |
| 482 | Ga0207668_10037570 | 3300025972 | Bacteria | 3242 |
| 483 | Ga0207640_10050956 | 3300025981 | Bacteria | 2689 |
| 484 | Ga0207640_10365750 | 3300025981 | Bacteria | 1164 |
| 485 | Ga0207658_10006246 | 3300025986 | Bacteria | 8141 |
| 486 | Ga0207658_10026736 | 3300025986 | Bacteria | 4048 |
| 487 | Ga0207658_10086633 | 3300025986 | Bacteria | 2416 |
| 488 | Ga0207658_10363691 | 3300025986 | Bacteria | 1263 |
| 489 | Ga0207658_11999601 | 3300025986 | Bacteria | 527 |
| 490 | Ga0207677_10039527 | 3300026023 | Bacteria | 3103 |
| 491 | Ga0207677_10118183 | 3300026023 | Bacteria | 1988 |
| 492 | Ga0207677_11480381 | 3300026023 | Bacteria | 627 |
| 493 | Ga0207703_10011529 | 3300026035 | Bacteria | 6877 |
| 494 | Ga0207703_10017883 | 3300026035 | Bacteria | 5536 |
| 495 | Ga0207703_10077338 | 3300026035 | Bacteria | 2762 |
| 496 | Ga0207703_10173499 | 3300026035 | Bacteria | 1898 |
| 497 | Ga0207703_10239466 | 3300026035 | Bacteria | 1631 |
| 498 | Ga0207639_10034366 | 3300026041 | Bacteria | 3746 |
| 499 | Ga0207639_10061090 | 3300026041 | Bacteria | 2909 |
| 500 | Ga0207639_10128935 | 3300026041 | Bacteria | 2091 |
| 501 | Ga0207639_10505870 | 3300026041 | Bacteria | 1104 |
| 502 | Ga0207678_10017556 | 3300026067 | Bacteria | 6285 |
| 503 | Ga0207678_10139321 | 3300026067 | Bacteria | 2070 |
| 504 | Ga0207678_10962332 | 3300026067 | Bacteria | 755 |
| 505 | Ga0207708_10242072 | 3300026075 | Bacteria | 1451 |
| 506 | Ga0207708_10918721 | 3300026075 | Bacteria | 758 |
| 507 | Ga0207702_10000310 | 3300026078 | Bacteria | 55596 |
| 508 | Ga0207702_10007209 | 3300026078 | Bacteria | 9515 |
| 509 | Ga0207702_10167053 | 3300026078 | Bacteria | 2014 |
| 510 | Ga0207641_10005581 | 3300026088 | Bacteria | 10721 |
| 511 | Ga0207641_10009917 | 3300026088 | Bacteria | 7842 |
| 512 | Ga0207641_10140326 | 3300026088 | Bacteria | 2180 |
| 513 | Ga0207641_10515446 | 3300026088 | Bacteria | 1163 |
| 514 | Ga0207641_10875119 | 3300026088 | Bacteria | 891 |
| 515 | Ga0207641_10943063 | 3300026088 | Bacteria | 858 |
| 516 | Ga0207648_10000726 | 3300026089 | Bacteria | 36910 |
| 517 | Ga0207648_10001220 | 3300026089 | Bacteria | 28819 |
| 518 | Ga0207676_10003141 | 3300026095 | Bacteria | 11789 |
| 519 | Ga0207676_10051112 | 3300026095 | Bacteria | 3225 |
| 520 | Ga0207676_10152353 | 3300026095 | Bacteria | 1993 |
| 521 | Ga0207674_10028559 | 3300026116 | Bacteria | 5886 |
| 522 | Ga0207674_10067479 | 3300026116 | Bacteria | 3601 |
| 523 | Ga0207674_10078312 | 3300026116 | Bacteria | 3310 |
| 524 | Ga0207674_10080603 | 3300026116 | Bacteria | 3258 |
| 525 | Ga0207675_100001344 | 3300026118 | Bacteria | 24662 |
| 526 | Ga0207675_100021731 | 3300026118 | Bacteria | 5972 |
| 527 | Ga0207675_100088142 | 3300026118 | Bacteria | 2915 |
| 528 | Ga0207675_100198307 | 3300026118 | Bacteria | 1927 |
| 529 | Ga0207675_101968851 | 3300026118 | Bacteria | 602 |
| 530 | Ga0207675_101984349 | 3300026118 | Bacteria | 600 |
| 531 | Ga0207675_102377388 | 3300026118 | Bacteria | 542 |
| 532 | Ga0207683_10000807 | 3300026121 | Bacteria | 28669 |
| 533 | Ga0207683_10079818 | 3300026121 | Bacteria | 2902 |
| 534 | Ga0207683_10339286 | 3300026121 | Bacteria | 1378 |
| 535 | Ga0207683_11283609 | 3300026121 | Bacteria | 678 |
| 536 | Ga0207698_10017978 | 3300026142 | Bacteria | 4807 |
| 537 | Ga0207698_10068036 | 3300026142 | Bacteria | 2811 |
| 538 | Ga0207698_10350955 | 3300026142 | Bacteria | 1393 |
| 539 | Ga0207698_10658000 | 3300026142 | Bacteria | 1038 |
| 540 | Ga0207698_11153052 | 3300026142 | Bacteria | 788 |
| 541 | Ga0209996_1026298 | 3300027395 | Bacteria | 834 |
| 542 | Ga0209995_1002494 | 3300027471 | Bacteria | 2911 |
| 543 | Ga0209968_1088468 | 3300027526 | Bacteria | 561 |
| 544 | Ga0209999_1009637 | 3300027543 | Bacteria | 1743 |
| 545 | Ga0209970_1020437 | 3300027614 | Bacteria | 1119 |
| 546 | Ga0209966_1006452 | 3300027695 | Bacteria | 2038 |
| 547 | Ga0209974_10000041 | 3300027876 | Bacteria | 31325 |
| 548 | Ga0209974_10013052 | 3300027876 | Bacteria | 2770 |
| 549 | Ga0207428_10393414 | 3300027907 | Bacteria | 1015 |
| 550 | Ga0268266_11562769 | 3300028379 | Bacteria | 635 |
| 551 | Ga0268265_10033997 | 3300028380 | Bacteria | 3712 |
| 552 | Ga0268264_10009963 | 3300028381 | Bacteria | 7870 |
| 553 | Ga0268264_10011189 | 3300028381 | Bacteria | 7411 |
| 554 | Ga0268264_11307719 | 3300028381 | Bacteria | 735 |
| 555 | Ga0307408_100012040 | 3300031548 | Bacteria | 5726 |
| 556 | Ga0265342_10242554 | 3300031712 | Bacteria | 964 |
| 557 | Ga0307405_10009517 | 3300031731 | Bacteria | 4985 |
| 558 | Ga0307413_10006886 | 3300031824 | Bacteria | 5230 |
| 559 | Ga0307413_11927412 | 3300031824 | Bacteria | 531 |
| 560 | Ga0307410_10006796 | 3300031852 | Bacteria | 6208 |
| 561 | Ga0307410_10736014 | 3300031852 | Bacteria | 834 |
| 562 | Ga0307406_10001453 | 3300031901 | Bacteria | 13100 |
| 563 | Ga0307407_10006443 | 3300031903 | Bacteria | 5217 |
| 564 | Ga0307407_10199927 | 3300031903 | Bacteria | 1339 |
| 565 | Ga0307412_10022460 | 3300031911 | Bacteria | 3868 |
| 566 | Ga0307412_10269425 | 3300031911 | Bacteria | 1332 |
| 567 | Ga0307412_10346995 | 3300031911 | Bacteria | 1190 |
| 568 | Ga0307409_100013622 | 3300031995 | Bacteria | 5245 |
| 569 | Ga0307409_100204427 | 3300031995 | Bacteria | 1770 |
| 570 | Ga0307409_102428258 | 3300031995 | Bacteria | 553 |
| 571 | Ga0307416_100006433 | 3300032002 | Bacteria | 7358 |
| 572 | Ga0307416_100928746 | 3300032002 | Bacteria | 971 |
| 573 | Ga0307414_10137857 | 3300032004 | Bacteria | 1905 |
| 574 | Ga0307411_10000456 | 3300032005 | Bacteria | 14093 |
| 575 | Ga0307415_100080891 | 3300032126 | Bacteria | 2319 |
| 576 | Ga0307415_100741191 | 3300032126 | Bacteria | 891 |
| 577 | Ga0373934_0191341 | 3300035086 | Bacteria | 842 |
| 578 | Ga0373953_0297824 | 3300035117 | Bacteria | 704 |
| 579 | Ga0373957_0030941 | 3300035120 | Bacteria | 1964 |
| 580 | Ga0373955_0128794 | 3300035172 | Bacteria | 1476 |
| 581 | Ga0373955_0255228 | 3300035172 | Bacteria | 1052 |
| 582 | Ga0373961_0157475 | 3300035241 | Bacteria | 778 |
| 583 | Ga0373931_0189560 | 3300035691 | Bacteria | 1223 |
| 584 | Ga0373935_0077542 | 3300035692 | Bacteria | 2154 |
| 585 | Ga0395900_0358506 | 3300037418 | Bacteria | 1430 |
| 586 | Ga0395905_0029632 | 3300037471 | Bacteria | 5158 |
| 587 | Ga0395905_0286839 | 3300037471 | Bacteria | 1533 |
| 588 | Ga0395905_0396436 | 3300037471 | Bacteria | 1275 |
| 589 | Ga0395901_0082541 | 3300038443 | Bacteria | 3358 |
| 590 | Ga0395901_1259029 | 3300038443 | Bacteria | 703 |
| 591 | Ga0242420_076421 | 3300038996 | Bacteria | 687 |
| 592 | Ga0436361_0962106 | 3300039447 | Bacteria | 1356 |
| 593 | Ga0439465_0097522 | 3300041413 | Bacteria | 1012 |
| 594 | Ga0451804_0410469 | 3300041463 | Bacteria | 681 |
| 595 | Ga0451837_1437381 | 3300041494 | Bacteria | 556 |
| 596 | Ga0451853_2798496 | 3300041512 | Bacteria | 1185 |
| 597 | Ga0439441_176034 | 3300042001 | Bacteria | 513 |
| 598 | Ga0450896_004241 | 3300042133 | Bacteria | 1941 |
| 599 | Ga0450898_125407 | 3300042134 | Bacteria | 550 |
| 600 | Ga0439446_0376820 | 3300042156 | Bacteria | 509 |
| 601 | Ga0439444_0078373 | 3300042437 | Bacteria | 719 |
| 602 | Ga0451577_0183458 | 3300042876 | Bacteria | 1887 |
| 603 | Ga0451577_0437630 | 3300042876 | Bacteria | 1187 |
| 604 | Ga0466969_0029420 | 3300044656 | Bacteria | 2804 |
| 605 | Ga0466980_0259552 | 3300044668 | Bacteria | 1073 |
| 606 | Ga0453683_0520212 | 3300044673 | Bacteria | 773 |
| 607 | Ga0466965_0086054 | 3300044683 | Bacteria | 1594 |
| 608 | Ga0466966_0026828 | 3300044684 | Bacteria | 3758 |
| 609 | Ga0466966_0218177 | 3300044684 | Bacteria | 1152 |
| 610 | Ga0466961_0054494 | 3300044693 | Bacteria | 2550 |
| 611 | Ga0466961_0341621 | 3300044693 | Bacteria | 912 |
| 612 | Ga0453684_0397304 | 3300044712 | Bacteria | 1545 |
| 613 | Ga0453684_0779249 | 3300044712 | Bacteria | 1033 |
| 614 | Ga0466971_0203093 | 3300044719 | Bacteria | 936 |
| 615 | Ga0466970_0226356 | 3300044765 | Bacteria | 1044 |
| 616 | Ga0466957_0031256 | 3300044842 | Bacteria | 3181 |
