F476973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 328 | 708 | 452 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100003218|Ga0070670_10000321811 |
| Length | 504 |
| Sequence | MRADEGNQAIPNPTLPLKGRAHSFAAVVGAAQFSDTLRMLPVVALVGRPNVGKSTLFNVLTRTRDALVHDLPGLTRDRHYGICRLGEREFVVVDTGGLSGEKEGIDALTAHQAELAIDEADIVALVVDARDGVLPQDRNILGRLRKHDKPLLLIVNKIDGVDEGNARSEFASFGFAEPVLTSSAHSRGLSELLEAVEAHLPAVDADALEAADPTDEGIRVAIVGRPNVGKSTLVNRLLGEDRVVVSDIAGTTRDSIRVPLERDGKKYTLIDTAGVRRRARVEEAVEKFSVIKTLQSIAAANVVVLMLDAKEGVSEQDATLIGHVLDEGRALVVAANKWDGLSTYEREQCRNSLERRLDFVPFVKPVFISGLHGSGLAELMRAIVRAHKSATREFGSSELTKALEQAYEGYQPPLVRGHAPKLRFAHPGGTNPPTIVIHGSRTRHIAEGYQRYLENFFRKRFKLEGTPIRIAFKETVNPFAGRKNVLTEGQLRKRQRMIRNAKKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 4 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 5 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 6 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 7 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 188 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 191 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 201 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 202 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 203 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 221 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 222 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 223 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 224 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 225 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 228 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 229 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 230 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 231 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 321 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 322 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0 |
| Isolates | 0.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 1.12 |
| Rhizosphere | 92.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001335 | 3300001915 | Bacteria | 7179 |
| 2 | JGI24735J21928_10000384 | 3300002067 | Bacteria | 15443 |
| 3 | JGI25162J39368_1002209 | 3300002737 | Bacteria | 8012 |
| 4 | JGI25162J39368_1002625 | 3300002737 | Bacteria | 6685 |
| 5 | JGI25157J39369_1000653 | 3300002741 | Bacteria | 19231 |
| 6 | JGI25165J46597_1002505 | 3300003214 | Bacteria | 5821 |
| 7 | rootH2_10029880 | 3300003320 | Bacteria | 4608 |
| 8 | rootH2_10072900 | 3300003320 | Bacteria | 3477 |
| 9 | rootH1_10006213 | 3300003323 | Bacteria | 24132 |
| 10 | rootH1_10012258 | 3300003323 | Bacteria | 148276 |
| 11 | Ga0065715_10098672 | 3300005293 | Bacteria | 3514 |
| 12 | Ga0065707_10000479 | 3300005295 | Bacteria | 32900 |
| 13 | Ga0065707_10082343 | 3300005295 | Bacteria | 16603 |
| 14 | Ga0065707_10155562 | 3300005295 | Bacteria | 1612 |
| 15 | Ga0070658_10005958 | 3300005327 | Bacteria | 9891 |
| 16 | Ga0070658_10016622 | 3300005327 | Bacteria | 5888 |
| 17 | Ga0070658_10031632 | 3300005327 | Bacteria | 4250 |
| 18 | Ga0070658_10186300 | 3300005327 | Bacteria | 1748 |
| 19 | Ga0070676_10029821 | 3300005328 | Bacteria | 3106 |
| 20 | Ga0070676_10038981 | 3300005328 | Bacteria | 2746 |
| 21 | Ga0070683_100063514 | 3300005329 | Bacteria | 3435 |
| 22 | Ga0070683_100166358 | 3300005329 | Bacteria | 2092 |
| 23 | Ga0070690_100000927 | 3300005330 | Bacteria | 14948 |
| 24 | Ga0070670_100003218 | 3300005331 | Bacteria | 13478 |
| 25 | Ga0068869_100001406 | 3300005334 | Bacteria | 14234 |
| 26 | Ga0068869_100077913 | 3300005334 | Bacteria | 2467 |
| 27 | Ga0070666_10000763 | 3300005335 | Bacteria | 19462 |
| 28 | Ga0070666_10003471 | 3300005335 | Bacteria | 9553 |
| 29 | Ga0070680_100001378 | 3300005336 | Bacteria | 17575 |
| 30 | Ga0070680_100002509 | 3300005336 | Bacteria | 13595 |
| 31 | Ga0070680_100005660 | 3300005336 | Bacteria | 9473 |
| 32 | Ga0070680_100039071 | 3300005336 | Bacteria | 3840 |
| 33 | Ga0070680_100051977 | 3300005336 | Bacteria | 3345 |
| 34 | Ga0070682_100001534 | 3300005337 | Bacteria | 12954 |
| 35 | Ga0070682_100019159 