| 617 | Ga0466957_0452812 | 3300044842 | Bacteria | 885 |
| 618 | Ga0466959_0012017 | 3300045049 | Bacteria | 6245 |
| 619 | Ga0451576_0427578 | 3300045051 | Bacteria | 1390 |
| 620 | Ga0466958_0432522 | 3300045836 | Bacteria | 851 |
| 621 | Ga0495592_0305150 | 3300046454 | Bacteria | 1033 |
| 622 | Ga0495651_0070347 | 3300046462 | Bacteria | 2663 |
| 623 | Ga0495608_0013310 | 3300046511 | Bacteria | 5707 |
| 624 | Ga0495628_0070524 | 3300046516 | Bacteria | 2725 |
| 625 | Ga0495587_0175271 | 3300046536 | Bacteria | 1217 |
| 626 | Ga0495621_0250034 | 3300046539 | Bacteria | 724 |
| 627 | Ga0495667_0090853 | 3300046559 | Bacteria | 1978 |
| 628 | Ga0495635_0354361 | 3300046663 | Bacteria | 979 |
| 629 | Ga0495657_0441877 | 3300046675 | Bacteria | 762 |
| 630 | Ga0495623_0032712 | 3300046679 | Bacteria | 3341 |
| 631 | Ga0495658_0488500 | 3300046683 | Bacteria | 787 |
| 632 | Ga0495658_1018286 | 3300046683 | Bacteria | 529 |
| 633 | Ga0495600_0275561 | 3300046809 | Bacteria | 1066 |
| 634 | Ga0495684_0191930 | 3300047471 | Bacteria | 1510 |
| 635 | Ga0495602_0227371 | 3300048088 | Bacteria | 1404 |
| 636 | Ga0496100_0387926 | 3300048903 | Bacteria | 1062 |
| 637 | Ga0496101_0821129 | 3300048904 | Bacteria | 733 |
| 638 | Ga0496101_1584087 | 3300048904 | Bacteria | 509 |
| 639 | Ga0496102_0019973 | 3300048905 | Bacteria | 5910 |
| 640 | Ga0496102_0031073 | 3300048905 | Bacteria | 4787 |
| 641 | Ga0496102_0566374 | 3300048905 | Bacteria | 1059 |
| 642 | Ga0496103_0010672 | 3300048906 | Bacteria | 5435 |
| 643 | Ga0496106_0042223 | 3300048909 | Bacteria | 3420 |
| 644 | Ga0496106_0043122 | 3300048909 | Bacteria | 3384 |
| 645 | Ga0496106_0503832 | 3300048909 | Bacteria | 972 |
| 646 | Ga0496106_0965233 | 3300048909 | Bacteria | 671 |
| 647 | Ga0496107_0002463 | 3300048910 | Bacteria | 12009 |
| 648 | Ga0496107_0155747 | 3300048910 | Bacteria | 1692 |
| 649 | Ga0496108_0092966 | 3300048911 | Bacteria | 2565 |
| 650 | Ga0496108_0257919 | 3300048911 | Bacteria | 1517 |
| 651 | Ga0496108_1228064 | 3300048911 | Bacteria | 633 |
| 652 | Ga0496109_1183987 | 3300048912 | Bacteria | 701 |
| 653 | Ga0496109_1221697 | 3300048912 | Bacteria | 688 |
| 654 | Ga0496110_0510561 | 3300048913 | Bacteria | 1094 |
| 655 | Ga0496110_1410153 | 3300048913 | Bacteria | 606 |
| 656 | Ga0496110_1841710 | 3300048913 | Bacteria | 515 |
| 657 | Ga0496112_1305975 | 3300048915 | Bacteria | 641 |
| 658 | Ga0496114_0857914 | 3300048917 | Bacteria | 788 |
| 659 | Ga0496126_0005752 | 3300048929 | Bacteria | 14027 |
| 660 | Ga0496126_0036269 | 3300048929 | Bacteria | 4611 |
| 661 | Ga0501034_0014114 | 3300049571 | Bacteria | 8232 |
| 662 | Ga0501034_0070809 | 3300049571 | Bacteria | 3498 |
| 663 | Ga0501034_0387494 | 3300049571 | Bacteria | 1322 |
| 664 | Ga0501046_0274123 | 3300049580 | Bacteria | 1237 |
| 665 | Ga0501047_0004566 | 3300049581 | Bacteria | 13022 |
| 666 | Ga0501047_0023350 | 3300049581 | Bacteria | 5939 |
| 667 | Ga0501047_0485179 | 3300049581 | Bacteria | 1063 |
| 668 | Ga0501047_0565800 | 3300049581 | Unclassified | 960 |
| 669 | Ga0501048_0658102 | 3300049582 | Bacteria | 752 |
| 670 | Ga0501067_0003639 | 3300049583 | Bacteria | 8491 |
| 671 | Ga0501067_0103722 | 3300049583 | Bacteria | 1580 |
| 672 | Ga0501068_0007747 | 3300049584 | Bacteria | 5947 |
| 673 | Ga0501069_0007681 | 3300049585 | Bacteria | 5658 |
| 674 | Ga0501069_0136668 | 3300049585 | Bacteria | 1405 |
| 675 | Ga0501070_0005698 | 3300049586 | Bacteria | 10619 |
| 676 | Ga0501070_0132421 | 3300049586 | Bacteria | 2059 |
| 677 | Ga0501072_0012097 | 3300049588 | Bacteria | 6593 |
| 678 | Ga0501073_0002490 | 3300049589 | Bacteria | 13749 |
| 679 | Ga0501073_0009577 | 3300049589 | Bacteria | 7144 |
| 680 | Ga0501074_0001555 | 3300049590 | Bacteria | 15520 |
| 681 | Ga0501074_0019444 | 3300049590 | Bacteria | 4933 |
| 682 | Ga0501077_1033310 | 3300049593 | Bacteria | 529 |
| 683 | Ga0501079_0011145 | 3300049741 | Bacteria | 6856 |
| 684 | Ga0501079_0867276 | 3300049741 | Bacteria | 711 |
| 685 | Ga0501080_0016096 | 3300049742 | Bacteria | 6903 |
| 686 | Ga0501080_0024511 | 3300049742 | Bacteria | 5592 |
| 687 | Ga0501080_0039895 | 3300049742 | Bacteria | 4381 |
| 688 | Ga0501080_0188975 | 3300049742 | Bacteria | 1893 |
| 689 | Ga0501083_0003639 | 3300049744 | Bacteria | 10819 |
| 690 | Ga0501083_0015423 | 3300049744 | Bacteria | 5351 |
| 691 | Ga0501083_0055475 | 3300049744 | Bacteria | 2656 |
| 692 | Ga0501035_0181555 | 3300049822 | Bacteria | 1813 |
| 693 | Ga0501035_0192526 | 3300049822 | Bacteria | 1753 |
| 694 | Ga0501035_0541592 | 3300049822 | Bacteria | 954 |
| 695 | Ga0501044_0088928 | 3300049823 | Bacteria | 3118 |
| 696 | nmdc:mga06z11_917056_c1 | 3300050494 | Bacteria | 534 |
| 697 | nmdc:mga07m45_257_c1 | 3300050496 | Bacteria | 21611 |
| 698 | nmdc:mga08x19_424194_c1 | 3300050514 | Bacteria | 934 |
| 699 | nmdc:mga0a205_66931_c1 | 3300050515 | Bacteria | 3470 |
| 700 | Ga0495601_0116042 | 3300053077 | Bacteria | 1736 |
| 701 | Ga0495595_0168288 | 3300053084 | Bacteria | 1084 |
| 702 | Ga0495595_0287598 | 3300053084 | Bacteria | 826 |
| 703 | Ga0495619_0012027 | 3300053085 | Bacteria | 5453 |
| 704 | Ga0495619_0272528 | 3300053085 | Bacteria | 1173 |
| 705 | Ga0500646_0000709 | 3300053090 | Bacteria | 9479 |
| 706 | Ga0500555_136848 | 3300053103 | Bacteria | 605 |
| 707 | Ga0500642_0458646 | 3300053130 | Bacteria | 545 |
| 708 | Ga0500568_0029148 | 3300053139 | Bacteria | 2293 |
| 709 | Ga0500604_0007191 | 3300053151 | Bacteria | 2947 |
| 710 | Ga0501084_0061508 | 3300054114 | Bacteria | 3144 |
| 711 | Ga0590071_061993 | 3300059421 | Bacteria | 915 |
| 712 | Ga0501082_0030848 | 3300060353 | Bacteria | 4621 |
| 713 | Ga0501082_0056471 | 3300060353 | Bacteria | 3382 |
| 714 | Ga0466962_0571458 | 3300061719 | Bacteria | 575 |
| 715 | Ga0466962_0634592 | 3300061719 | Bacteria | 546 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007076 | Ga0075435_100028374 | Ga0075435_1000283742 | 83 |
| 2 | 3300005334 | Ga0068869_101524698 | Ga0068869_1015246981 | 84 |
| 3 | 3300005353 | Ga0070669_100876503 | Ga0070669_1008765032 | 84 |
| 4 | 3300005354 | Ga0070675_100160918 | Ga0070675_1001609181 | 84 |
| 5 | 3300005356 | Ga0070674_100538724 | Ga0070674_1005387242 | 84 |
| 6 | 3300005364 | Ga0070673_100123618 | Ga0070673_1001236182 | 84 |
| 7 | 3300005548 | Ga0070665_101235679 | Ga0070665_1012356792 | 84 |
| 8 | 3300005578 | Ga0068854_100198460 | Ga0068854_1001984602 | 84 |
| 9 | 3300005616 | Ga0068852_100310452 | Ga0068852_1003104522 | 84 |
| 10 | 3300006844 | Ga0075428_100794878 | Ga0075428_1007948781 | 84 |
| 11 | 3300031852 | Ga0307410_10736014 | Ga0307410_107360142 | 84 |
| 12 | 3300005329 | Ga0070683_100144385 | Ga0070683_1001443852 | 85 |
| 13 | 3300005331 | Ga0070670_100147629 | Ga0070670_1001476294 | 85 |
| 14 | 3300005336 | Ga0070680_100091698 | Ga0070680_1000916984 | 85 |
| 15 | 3300005339 | Ga0070660_100071292 | Ga0070660_1000712922 | 85 |
| 16 | 3300005344 | Ga0070661_100000785 | Ga0070661_1000007854 | 85 |
| 17 | 3300005366 | Ga0070659_100901085 | Ga0070659_1009010852 | 85 |
| 18 | 3300005435 | Ga0070714_100013821 | Ga0070714_1000138213 | 85 |
| 19 | 3300005458 | Ga0070681_10166976 | Ga0070681_101669762 | 85 |
| 20 | 3300005530 | Ga0070679_100030395 | Ga0070679_1000303954 | 85 |
| 21 | 3300005535 | Ga0070684_100047181 | Ga0070684_1000471812 | 85 |
| 22 | 3300005539 | Ga0068853_100108701 | Ga0068853_1001087013 | 85 |
| 23 | 3300005546 | Ga0070696_100130350 | Ga0070696_1001303502 | 85 |
| 24 | 3300005548 | Ga0070665_100564346 | Ga0070665_1005643462 | 85 |
| 25 | 3300005563 | Ga0068855_100015373 | Ga0068855_1000153732 | 85 |
| 26 | 3300005563 | Ga0068855_102558464 | Ga0068855_1025584642 | 85 |
| 27 | 3300005564 | Ga0070664_100000500 | Ga0070664_10000050021 | 85 |
| 28 | 3300005577 | Ga0068857_100119000 | Ga0068857_1001190004 | 85 |
| 29 | 3300005578 | Ga0068854_100044853 | Ga0068854_1000448534 | 85 |
| 30 | 3300005614 | Ga0068856_100005622 | Ga0068856_10000562212 | 85 |
| 31 | 3300005616 | Ga0068852_100004594 | Ga0068852_1000045949 | 85 |
| 32 | 3300005618 | Ga0068864_100447516 | Ga0068864_1004475161 | 85 |
| 33 | 3300005841 | Ga0068863_100252509 | Ga0068863_1002525092 | 85 |
| 34 | 3300005841 | Ga0068863_100443072 | Ga0068863_1004430722 | 85 |
| 35 | 3300005844 | Ga0068862_100120768 | Ga0068862_1001207683 | 85 |
| 36 | 3300006186 | Ga0075369_10178223 | Ga0075369_101782233 | 85 |
| 37 | 3300009093 | Ga0105240_10037008 | Ga0105240_100370082 | 85 |
| 38 | 3300009545 | Ga0105237_11014655 | Ga0105237_110146552 | 85 |
| 39 | 3300009551 | Ga0105238_10001723 | Ga0105238_1000172320 | 85 |
| 40 | 3300013100 | Ga0157373_10016743 | Ga0157373_100167437 | 85 |
| 41 | 3300013102 | Ga0157371_10089714 | Ga0157371_100897145 | 85 |
| 42 | 3300013104 | Ga0157370_10130729 | Ga0157370_101307293 | 85 |
| 43 | 3300013105 | Ga0157369_10018914 | Ga0157369_100189147 | 85 |
| 44 | 3300013296 | Ga0157374_11121369 | Ga0157374_111213692 | 85 |
| 45 | 3300013307 | Ga0157372_10221992 | Ga0157372_102219923 | 85 |
| 46 | 3300014326 | Ga0157380_13516309 | Ga0157380_135163091 | 85 |
| 47 | 3300014968 | Ga0157379_11434233 | Ga0157379_114342331 | 85 |
| 48 | 3300053090 | Ga0500646_0000709 | Ga0500646_0000709_4507_4809 | 85 |
| 49 | 3300053103 | Ga0500555_136848 | Ga0500555_136848_111_413 | 85 |
| 50 | 3300053130 | Ga0500642_0458646 | Ga0500642_0458646_132_434 | 85 |
| 51 | 3300053139 | Ga0500568_0029148 | Ga0500568_0029148_1854_2156 | 85 |
| 52 | 3300053151 | Ga0500604_0007191 | Ga0500604_0007191_2580_2882 | 85 |
| 53 | 3300005290 | Ga0065712_10440649 | Ga0065712_104406491 | 86 |
| 54 | 3300005327 | Ga0070658_10269124 | Ga0070658_102691243 | 86 |
| 55 | 3300005328 | Ga0070676_10004641 | Ga0070676_100046418 | 86 |
| 56 | 3300005329 | Ga0070683_100062398 | Ga0070683_1000623983 | 86 |
| 57 | 3300005330 | Ga0070690_100043614 | Ga0070690_1000436142 | 86 |
| 58 | 3300005331 | Ga0070670_100254643 | Ga0070670_1002546432 | 86 |
| 59 | 3300005334 | Ga0068869_100134026 | Ga0068869_1001340264 | 86 |
| 60 | 3300005334 | Ga0068869_100159550 | Ga0068869_1001595504 | 86 |
| 61 | 3300005335 | Ga0070666_10001230 | Ga0070666_1000123014 | 86 |
| 62 | 3300005338 | Ga0068868_100004809 | Ga0068868_1000048094 | 86 |
| 63 | 3300005340 | Ga0070689_100007760 | Ga0070689_1000077608 | 86 |
| 64 | 3300005340 | Ga0070689_100110142 | Ga0070689_1001101423 | 86 |
| 65 | 3300005343 | Ga0070687_100857270 | Ga0070687_1008572702 | 86 |
| 66 | 3300005344 | Ga0070661_100519571 | Ga0070661_1005195712 | 86 |
| 67 | 3300005353 | Ga0070669_100001757 | Ga0070669_1000017577 | 86 |
| 68 | 3300005353 | Ga0070669_101377899 | Ga0070669_1013778991 | 86 |
| 69 | 3300005354 | Ga0070675_100007265 | Ga0070675_1000072657 | 86 |
| 70 | 3300005354 | Ga0070675_100038922 | Ga0070675_1000389222 | 86 |
| 71 | 3300005354 | Ga0070675_100471981 | Ga0070675_1004719812 | 86 |
| 72 | 3300005355 | Ga0070671_100046594 | Ga0070671_1000465944 | 86 |
| 73 | 3300005355 | Ga0070671_100190312 | Ga0070671_1001903122 | 86 |
| 74 | 3300005355 | Ga0070671_101079366 | Ga0070671_1010793662 | 86 |
| 75 | 3300005356 | Ga0070674_100031169 | Ga0070674_1000311695 | 86 |
| 76 | 3300005356 | Ga0070674_100842464 | Ga0070674_1008424642 | 86 |
| 77 | 3300005364 | Ga0070673_100006593 | Ga0070673_1000065933 | 86 |
| 78 | 3300005364 | Ga0070673_100330993 | Ga0070673_1003309933 | 86 |
| 79 | 3300005364 | Ga0070673_101567873 | Ga0070673_1015678731 | 86 |
| 80 | 3300005365 | Ga0070688_100003852 | Ga0070688_1000038524 | 86 |
| 81 | 3300005365 | Ga0070688_100094015 | Ga0070688_1000940153 | 86 |
| 82 | 3300005366 | Ga0070659_100172176 | Ga0070659_1001721762 | 86 |
| 83 | 3300005366 | Ga0070659_100231919 | Ga0070659_1002319192 | 86 |
| 84 | 3300005366 | Ga0070659_101832160 | Ga0070659_1018321601 | 86 |
| 85 | 3300005367 | Ga0070667_100007565 | Ga0070667_1000075658 | 86 |
| 86 | 3300005367 | Ga0070667_101020981 | Ga0070667_1010209812 | 86 |
| 87 | 3300005434 | Ga0070709_11042667 | Ga0070709_110426671 | 86 |
| 88 | 3300005435 | Ga0070714_100559952 | Ga0070714_1005599522 | 86 |
| 89 | 3300005438 | Ga0070701_10255983 | Ga0070701_102559832 | 86 |
| 90 | 3300005440 | Ga0070705_101811455 | Ga0070705_1018114551 | 86 |
| 91 | 3300005441 | Ga0070700_101555775 | Ga0070700_1015557752 | 86 |
| 92 | 3300005444 | Ga0070694_100066381 | Ga0070694_1000663812 | 86 |
| 93 | 3300005445 | Ga0070708_100000176 | Ga0070708_10000017626 | 86 |
| 94 | 3300005455 | Ga0070663_100110580 | Ga0070663_1001105803 | 86 |
| 95 | 3300005456 | Ga0070678_100009598 | Ga0070678_1000095986 | 86 |
| 96 | 3300005459 | Ga0068867_100004874 | Ga0068867_1000048748 | 86 |
| 97 | 3300005459 | Ga0068867_100435100 | Ga0068867_1004351001 | 86 |
| 98 | 3300005530 | Ga0070679_100088432 | Ga0070679_1000884323 | 86 |
| 99 | 3300005530 | Ga0070679_101131920 | Ga0070679_1011319202 | 86 |
| 100 | 3300005535 | Ga0070684_102294683 | Ga0070684_1022946832 | 86 |
| 101 | 3300005536 | Ga0070697_101886844 | Ga0070697_1018868441 | 86 |
| 102 | 3300005539 | Ga0068853_100172532 | Ga0068853_1001725322 | 86 |
| 103 | 3300005539 | Ga0068853_100742324 | Ga0068853_1007423242 | 86 |
| 104 | 3300005543 | Ga0070672_100004907 | Ga0070672_1000049078 | 86 |
| 105 | 3300005543 | Ga0070672_100086091 | Ga0070672_1000860914 | 86 |
| 106 | 3300005547 | Ga0070693_100737051 | Ga0070693_1007370512 | 86 |
| 107 | 3300005548 | Ga0070665_100028490 | Ga0070665_1000284905 | 86 |
| 108 | 3300005548 | Ga0070665_101108426 | Ga0070665_1011084262 | 86 |
| 109 | 3300005549 | Ga0070704_100697125 | Ga0070704_1006971252 | 86 |
| 110 | 3300005563 | Ga0068855_100017343 | Ga0068855_1000173434 | 86 |
| 111 | 3300005564 | Ga0070664_100052899 | Ga0070664_1000528992 | 86 |
| 112 | 3300005577 | Ga0068857_100150732 | Ga0068857_1001507324 | 86 |
| 113 | 3300005616 | Ga0068852_100019402 | Ga0068852_1000194027 | 86 |
| 114 | 3300005617 | Ga0068859_100009973 | Ga0068859_1000099735 | 86 |
| 115 | 3300005617 | Ga0068859_100150522 | Ga0068859_1001505224 | 86 |
| 116 | 3300005618 | Ga0068864_100007408 | Ga0068864_1000074084 | 86 |
| 117 | 3300005719 | Ga0068861_100115886 | Ga0068861_1001158862 | 86 |
| 118 | 3300005719 | Ga0068861_100470687 | Ga0068861_1004706872 | 86 |
| 119 | 3300005719 | Ga0068861_100547588 | Ga0068861_1005475883 | 86 |
| 120 | 3300005719 | Ga0068861_102490552 | Ga0068861_1024905522 | 86 |
| 121 | 3300005840 | Ga0068870_10009071 | Ga0068870_100090714 | 86 |
| 122 | 3300005840 | Ga0068870_10051327 | Ga0068870_100513273 | 86 |
| 123 | 3300005841 | Ga0068863_100093698 | Ga0068863_1000936985 | 86 |
| 124 | 3300005842 | Ga0068858_100025579 | Ga0068858_1000255794 | 86 |
| 125 | 3300005842 | Ga0068858_100396600 | Ga0068858_1003966002 | 86 |
| 126 | 3300005843 | Ga0068860_100006112 | Ga0068860_1000061129 | 86 |
| 127 | 3300005843 | Ga0068860_100521085 | Ga0068860_1005210852 | 86 |
| 128 | 3300005843 | Ga0068860_101936172 | Ga0068860_1019361722 | 86 |
| 129 | 3300006028 | Ga0070717_10345772 | Ga0070717_103457723 | 86 |
| 130 | 3300006058 | Ga0075432_10111680 | Ga0075432_101116803 | 86 |
| 131 | 3300006163 | Ga0070715_10865156 | Ga0070715_108651562 | 86 |
| 132 | 3300006178 | Ga0075367_11091498 | Ga0075367_110914982 | 86 |
| 133 | 3300006237 | Ga0097621_100003143 | Ga0097621_1000031431 | 86 |
| 134 | 3300006358 | Ga0068871_100010536 | Ga0068871_1000105364 | 86 |
| 135 | 3300006358 | Ga0068871_101012871 | Ga0068871_1010128712 | 86 |
| 136 | 3300006852 | Ga0075433_10055370 | Ga0075433_100553703 | 86 |
| 137 | 3300006881 | Ga0068865_100006382 | Ga0068865_1000063825 | 86 |
| 138 | 3300006931 | Ga0097620_100009973 | Ga0097620_1000099735 | 86 |
| 139 | 3300006931 | Ga0097620_100150522 | Ga0097620_1001505224 | 86 |
| 140 | 3300009093 | Ga0105240_10073361 | Ga0105240_100733614 | 86 |
| 141 | 3300009098 | Ga0105245_10288760 | Ga0105245_102887602 | 86 |
| 142 | 3300009174 | Ga0105241_11158392 | Ga0105241_111583922 | 86 |
| 143 | 3300009177 | Ga0105248_10001222 | Ga0105248_1000122212 | 86 |
| 144 | 3300009177 | Ga0105248_10716146 | Ga0105248_107161463 | 86 |
| 145 | 3300009177 | Ga0105248_11306506 | Ga0105248_113065061 | 86 |
| 146 | 3300009551 | Ga0105238_10080184 | Ga0105238_100801842 | 86 |
| 147 | 3300009553 | Ga0105249_10338327 | Ga0105249_103383272 | 86 |
| 148 | 3300009553 | Ga0105249_10987269 | Ga0105249_109872692 | 86 |
| 149 | 3300013105 | Ga0157369_10006741 | Ga0157369_1000674110 | 86 |
| 150 | 3300013296 | Ga0157374_10003730 | Ga0157374_100037305 | 86 |
| 151 | 3300013297 | Ga0157378_10152831 | Ga0157378_101528313 | 86 |
| 152 | 3300013297 | Ga0157378_10909694 | Ga0157378_109096942 | 86 |
| 153 | 3300013297 | Ga0157378_12335308 | Ga0157378_123353082 | 86 |
| 154 | 3300013306 | Ga0163162_10155174 | Ga0163162_101551742 | 86 |
| 155 | 3300013306 | Ga0163162_10543796 | Ga0163162_105437962 | 86 |
| 156 | 3300013306 | Ga0163162_10707591 | Ga0163162_107075912 | 86 |
| 157 | 3300013307 | Ga0157372_10331504 | Ga0157372_103315043 | 86 |
| 158 | 3300013308 | Ga0157375_10092999 | Ga0157375_100929993 | 86 |
| 159 | 3300013308 | Ga0157375_10200138 | Ga0157375_102001384 | 86 |
| 160 | 3300014326 | Ga0157380_11182038 | Ga0157380_111820381 | 86 |
| 161 | 3300014326 | Ga0157380_11551554 | Ga0157380_115515542 | 86 |
| 162 | 3300014745 | Ga0157377_10931561 | Ga0157377_109315612 | 86 |
| 163 | 3300014968 | Ga0157379_10003011 | Ga0157379_100030116 | 86 |
| 164 | 3300014969 | Ga0157376_10175529 | Ga0157376_101755292 | 86 |
| 165 | 3300014969 | Ga0157376_11918145 | Ga0157376_119181452 | 86 |
| 166 | 3300021361 | Ga0213872_10312706 | Ga0213872_103127061 | 86 |
| 167 | 3300025315 | Ga0207697_10007205 | Ga0207697_100072054 | 86 |
| 168 | 3300025899 | Ga0207642_10241373 | Ga0207642_102413733 | 86 |
| 169 | 3300025901 | Ga0207688_10089483 | Ga0207688_100894834 | 86 |
| 170 | 3300025901 | Ga0207688_10173786 | Ga0207688_101737862 | 86 |
| 171 | 3300025903 | Ga0207680_10409345 | Ga0207680_104093452 | 86 |
| 172 | 3300025907 | Ga0207645_10000867 | Ga0207645_100008678 | 86 |
| 173 | 3300025908 | Ga0207643_10557962 | Ga0207643_105579622 | 86 |
| 174 | 3300025909 | Ga0207705_10081090 | Ga0207705_100810902 | 86 |
| 175 | 3300025909 | Ga0207705_10407838 | Ga0207705_104078383 | 86 |
| 176 | 3300025913 | Ga0207695_10183388 | Ga0207695_101833882 | 86 |
| 177 | 3300025916 | Ga0207663_11112999 | Ga0207663_111129992 | 86 |
| 178 | 3300025920 | Ga0207649_10453604 | Ga0207649_104536042 | 86 |
| 179 | 3300025923 | Ga0207681_10034544 | Ga0207681_100345444 | 86 |
| 180 | 3300025923 | Ga0207681_11211557 | Ga0207681_112115572 | 86 |
| 181 | 3300025924 | Ga0207694_10095613 | Ga0207694_100956133 | 86 |
| 182 | 3300025925 | Ga0207650_10011061 | Ga0207650_100110613 | 86 |
| 183 | 3300025926 | Ga0207659_10013628 | Ga0207659_100136282 | 86 |
| 184 | 3300025926 | Ga0207659_10100244 | Ga0207659_101002444 | 86 |
| 185 | 3300025931 | Ga0207644_10081230 | Ga0207644_100812304 | 86 |
| 186 | 3300025931 | Ga0207644_10089114 | Ga0207644_100891142 | 86 |
| 187 | 3300025932 | Ga0207690_10317504 | Ga0207690_103175042 | 86 |
| 188 | 3300025932 | Ga0207690_10432339 | Ga0207690_104323392 | 86 |
| 189 | 3300025933 | Ga0207706_10714602 | Ga0207706_107146021 | 86 |
| 190 | 3300025936 | Ga0207670_10013294 | Ga0207670_100132944 | 86 |
| 191 | 3300025937 | Ga0207669_10046076 | Ga0207669_100460764 | 86 |
| 192 | 3300025940 | Ga0207691_10000328 | Ga0207691_1000032835 | 86 |
| 193 | 3300025940 | Ga0207691_10010980 | Ga0207691_100109806 | 86 |
| 194 | 3300025941 | Ga0207711_10015761 | Ga0207711_100157616 | 86 |
| 195 | 3300025941 | Ga0207711_10715892 | Ga0207711_107158921 | 86 |
| 196 | 3300025941 | Ga0207711_10847151 | Ga0207711_108471511 | 86 |
| 197 | 3300025942 | Ga0207689_10003815 | Ga0207689_100038159 | 86 |
| 198 | 3300025944 | Ga0207661_10135413 | Ga0207661_101354132 | 86 |
| 199 | 3300025945 | Ga0207679_10046035 | Ga0207679_100460352 | 86 |
| 200 | 3300025949 | Ga0207667_10031658 | Ga0207667_100316582 | 86 |
| 201 | 3300025960 | Ga0207651_10004469 | Ga0207651_100044692 | 86 |
| 202 | 3300025960 | Ga0207651_10068842 | Ga0207651_100688423 | 86 |
| 203 | 3300025961 | Ga0207712_10539464 | Ga0207712_105394642 | 86 |
| 204 | 3300025972 | Ga0207668_10014932 | Ga0207668_100149321 | 86 |
| 205 | 3300025972 | Ga0207668_10029422 | Ga0207668_100294222 | 86 |
| 206 | 3300025986 | Ga0207658_10006246 | Ga0207658_100062464 | 86 |
| 207 | 3300025986 | Ga0207658_11999601 | Ga0207658_119996012 | 86 |
| 208 | 3300026023 | Ga0207677_10118183 | Ga0207677_101181833 | 86 |
| 209 | 3300026035 | Ga0207703_10017883 | Ga0207703_100178835 | 86 |
| 210 | 3300026035 | Ga0207703_10077338 | Ga0207703_100773382 | 86 |
| 211 | 3300026041 | Ga0207639_10128935 | Ga0207639_101289352 | 86 |
| 212 | 3300026041 | Ga0207639_10505870 | Ga0207639_105058702 | 86 |
| 213 | 3300026067 | Ga0207678_10139321 | Ga0207678_101393213 | 86 |
| 214 | 3300026075 | Ga0207708_10242072 | Ga0207708_102420722 | 86 |
| 215 | 3300026075 | Ga0207708_10918721 | Ga0207708_109187212 | 86 |
| 216 | 3300026088 | Ga0207641_10005581 | Ga0207641_1000558111 | 86 |
| 217 | 3300026089 | Ga0207648_10001220 | Ga0207648_1000122014 | 86 |
| 218 | 3300026095 | Ga0207676_10051112 | Ga0207676_100511121 | 86 |
| 219 | 3300026095 | Ga0207676_10152353 | Ga0207676_101523531 | 86 |
| 220 | 3300026116 | Ga0207674_10067479 | Ga0207674_100674792 | 86 |
| 221 | 3300026118 | Ga0207675_100021731 | Ga0207675_1000217316 | 86 |
| 222 | 3300026118 | Ga0207675_101968851 | Ga0207675_1019688512 | 86 |
| 223 | 3300026118 | Ga0207675_102377388 | Ga0207675_1023773882 | 86 |
| 224 | 3300026121 | Ga0207683_10000807 | Ga0207683_1000080711 | 86 |
| 225 | 3300026121 | Ga0207683_10079818 | Ga0207683_100798184 | 86 |
| 226 | 3300027907 | Ga0207428_10393414 | Ga0207428_103934141 | 86 |
| 227 | 3300028381 | Ga0268264_10011189 | Ga0268264_100111892 | 86 |
| 228 | 3300028381 | Ga0268264_11307719 | Ga0268264_113077192 | 86 |
| 229 | 3300031903 | Ga0307407_10199927 | Ga0307407_101999273 | 86 |
| 230 | 3300031911 | Ga0307412_10269425 | Ga0307412_102694252 | 86 |
| 231 | 3300031911 | Ga0307412_10346995 | Ga0307412_103469952 | 86 |
| 232 | 3300031995 | Ga0307409_102428258 | Ga0307409_1024282582 | 86 |
| 233 | 3300032002 | Ga0307416_100928746 | Ga0307416_1009287462 | 86 |
| 234 | 3300032126 | Ga0307415_100741191 | Ga0307415_1007411912 | 86 |
| 235 | 3300035117 | Ga0373953_0297824 | Ga0373953_0297824_94_354 | 86 |
| 236 | 3300035172 | Ga0373955_0255228 | Ga0373955_0255228_574_834 | 86 |
| 237 | 3300037471 | Ga0395905_0286839 | Ga0395905_0286839_661_921 | 86 |
| 238 | 3300038443 | Ga0395901_1259029 | Ga0395901_1259029_370_630 | 86 |
| 239 | 3300039447 | Ga0436361_0962106 | Ga0436361_0962106_820_1080 | 86 |
| 240 | 3300041413 | Ga0439465_0097522 | Ga0439465_0097522_647_910 | 86 |
| 241 | 3300041463 | Ga0451804_0410469 | Ga0451804_0410469_252_512 | 86 |
| 242 | 3300041512 | Ga0451853_2798496 | Ga0451853_2798496_759_1019 | 86 |
| 243 | 3300042134 | Ga0450898_125407 | Ga0450898_125407_69_332 | 86 |
| 244 | 3300042156 | Ga0439446_0376820 | Ga0439446_0376820_68_331 | 86 |
| 245 | 3300046539 | Ga0495621_0250034 | Ga0495621_0250034_162_422 | 86 |
| 246 | 3300046663 | Ga0495635_0354361 | Ga0495635_0354361_22_282 | 86 |
| 247 | 3300046683 | Ga0495658_0488500 | Ga0495658_0488500_311_571 | 86 |
| 248 | 3300046683 | Ga0495658_1018286 | Ga0495658_1018286_212_472 | 86 |
| 249 | 3300048904 | Ga0496101_1584087 | Ga0496101_1584087_202_462 | 86 |
| 250 | 3300048910 | Ga0496107_0155747 | Ga0496107_0155747_1283_1543 | 86 |
| 251 | 3300048911 | Ga0496108_1228064 | Ga0496108_1228064_22_282 | 86 |
| 252 | 3300048917 | Ga0496114_0857914 | Ga0496114_0857914_48_308 | 86 |
| 253 | 3300048929 | Ga0496126_0005752 | Ga0496126_0005752_5426_5686 | 86 |
| 254 | 3300048929 | Ga0496126_0036269 | Ga0496126_0036269_2033_2293 | 86 |
| 255 | 3300050494 | nmdc:mga06z11_917056_c1 | nmdc:mga06z11_917056_c1_239_505 | 86 |
| 256 | 3300050515 | nmdc:mga0a205_66931_c1 | nmdc:mga0a205_66931_c1_2458_2718 | 86 |
| 257 | 3300053084 | Ga0495595_0287598 | Ga0495595_0287598_539_799 | 86 |
| 258 | 3300059421 | Ga0590071_061993 | Ga0590071_061993_149_409 | 86 |
| 259 | 3300005331 | Ga0070670_100128287 | Ga0070670_1001282873 | 87 |
| 260 | 3300005334 | Ga0068869_100888967 | Ga0068869_1008889671 | 87 |
| 261 | 3300005335 | Ga0070666_10093476 | Ga0070666_100934762 | 87 |
| 262 | 3300005338 | Ga0068868_100009230 | Ga0068868_1000092304 | 87 |
| 263 | 3300005344 | Ga0070661_100047224 | Ga0070661_1000472244 | 87 |
| 264 | 3300005345 | Ga0070692_10105524 | Ga0070692_101055242 | 87 |
| 265 | 3300005353 | Ga0070669_100319997 | Ga0070669_1003199972 | 87 |
| 266 | 3300005354 | Ga0070675_100018828 | Ga0070675_1000188285 | 87 |
| 267 | 3300005355 | Ga0070671_100107065 | Ga0070671_1001070654 | 87 |
| 268 | 3300005367 | Ga0070667_100096629 | Ga0070667_1000966294 | 87 |
| 269 | 3300005406 | Ga0070703_10624365 | Ga0070703_106243652 | 87 |
| 270 | 3300005444 | Ga0070694_100574433 | Ga0070694_1005744332 | 87 |
| 271 | 3300005455 | Ga0070663_100294014 | Ga0070663_1002940142 | 87 |
| 272 | 3300005456 | Ga0070678_100411185 | Ga0070678_1004111852 | 87 |
| 273 | 3300005457 | Ga0070662_100175919 | Ga0070662_1001759193 | 87 |
| 274 | 3300005458 | Ga0070681_10009497 | Ga0070681_100094976 | 87 |
| 275 | 3300005530 | Ga0070679_100000683 | Ga0070679_10000068311 | 87 |
| 276 | 3300005535 | Ga0070684_100105223 | Ga0070684_1001052234 | 87 |
| 277 | 3300005539 | Ga0068853_100099418 | Ga0068853_1000994181 | 87 |
| 278 | 3300005539 | Ga0068853_100159109 | Ga0068853_1001591093 | 87 |
| 279 | 3300005543 | Ga0070672_100113318 | Ga0070672_1001133183 | 87 |
| 280 | 3300005548 | Ga0070665_100907261 | Ga0070665_1009072612 | 87 |
| 281 | 3300005549 | Ga0070704_100283342 | Ga0070704_1002833422 | 87 |
| 282 | 3300005564 | Ga0070664_100259809 | Ga0070664_1002598092 | 87 |
| 283 | 3300005564 | Ga0070664_100319236 | Ga0070664_1003192362 | 87 |
| 284 | 3300005578 | Ga0068854_100024222 | Ga0068854_1000242224 | 87 |
| 285 | 3300005615 | Ga0070702_100597197 | Ga0070702_1005971972 | 87 |
| 286 | 3300005616 | Ga0068852_100038154 | Ga0068852_1000381543 | 87 |
| 287 | 3300005617 | Ga0068859_100771337 | Ga0068859_1007713372 | 87 |
| 288 | 3300005618 | Ga0068864_100035918 | Ga0068864_1000359185 | 87 |
| 289 | 3300005834 | Ga0068851_10034148 | Ga0068851_100341483 | 87 |
| 290 | 3300005841 | Ga0068863_100315452 | Ga0068863_1003154522 | 87 |
| 291 | 3300005841 | Ga0068863_100683562 | Ga0068863_1006835622 | 87 |
| 292 | 3300006237 | Ga0097621_100010141 | Ga0097621_1000101412 | 87 |
| 293 | 3300006237 | Ga0097621_100020362 | Ga0097621_1000203624 | 87 |
| 294 | 3300006358 | Ga0068871_100091440 | Ga0068871_1000914405 | 87 |
| 295 | 3300006358 | Ga0068871_100112370 | Ga0068871_1001123702 | 87 |
| 296 | 3300006881 | Ga0068865_100722915 | Ga0068865_1007229151 | 87 |
| 297 | 3300006931 | Ga0097620_100771184 | Ga0097620_1007711842 | 87 |
| 298 | 3300009098 | Ga0105245_10047077 | Ga0105245_100470774 | 87 |
| 299 | 3300009148 | Ga0105243_10265943 | Ga0105243_102659432 | 87 |
| 300 | 3300009177 | Ga0105248_10168778 | Ga0105248_101687782 | 87 |
| 301 | 3300009177 | Ga0105248_10418119 | Ga0105248_104181192 | 87 |
| 302 | 3300009553 | Ga0105249_13560933 | Ga0105249_135609332 | 87 |
| 303 | 3300009553 | Ga0105249_13584910 | Ga0105249_135849101 | 87 |
| 304 | 3300013100 | Ga0157373_10006331 | Ga0157373_100063314 | 87 |
| 305 | 3300013102 | Ga0157371_10785278 | Ga0157371_107852782 | 87 |
| 306 | 3300013104 | Ga0157370_10002179 | Ga0157370_100021794 | 87 |
| 307 | 3300013104 | Ga0157370_10055513 | Ga0157370_100555135 | 87 |
| 308 | 3300013104 | Ga0157370_10225326 | Ga0157370_102253262 | 87 |
| 309 | 3300013296 | Ga0157374_10017807 | Ga0157374_100178076 | 87 |
| 310 | 3300013296 | Ga0157374_10072948 | Ga0157374_100729483 | 87 |
| 311 | 3300013297 | Ga0157378_10149202 | Ga0157378_101492023 | 87 |
| 312 | 3300013306 | Ga0163162_10053479 | Ga0163162_100534792 | 87 |
| 313 | 3300013306 | Ga0163162_10812500 | Ga0163162_108125002 | 87 |
| 314 | 3300013307 | Ga0157372_10039797 | Ga0157372_100397973 | 87 |
| 315 | 3300013307 | Ga0157372_10165010 | Ga0157372_101650102 | 87 |
| 316 | 3300013308 | Ga0157375_10015066 | Ga0157375_100150666 | 87 |
| 317 | 3300013308 | Ga0157375_10135338 | Ga0157375_101353383 | 87 |
| 318 | 3300014497 | Ga0182008_10217977 | Ga0182008_102179772 | 87 |
| 319 | 3300014968 | Ga0157379_10046158 | Ga0157379_100461584 | 87 |
| 320 | 3300014969 | Ga0157376_10409600 | Ga0157376_104096002 | 87 |
| 321 | 3300025912 | Ga0207707_10002721 | Ga0207707_100027219 | 87 |
| 322 | 3300025920 | Ga0207649_11024048 | Ga0207649_110240482 | 87 |
| 323 | 3300025921 | Ga0207652_10000882 | Ga0207652_1000088221 | 87 |
| 324 | 3300025934 | Ga0207686_10083788 | Ga0207686_100837882 | 87 |
| 325 | 3300025935 | Ga0207709_10488234 | Ga0207709_104882343 | 87 |
| 326 | 3300025938 | Ga0207704_10252442 | Ga0207704_102524423 | 87 |
| 327 | 3300025941 | Ga0207711_10026765 | Ga0207711_100267652 | 87 |
| 328 | 3300025941 | Ga0207711_10172502 | Ga0207711_101725022 | 87 |
| 329 | 3300025945 | Ga0207679_10226757 | Ga0207679_102267573 | 87 |
| 330 | 3300025961 | Ga0207712_10679884 | Ga0207712_106798841 | 87 |
| 331 | 3300026035 | Ga0207703_10173499 | Ga0207703_101734992 | 87 |
| 332 | 3300026041 | Ga0207639_10061090 | Ga0207639_100610904 | 87 |
| 333 | 3300026067 | Ga0207678_10962332 | Ga0207678_109623321 | 87 |
| 334 | 3300026088 | Ga0207641_10515446 | Ga0207641_105154462 | 87 |
| 335 | 3300026116 | Ga0207674_10078312 | Ga0207674_100783123 | 87 |
| 336 | 3300035086 | Ga0373934_0191341 | Ga0373934_0191341_349_612 | 87 |
| 337 | 3300035120 | Ga0373957_0030941 | Ga0373957_0030941_549_812 | 87 |
| 338 | 3300035172 | Ga0373955_0128794 | Ga0373955_0128794_274_537 | 87 |
| 339 | 3300035692 | Ga0373935_0077542 | Ga0373935_0077542_613_876 | 87 |
| 340 | 3300042001 | Ga0439441_176034 | Ga0439441_176034_15_278 | 87 |
| 341 | 3300044656 | Ga0466969_0029420 | Ga0466969_0029420_1312_1635 | 87 |
| 342 | 3300044668 | Ga0466980_0259552 | Ga0466980_0259552_281_604 | 87 |
| 343 | 3300044684 | Ga0466966_0026828 | Ga0466966_0026828_2012_2335 | 87 |
| 344 | 3300044684 | Ga0466966_0218177 | Ga0466966_0218177_368_631 | 87 |
| 345 | 3300044693 | Ga0466961_0054494 | Ga0466961_0054494_1334_1657 | 87 |
| 346 | 3300044693 | Ga0466961_0341621 | Ga0466961_0341621_627_890 | 87 |
| 347 | 3300044712 | Ga0453684_0779249 | Ga0453684_0779249_474_737 | 87 |
| 348 | 3300044765 | Ga0466970_0226356 | Ga0466970_0226356_142_465 | 87 |
| 349 | 3300044842 | Ga0466957_0031256 | Ga0466957_0031256_2309_2572 | 87 |
| 350 | 3300045049 | Ga0466959_0012017 | Ga0466959_0012017_3912_4235 | 87 |
| 351 | 3300045836 | Ga0466958_0432522 | Ga0466958_0432522_504_767 | 87 |
| 352 | 3300046454 | Ga0495592_0305150 | Ga0495592_0305150_681_944 | 87 |
| 353 | 3300046462 | Ga0495651_0070347 | Ga0495651_0070347_372_635 | 87 |
| 354 | 3300046511 | Ga0495608_0013310 | Ga0495608_0013310_5147_5410 | 87 |
| 355 | 3300046516 | Ga0495628_0070524 | Ga0495628_0070524_765_1028 | 87 |
| 356 | 3300046536 | Ga0495587_0175271 | Ga0495587_0175271_119_382 | 87 |
| 357 | 3300046559 | Ga0495667_0090853 | Ga0495667_0090853_1041_1304 | 87 |
| 358 | 3300046675 | Ga0495657_0441877 | Ga0495657_0441877_241_504 | 87 |
| 359 | 3300046679 | Ga0495623_0032712 | Ga0495623_0032712_1569_1832 | 87 |
| 360 | 3300046809 | Ga0495600_0275561 | Ga0495600_0275561_168_431 | 87 |
| 361 | 3300047471 | Ga0495684_0191930 | Ga0495684_0191930_578_841 | 87 |
| 362 | 3300048088 | Ga0495602_0227371 | Ga0495602_0227371_319_582 | 87 |
| 363 | 3300049744 | Ga0501083_0015423 | Ga0501083_0015423_4466_4729 | 87 |
| 364 | 3300053077 | Ga0495601_0116042 | Ga0495601_0116042_474_737 | 87 |
| 365 | 3300053084 | Ga0495595_0168288 | Ga0495595_0168288_69_332 | 87 |
| 366 | 3300053085 | Ga0495619_0012027 | Ga0495619_0012027_176_439 | 87 |
| 367 | 3300053085 | Ga0495619_0272528 | Ga0495619_0272528_65_328 | 87 |
| 368 | 3300061719 | Ga0466962_0571458 | Ga0466962_0571458_293_556 | 87 |
| 369 | 3300005327 | Ga0070658_10120193 | Ga0070658_101201932 | 88 |
| 370 | 3300005327 | Ga0070658_10585171 | Ga0070658_105851712 | 88 |
| 371 | 3300005328 | Ga0070676_10140447 | Ga0070676_101404472 | 88 |
| 372 | 3300005328 | Ga0070676_10423591 | Ga0070676_104235912 | 88 |
| 373 | 3300005331 | Ga0070670_100333836 | Ga0070670_1003338361 | 88 |
| 374 | 3300005338 | Ga0068868_100772308 | Ga0068868_1007723081 | 88 |
| 375 | 3300005339 | Ga0070660_100002471 | Ga0070660_1000024716 | 88 |
| 376 | 3300005339 | Ga0070660_100604638 | Ga0070660_1006046382 | 88 |
| 377 | 3300005344 | Ga0070661_100009775 | Ga0070661_1000097752 | 88 |
| 378 | 3300005353 | Ga0070669_100108367 | Ga0070669_1001083674 | 88 |
| 379 | 3300005354 | Ga0070675_100088072 | Ga0070675_1000880722 | 88 |
| 380 | 3300005355 | Ga0070671_100003687 | Ga0070671_1000036875 | 88 |
| 381 | 3300005364 | Ga0070673_101151183 | Ga0070673_1011511831 | 88 |
| 382 | 3300005366 | Ga0070659_100015059 | Ga0070659_1000150592 | 88 |
| 383 | 3300005366 | Ga0070659_100252883 | Ga0070659_1002528832 | 88 |
| 384 | 3300005366 | Ga0070659_100376300 | Ga0070659_1003763002 | 88 |
| 385 | 3300005367 | Ga0070667_100147172 | Ga0070667_1001471724 | 88 |
| 386 | 3300005455 | Ga0070663_100017475 | Ga0070663_1000174756 | 88 |
| 387 | 3300005455 | Ga0070663_101735025 | Ga0070663_1017350252 | 88 |
| 388 | 3300005457 | Ga0070662_100000258 | Ga0070662_10000025817 | 88 |
| 389 | 3300005457 | Ga0070662_101970907 | Ga0070662_1019709071 | 88 |
| 390 | 3300005458 | Ga0070681_10363007 | Ga0070681_103630072 | 88 |
| 391 | 3300005530 | Ga0070679_101224906 | Ga0070679_1012249061 | 88 |
| 392 | 3300005539 | Ga0068853_100015034 | Ga0068853_1000150342 | 88 |
| 393 | 3300005539 | Ga0068853_101916189 | Ga0068853_1019161892 | 88 |
| 394 | 3300005563 | Ga0068855_100004105 | Ga0068855_10000410514 | 88 |
| 395 | 3300005563 | Ga0068855_100214285 | Ga0068855_1002142852 | 88 |
| 396 | 3300005563 | Ga0068855_100646092 | Ga0068855_1006460922 | 88 |
| 397 | 3300005563 | Ga0068855_101094096 | Ga0068855_1010940962 | 88 |
| 398 | 3300005564 | Ga0070664_100000205 | Ga0070664_10000020527 | 88 |
| 399 | 3300005564 | Ga0070664_100030140 | Ga0070664_1000301403 | 88 |
| 400 | 3300005577 | Ga0068857_101216951 | Ga0068857_1012169512 | 88 |
| 401 | 3300005578 | Ga0068854_100110870 | Ga0068854_1001108702 | 88 |
| 402 | 3300005614 | Ga0068856_100000487 | Ga0068856_10000048731 | 88 |
| 403 | 3300005614 | Ga0068856_100292509 | Ga0068856_1002925092 | 88 |
| 404 | 3300005616 | Ga0068852_100081928 | Ga0068852_1000819282 | 88 |
| 405 | 3300005616 | Ga0068852_100275693 | Ga0068852_1002756933 | 88 |
| 406 | 3300005616 | Ga0068852_101371654 | Ga0068852_1013716542 | 88 |
| 407 | 3300005841 | Ga0068863_101340471 | Ga0068863_1013404711 | 88 |
| 408 | 3300006237 | Ga0097621_100623117 | Ga0097621_1006231172 | 88 |
| 409 | 3300006358 | Ga0068871_100393557 | Ga0068871_1003935572 | 88 |
| 410 | 3300009174 | Ga0105241_11783467 | Ga0105241_117834671 | 88 |
| 411 | 3300013100 | Ga0157373_10003392 | Ga0157373_100033922 | 88 |
| 412 | 3300013102 | Ga0157371_10000365 | Ga0157371_1000036535 | 88 |
| 413 | 3300013104 | Ga0157370_10672044 | Ga0157370_106720442 | 88 |
| 414 | 3300013105 | Ga0157369_10019036 | Ga0157369_100190362 | 88 |
| 415 | 3300013105 | Ga0157369_10442735 | Ga0157369_104427352 | 88 |
| 416 | 3300013296 | Ga0157374_10256674 | Ga0157374_102566744 | 88 |
| 417 | 3300013297 | Ga0157378_10344976 | Ga0157378_103449762 | 88 |
| 418 | 3300013307 | Ga0157372_10025043 | Ga0157372_100250432 | 88 |
| 419 | 3300013307 | Ga0157372_10996673 | Ga0157372_109966732 | 88 |
| 420 | 3300013307 | Ga0157372_12807186 | Ga0157372_128071861 | 88 |
| 421 | 3300014969 | Ga0157376_10366566 | Ga0157376_103665662 | 88 |
| 422 | 3300025904 | Ga0207647_10318264 | Ga0207647_103182642 | 88 |
| 423 | 3300025907 | Ga0207645_10013883 | Ga0207645_100138834 | 88 |
| 424 | 3300025907 | Ga0207645_10125489 | Ga0207645_101254893 | 88 |
| 425 | 3300025909 | Ga0207705_10074796 | Ga0207705_100747962 | 88 |
| 426 | 3300025917 | Ga0207660_10562897 | Ga0207660_105628972 | 88 |
| 427 | 3300025919 | Ga0207657_10000967 | Ga0207657_1000096730 | 88 |
| 428 | 3300025920 | Ga0207649_10159379 | Ga0207649_101593792 | 88 |
| 429 | 3300025923 | Ga0207681_10048752 | Ga0207681_100487524 | 88 |
| 430 | 3300025926 | Ga0207659_10291320 | Ga0207659_102913202 | 88 |
| 431 | 3300025929 | Ga0207664_10822441 | Ga0207664_108224412 | 88 |
| 432 | 3300025931 | Ga0207644_10013484 | Ga0207644_100134844 | 88 |
| 433 | 3300025932 | Ga0207690_10000438 | Ga0207690_1000043824 | 88 |
| 434 | 3300025933 | Ga0207706_10000024 | Ga0207706_10000024130 | 88 |
| 435 | 3300025940 | Ga0207691_10039517 | Ga0207691_100395172 | 88 |
| 436 | 3300025942 | Ga0207689_10665233 | Ga0207689_106652332 | 88 |
| 437 | 3300025945 | Ga0207679_10001794 | Ga0207679_1000179415 | 88 |
| 438 | 3300025945 | Ga0207679_11085493 | Ga0207679_110854932 | 88 |
| 439 | 3300025949 | Ga0207667_10002406 | Ga0207667_100024063 | 88 |
| 440 | 3300025949 | Ga0207667_10473498 | Ga0207667_104734981 | 88 |
| 441 | 3300025949 | Ga0207667_10483639 | Ga0207667_104836392 | 88 |
| 442 | 3300025960 | Ga0207651_10205844 | Ga0207651_102058443 | 88 |
| 443 | 3300025981 | Ga0207640_10050956 | Ga0207640_100509562 | 88 |
| 444 | 3300025981 | Ga0207640_10365750 | Ga0207640_103657502 | 88 |
| 445 | 3300025986 | Ga0207658_10086633 | Ga0207658_100866332 | 88 |
| 446 | 3300026023 | Ga0207677_11480381 | Ga0207677_114803812 | 88 |
| 447 | 3300026041 | Ga0207639_10034366 | Ga0207639_100343663 | 88 |
| 448 | 3300026067 | Ga0207678_10017556 | Ga0207678_100175567 | 88 |
| 449 | 3300026078 | Ga0207702_10007209 | Ga0207702_100072096 | 88 |
| 450 | 3300026088 | Ga0207641_10140326 | Ga0207641_101403262 | 88 |
| 451 | 3300026118 | Ga0207675_101984349 | Ga0207675_1019843492 | 88 |
| 452 | 3300026142 | Ga0207698_10017978 | Ga0207698_100179782 | 88 |
| 453 | 3300027876 | Ga0209974_10013052 | Ga0209974_100130524 | 88 |
| 454 | 3300031548 | Ga0307408_100012040 | Ga0307408_1000120404 | 88 |
| 455 | 3300031712 | Ga0265342_10242554 | Ga0265342_102425541 | 88 |
| 456 | 3300031731 | Ga0307405_10009517 | Ga0307405_100095172 | 88 |
| 457 | 3300031824 | Ga0307413_10006886 | Ga0307413_100068864 | 88 |
| 458 | 3300031824 | Ga0307413_11927412 | Ga0307413_119274122 | 88 |
| 459 | 3300031852 | Ga0307410_10006796 | Ga0307410_100067962 | 88 |
| 460 | 3300031901 | Ga0307406_10001453 | Ga0307406_1000145310 | 88 |
| 461 | 3300031903 | Ga0307407_10006443 | Ga0307407_100064435 | 88 |
| 462 | 3300031911 | Ga0307412_10022460 | Ga0307412_100224604 | 88 |
| 463 | 3300031995 | Ga0307409_100013622 | Ga0307409_1000136222 | 88 |
| 464 | 3300031995 | Ga0307409_100204427 | Ga0307409_1002044274 | 88 |
| 465 | 3300032002 | Ga0307416_100006433 | Ga0307416_1000064332 | 88 |
| 466 | 3300032004 | Ga0307414_10137857 | Ga0307414_101378574 | 88 |
| 467 | 3300032005 | Ga0307411_10000456 | Ga0307411_1000045611 | 88 |
| 468 | 3300032126 | Ga0307415_100080891 | Ga0307415_1000808913 | 88 |
| 469 | 3300035241 | Ga0373961_0157475 | Ga0373961_0157475_254_520 | 88 |
| 470 | 3300038996 | Ga0242420_076421 | Ga0242420_076421_83_349 | 88 |
| 471 | 3300042133 | Ga0450896_004241 | Ga0450896_004241_1215_1481 | 88 |
| 472 | 3300042437 | Ga0439444_0078373 | Ga0439444_0078373_315_581 | 88 |
| 473 | 3300042876 | Ga0451577_0183458 | Ga0451577_0183458_850_1116 | 88 |
| 474 | 3300044673 | Ga0453683_0520212 | Ga0453683_0520212_39_305 | 88 |
| 475 | 3300048905 | Ga0496102_0031073 | Ga0496102_0031073_4161_4427 | 88 |
| 476 | 3300048906 | Ga0496103_0010672 | Ga0496103_0010672_2070_2336 | 88 |
| 477 | 3300048909 | Ga0496106_0043122 | Ga0496106_0043122_986_1252 | 88 |
| 478 | 3300048910 | Ga0496107_0002463 | Ga0496107_0002463_4576_4842 | 88 |
| 479 | 3300048912 | Ga0496109_1183987 | Ga0496109_1183987_385_651 | 88 |
| 480 | 3300048913 | Ga0496110_1410153 | Ga0496110_1410153_272_538 | 88 |
| 481 | 3300048915 | Ga0496112_1305975 | Ga0496112_1305975_286_552 | 88 |
| 482 | 3300049571 | Ga0501034_0014114 | Ga0501034_0014114_5781_6047 | 88 |
| 483 | 3300049571 | Ga0501034_0387494 | Ga0501034_0387494_673_939 | 88 |
| 484 | 3300049580 | Ga0501046_0274123 | Ga0501046_0274123_132_398 | 88 |
| 485 | 3300049581 | Ga0501047_0004566 | Ga0501047_0004566_8202_8468 | 88 |
| 486 | 3300049581 | Ga0501047_0023350 | Ga0501047_0023350_2724_2990 | 88 |
| 487 | 3300049581 | Ga0501047_0485179 | Ga0501047_0485179_86_352 | 88 |
| 488 | 3300049581 | Ga0501047_0565800 | Ga0501047_0565800_677_943 | 88 |
| 489 | 3300049582 | Ga0501048_0658102 | Ga0501048_0658102_353_619 | 88 |
| 490 | 3300049583 | Ga0501067_0003639 | Ga0501067_0003639_3356_3622 | 88 |
| 491 | 3300049583 | Ga0501067_0103722 | Ga0501067_0103722_243_509 | 88 |
| 492 | 3300049584 | Ga0501068_0007747 | Ga0501068_0007747_4617_4883 | 88 |
| 493 | 3300049585 | Ga0501069_0007681 | Ga0501069_0007681_4617_4883 | 88 |
| 494 | 3300049585 | Ga0501069_0136668 | Ga0501069_0136668_762_1028 | 88 |
| 495 | 3300049586 | Ga0501070_0005698 | Ga0501070_0005698_4695_4961 | 88 |
| 496 | 3300049586 | Ga0501070_0132421 | Ga0501070_0132421_897_1163 | 88 |
| 497 | 3300049588 | Ga0501072_0012097 | Ga0501072_0012097_1167_1433 | 88 |
| 498 | 3300049589 | Ga0501073_0002490 | Ga0501073_0002490_8647_8913 | 88 |
| 499 | 3300049589 | Ga0501073_0009577 | Ga0501073_0009577_5626_5892 | 88 |
| 500 | 3300049590 | Ga0501074_0001555 | Ga0501074_0001555_4838_5104 | 88 |
| 501 | 3300049590 | Ga0501074_0019444 | Ga0501074_0019444_2833_3099 | 88 |
| 502 | 3300049593 | Ga0501077_1033310 | Ga0501077_1033310_147_413 | 88 |
| 503 | 3300049741 | Ga0501079_0011145 | Ga0501079_0011145_5518_5784 | 88 |
| 504 | 3300049741 | Ga0501079_0867276 | Ga0501079_0867276_43_309 | 88 |
| 505 | 3300049742 | Ga0501080_0016096 | Ga0501080_0016096_3443_3709 | 88 |
| 506 | 3300049742 | Ga0501080_0024511 | Ga0501080_0024511_1070_1336 | 88 |
| 507 | 3300049742 | Ga0501080_0039895 | Ga0501080_0039895_3151_3417 | 88 |
| 508 | 3300049742 | Ga0501080_0188975 | Ga0501080_0188975_1207_1473 | 88 |
| 509 | 3300049744 | Ga0501083_0003639 | Ga0501083_0003639_3852_4118 | 88 |
| 510 | 3300049744 | Ga0501083_0055475 | Ga0501083_0055475_886_1152 | 88 |
| 511 | 3300049822 | Ga0501035_0181555 | Ga0501035_0181555_1099_1365 | 88 |
| 512 | 3300049822 | Ga0501035_0192526 | Ga0501035_0192526_1184_1450 | 88 |
| 513 | 3300049822 | Ga0501035_0541592 | Ga0501035_0541592_419_685 | 88 |
| 514 | 3300049823 | Ga0501044_0088928 | Ga0501044_0088928_1551_1817 | 88 |
| 515 | 3300054114 | Ga0501084_0061508 | Ga0501084_0061508_1807_2073 | 88 |
| 516 | 3300060353 | Ga0501082_0030848 | Ga0501082_0030848_4211_4477 | 88 |
| 517 | 3300060353 | Ga0501082_0056471 | Ga0501082_0056471_2715_2981 | 88 |
| 518 | 3300005328 | Ga0070676_10063927 | Ga0070676_100639272 | 89 |
| 519 | 3300005331 | Ga0070670_100017326 | Ga0070670_1000173268 | 89 |
| 520 | 3300005334 | Ga0068869_100007461 | Ga0068869_1000074616 | 89 |
| 521 | 3300005335 | Ga0070666_10420425 | Ga0070666_104204251 | 89 |
| 522 | 3300005338 | Ga0068868_100027870 | Ga0068868_1000278702 | 89 |
| 523 | 3300005340 | Ga0070689_100126550 | Ga0070689_1001265501 | 89 |
| 524 | 3300005347 | Ga0070668_100110996 | Ga0070668_1001109962 | 89 |
| 525 | 3300005353 | Ga0070669_100012988 | Ga0070669_1000129887 | 89 |
| 526 | 3300005364 | Ga0070673_100012953 | Ga0070673_1000129533 | 89 |
| 527 | 3300005365 | Ga0070688_100118034 | Ga0070688_1001180342 | 89 |
| 528 | 3300005367 | Ga0070667_100000716 | Ga0070667_10000071624 | 89 |
| 529 | 3300005440 | Ga0070705_100032030 | Ga0070705_1000320302 | 89 |
| 530 | 3300005456 | Ga0070678_100301934 | Ga0070678_1003019343 | 89 |
| 531 | 3300005457 | Ga0070662_100195724 | Ga0070662_1001957242 | 89 |
| 532 | 3300005459 | Ga0068867_100002291 | Ga0068867_1000022913 | 89 |
| 533 | 3300005543 | Ga0070672_100018279 | Ga0070672_1000182792 | 89 |
| 534 | 3300005549 | Ga0070704_100486918 | Ga0070704_1004869181 | 89 |
| 535 | 3300005577 | Ga0068857_100024151 | Ga0068857_1000241512 | 89 |
| 536 | 3300005616 | Ga0068852_101635288 | Ga0068852_1016352882 | 89 |
| 537 | 3300005617 | Ga0068859_100000638 | Ga0068859_10000063823 | 89 |
| 538 | 3300005618 | Ga0068864_100002774 | Ga0068864_10000277415 | 89 |
| 539 | 3300005718 | Ga0068866_10459742 | Ga0068866_104597422 | 89 |
| 540 | 3300005719 | Ga0068861_100001272 | Ga0068861_1000012723 | 89 |
| 541 | 3300005840 | Ga0068870_10011654 | Ga0068870_100116544 | 89 |
| 542 | 3300005842 | Ga0068858_100028541 | Ga0068858_1000285417 | 89 |
| 543 | 3300005843 | Ga0068860_100003943 | Ga0068860_1000039433 | 89 |
| 544 | 3300005844 | Ga0068862_100004934 | Ga0068862_1000049343 | 89 |
| 545 | 3300006852 | Ga0075433_10493006 | Ga0075433_104930062 | 89 |
| 546 | 3300006852 | Ga0075433_11615795 | Ga0075433_116157951 | 89 |
| 547 | 3300006881 | Ga0068865_100206659 | Ga0068865_1002066592 | 89 |
| 548 | 3300006931 | Ga0097620_100000638 | Ga0097620_10000063823 | 89 |
| 549 | 3300009011 | Ga0105251_10231531 | Ga0105251_102315312 | 89 |
| 550 | 3300009098 | Ga0105245_11414059 | Ga0105245_114140592 | 89 |
| 551 | 3300009101 | Ga0105247_10503076 | Ga0105247_105030762 | 89 |
| 552 | 3300009177 | Ga0105248_10022056 | Ga0105248_100220563 | 89 |
| 553 | 3300010375 | Ga0105239_11372543 | Ga0105239_113725432 | 89 |
| 554 | 3300011119 | Ga0105246_11238289 | Ga0105246_112382891 | 89 |
| 555 | 3300013100 | Ga0157373_10110230 | Ga0157373_101102303 | 89 |
| 556 | 3300013297 | Ga0157378_10023467 | Ga0157378_100234674 | 89 |
| 557 | 3300013306 | Ga0163162_10837554 | Ga0163162_108375542 | 89 |
| 558 | 3300013307 | Ga0157372_10771443 | Ga0157372_107714431 | 89 |
| 559 | 3300014325 | Ga0163163_10005582 | Ga0163163_100055825 | 89 |
| 560 | 3300014968 | Ga0157379_10001432 | Ga0157379_100014323 | 89 |
| 561 | 3300025735 | Ga0207713_1212763 | Ga0207713_12127632 | 89 |
| 562 | 3300025899 | Ga0207642_10057739 | Ga0207642_100577392 | 89 |
| 563 | 3300025900 | Ga0207710_10236747 | Ga0207710_102367472 | 89 |
| 564 | 3300025907 | Ga0207645_10552458 | Ga0207645_105524582 | 89 |
| 565 | 3300025908 | Ga0207643_10036956 | Ga0207643_100369562 | 89 |
| 566 | 3300025911 | Ga0207654_10691308 | Ga0207654_106913082 | 89 |
| 567 | 3300025919 | Ga0207657_10494951 | Ga0207657_104949512 | 89 |
| 568 | 3300025923 | Ga0207681_10020008 | Ga0207681_100200082 | 89 |
| 569 | 3300025925 | Ga0207650_10010149 | Ga0207650_100101493 | 89 |
| 570 | 3300025933 | Ga0207706_10226861 | Ga0207706_102268612 | 89 |
| 571 | 3300025938 | Ga0207704_10117960 | Ga0207704_101179602 | 89 |
| 572 | 3300025940 | Ga0207691_10028115 | Ga0207691_100281152 | 89 |
| 573 | 3300025941 | Ga0207711_10043445 | Ga0207711_100434452 | 89 |
| 574 | 3300025942 | Ga0207689_10000978 | Ga0207689_100009788 | 89 |
| 575 | 3300025949 | Ga0207667_10100540 | Ga0207667_101005402 | 89 |
| 576 | 3300025949 | Ga0207667_11288131 | Ga0207667_112881311 | 89 |
| 577 | 3300025960 | Ga0207651_10017821 | Ga0207651_100178213 | 89 |
| 578 | 3300025972 | Ga0207668_10037570 | Ga0207668_100375702 | 89 |
| 579 | 3300025986 | Ga0207658_10026736 | Ga0207658_100267364 | 89 |
| 580 | 3300026023 | Ga0207677_10039527 | Ga0207677_100395272 | 89 |
| 581 | 3300026035 | Ga0207703_10011529 | Ga0207703_100115296 | 89 |
| 582 | 3300026088 | Ga0207641_10009917 | Ga0207641_100099173 | 89 |
| 583 | 3300026089 | Ga0207648_10000726 | Ga0207648_100007263 | 89 |
| 584 | 3300026095 | Ga0207676_10003141 | Ga0207676_100031411 | 89 |
| 585 | 3300026116 | Ga0207674_10028559 | Ga0207674_100285596 | 89 |
| 586 | 3300026118 | Ga0207675_100001344 | Ga0207675_1000013443 | 89 |
| 587 | 3300026121 | Ga0207683_10339286 | Ga0207683_103392863 | 89 |
| 588 | 3300026142 | Ga0207698_11153052 | Ga0207698_111530522 | 89 |
| 589 | 3300028380 | Ga0268265_10033997 | Ga0268265_100339974 | 89 |
| 590 | 3300028381 | Ga0268264_10009963 | Ga0268264_100099633 | 89 |
| 591 | 3300035691 | Ga0373931_0189560 | Ga0373931_0189560_63_332 | 89 |
| 592 | 3300042876 | Ga0451577_0437630 | Ga0451577_0437630_58_327 | 89 |
| 593 | 3300044712 | Ga0453684_0397304 | Ga0453684_0397304_884_1153 | 89 |
| 594 | 3300045051 | Ga0451576_0427578 | Ga0451576_0427578_142_411 | 89 |
| 595 | 3300048905 | Ga0496102_0019973 | Ga0496102_0019973_779_1048 | 89 |
| 596 | 3300048909 | Ga0496106_0503832 | Ga0496106_0503832_72_341 | 89 |
| 597 | 3300048909 | Ga0496106_0965233 | Ga0496106_0965233_37_306 | 89 |
| 598 | 3300048911 | Ga0496108_0092966 | Ga0496108_0092966_1672_1941 | 89 |
| 599 | 3300048913 | Ga0496110_1841710 | Ga0496110_1841710_114_383 | 89 |
| 600 | 3300049571 | Ga0501034_0070809 | Ga0501034_0070809_206_475 | 89 |
| 601 | 3300050514 | nmdc:mga08x19_424194_c1 | nmdc:mga08x19_424194_c1_547_816 | 89 |
| 602 | 3300005335 | Ga0070666_10019652 | Ga0070666_100196523 | 90 |
| 603 | 3300005355 | Ga0070671_100410893 | Ga0070671_1004108933 | 90 |
| 604 | 3300005364 | Ga0070673_100001191 | Ga0070673_1000011914 | 90 |
| 605 | 3300005366 | Ga0070659_101745808 | Ga0070659_1017458082 | 90 |
| 606 | 3300005457 | Ga0070662_100558390 | Ga0070662_1005583902 | 90 |
| 607 | 3300005543 | Ga0070672_100174893 | Ga0070672_1001748931 | 90 |
| 608 | 3300005617 | Ga0068859_100489877 | Ga0068859_1004898772 | 90 |
| 609 | 3300005719 | Ga0068861_100697871 | Ga0068861_1006978712 | 90 |
| 610 | 3300005834 | Ga0068851_10847701 | Ga0068851_108477011 | 90 |
| 611 | 3300005841 | Ga0068863_100973243 | Ga0068863_1009732431 | 90 |
| 612 | 3300005841 | Ga0068863_101283340 | Ga0068863_1012833402 | 90 |
| 613 | 3300005842 | Ga0068858_100426940 | Ga0068858_1004269402 | 90 |
| 614 | 3300006931 | Ga0097620_100489901 | Ga0097620_1004899012 | 90 |
| 615 | 3300009098 | Ga0105245_11786626 | Ga0105245_117866262 | 90 |
| 616 | 3300009177 | Ga0105248_10090985 | Ga0105248_100909855 | 90 |
| 617 | 3300009177 | Ga0105248_10820765 | Ga0105248_108207652 | 90 |
| 618 | 3300009551 | Ga0105238_12664283 | Ga0105238_126642832 | 90 |
| 619 | 3300013306 | Ga0163162_11199103 | Ga0163162_111991031 | 90 |
| 620 | 3300013308 | Ga0157375_10011973 | Ga0157375_100119733 | 90 |
| 621 | 3300025321 | Ga0207656_10473145 | Ga0207656_104731451 | 90 |
| 622 | 3300025931 | Ga0207644_10039263 | Ga0207644_100392634 | 90 |
| 623 | 3300025932 | Ga0207690_11185349 | Ga0207690_111853492 | 90 |
| 624 | 3300025933 | Ga0207706_10085073 | Ga0207706_100850732 | 90 |
| 625 | 3300025940 | Ga0207691_10179539 | Ga0207691_101795393 | 90 |
| 626 | 3300025960 | Ga0207651_10380903 | Ga0207651_103809033 | 90 |
| 627 | 3300025986 | Ga0207658_10363691 | Ga0207658_103636911 | 90 |
| 628 | 3300026035 | Ga0207703_10239466 | Ga0207703_102394662 | 90 |
| 629 | 3300026088 | Ga0207641_10875119 | Ga0207641_108751192 | 90 |
| 630 | 3300026118 | Ga0207675_100198307 | Ga0207675_1001983072 | 90 |
| 631 | 3300026142 | Ga0207698_10068036 | Ga0207698_100680364 | 90 |
| 632 | 3300028379 | Ga0268266_11562769 | Ga0268266_115627692 | 90 |
| 633 | 3300041494 | Ga0451837_1437381 | Ga0451837_1437381_253_525 | 90 |
| 634 | 3300048903 | Ga0496100_0387926 | Ga0496100_0387926_546_818 | 90 |
| 635 | 3300048904 | Ga0496101_0821129 | Ga0496101_0821129_81_353 | 90 |
| 636 | 3300048905 | Ga0496102_0566374 | Ga0496102_0566374_195_467 | 90 |
| 637 | 3300048909 | Ga0496106_0042223 | Ga0496106_0042223_665_937 | 90 |
| 638 | 3300048911 | Ga0496108_0257919 | Ga0496108_0257919_371_643 | 90 |
| 639 | 3300048912 | Ga0496109_1221697 | Ga0496109_1221697_133_405 | 90 |
| 640 | 3300048913 | Ga0496110_0510561 | Ga0496110_0510561_535_807 | 90 |
| 641 | 3300005347 | Ga0070668_101975705 | Ga0070668_1019757051 | 91 |
| 642 | 3300006353 | Ga0075370_10000886 | Ga0075370_1000088615 | 91 |
| 643 | 3300017792 | Ga0163161_11387878 | Ga0163161_113878781 | 91 |
| 644 | 3300027395 | Ga0209996_1026298 | Ga0209996_10262981 | 91 |
| 645 | 3300027471 | Ga0209995_1002494 | Ga0209995_10024942 | 91 |
| 646 | 3300027526 | Ga0209968_1088468 | Ga0209968_10884681 | 91 |
| 647 | 3300027543 | Ga0209999_1009637 | Ga0209999_10096372 | 91 |
| 648 | 3300027614 | Ga0209970_1020437 | Ga0209970_10204371 | 91 |
| 649 | 3300027695 | Ga0209966_1006452 | Ga0209966_10064522 | 91 |
| 650 | 3300027876 | Ga0209974_10000041 | Ga0209974_1000004115 | 91 |
| 651 | 3300050496 | nmdc:mga07m45_257_c1 | nmdc:mga07m45_257_c1_20101_20391 | 91 |
| 652 | 3300026142 | Ga0207698_10658000 | Ga0207698_106580002 | 92 |
| 653 | 3300025949 | Ga0207667_10332986 | Ga0207667_103329862 | 93 |
| 654 | 3300037418 | Ga0395900_0358506 | Ga0395900_0358506_318_599 | 93 |
| 655 | 3300037471 | Ga0395905_0029632 | Ga0395905_0029632_319_600 | 93 |
| 656 | 3300038443 | Ga0395901_0082541 | Ga0395901_0082541_1790_2071 | 93 |
| 657 | 3300044683 | Ga0466965_0086054 | Ga0466965_0086054_1096_1380 | 94 |
| 658 | 3300044719 | Ga0466971_0203093 | Ga0466971_0203093_313_597 | 94 |
| 659 | 3300044842 | Ga0466957_0452812 | Ga0466957_0452812_355_639 | 94 |
| 660 | 3300061719 | Ga0466962_0634592 | Ga0466962_0634592_26_310 | 94 |
| 661 | 3300005344 | Ga0070661_101872498 | Ga0070661_1018724981 | 95 |
| 662 | 3300005614 | Ga0068856_100124311 | Ga0068856_1001243113 | 95 |
| 663 | 3300013100 | Ga0157373_11192806 | Ga0157373_111928062 | 95 |
| 664 | 3300025920 | Ga0207649_10525075 | Ga0207649_105250752 | 95 |
| 665 | 3300026078 | Ga0207702_10167053 | Ga0207702_101670532 | 95 |
| 666 | 3300003323 | rootH1_10003280 | rootH1_100032803 | 101 |
| 667 | 3300002738 | JGI25154J39366_1000759 | JGI25154J39366_100075916 | 102 |
| 668 | 3300002741 | JGI25157J39369_1000008 | JGI25157J39369_1000008117 | 102 |
| 669 | 3300005329 | Ga0070683_100188343 | Ga0070683_1001883432 | 102 |
| 670 | 3300005330 | Ga0070690_100096629 | Ga0070690_1000966293 | 102 |
| 671 | 3300005334 | Ga0068869_100719307 | Ga0068869_1007193071 | 102 |
| 672 | 3300005338 | Ga0068868_100776305 | Ga0068868_1007763052 | 102 |
| 673 | 3300005339 | Ga0070660_100230916 | Ga0070660_1002309162 | 102 |
| 674 | 3300005340 | Ga0070689_100122599 | Ga0070689_1001225992 | 102 |
| 675 | 3300005456 | Ga0070678_101666321 | Ga0070678_1016663211 | 102 |
| 676 | 3300005577 | Ga0068857_100004942 | Ga0068857_10000494210 | 102 |
| 677 | 3300005614 | Ga0068856_100014860 | Ga0068856_1000148608 | 102 |
| 678 | 3300005616 | Ga0068852_100127927 | Ga0068852_1001279272 | 102 |
| 679 | 3300005843 | Ga0068860_100951762 | Ga0068860_1009517622 | 102 |
| 680 | 3300006358 | Ga0068871_101144036 | Ga0068871_1011440362 | 102 |
| 681 | 3300009093 | Ga0105240_10294319 | Ga0105240_102943192 | 102 |
| 682 | 3300009174 | Ga0105241_10027331 | Ga0105241_100273315 | 102 |
| 683 | 3300009176 | Ga0105242_10821436 | Ga0105242_108214361 | 102 |
| 684 | 3300009545 | Ga0105237_10067353 | Ga0105237_100673534 | 102 |
| 685 | 3300009551 | Ga0105238_10217803 | Ga0105238_102178032 | 102 |
| 686 | 3300010375 | Ga0105239_10477713 | Ga0105239_104777132 | 102 |
| 687 | 3300011119 | Ga0105246_10302173 | Ga0105246_103021732 | 102 |
| 688 | 3300013105 | Ga0157369_10096857 | Ga0157369_100968574 | 102 |
| 689 | 3300013297 | Ga0157378_10554362 | Ga0157378_105543622 | 102 |
| 690 | 3300013307 | Ga0157372_10977766 | Ga0157372_109777662 | 102 |
| 691 | 3300013308 | Ga0157375_10610952 | Ga0157375_106109522 | 102 |
| 692 | 3300014325 | Ga0163163_10909109 | Ga0163163_109091091 | 102 |
| 693 | 3300014969 | Ga0157376_10579486 | Ga0157376_105794861 | 102 |
| 694 | 3300025246 | Ga0209646_1000039 | Ga0209646_1000039140 | 102 |
| 695 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006461 | 102 |
| 696 | 3300025253 | Ga0209677_100914 | Ga0209677_1009143 | 102 |
| 697 | 3300025256 | Ga0209759_1000020 | Ga0209759_1000020116 | 102 |
| 698 | 3300025911 | Ga0207654_10119050 | Ga0207654_101190502 | 102 |
| 699 | 3300025913 | Ga0207695_10104184 | Ga0207695_101041843 | 102 |
| 700 | 3300025914 | Ga0207671_10032764 | Ga0207671_100327642 | 102 |
| 701 | 3300025919 | Ga0207657_10066809 | Ga0207657_100668093 | 102 |
| 702 | 3300025924 | Ga0207694_11224054 | Ga0207694_112240541 | 102 |
| 703 | 3300025934 | Ga0207686_10414787 | Ga0207686_104147871 | 102 |
| 704 | 3300025936 | Ga0207670_10380942 | Ga0207670_103809422 | 102 |
| 705 | 3300025942 | Ga0207689_10110096 | Ga0207689_101100963 | 102 |
| 706 | 3300025944 | Ga0207661_10129937 | Ga0207661_101299373 | 102 |
| 707 | 3300025949 | Ga0207667_10174500 | Ga0207667_101745003 | 102 |
| 708 | 3300026078 | Ga0207702_10000310 | Ga0207702_1000031047 | 102 |
| 709 | 3300026088 | Ga0207641_10943063 | Ga0207641_109430631 | 102 |
| 710 | 3300026116 | Ga0207674_10080603 | Ga0207674_100806033 | 102 |
| 711 | 3300026118 | Ga0207675_100088142 | Ga0207675_1000881424 | 102 |
| 712 | 3300026121 | Ga0207683_11283609 | Ga0207683_112836092 | 102 |
| 713 | 3300026142 | Ga0207698_10350955 | Ga0207698_103509552 | 102 |
| 714 | 3300037471 | Ga0395905_0396436 | Ga0395905_0396436_642_950 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar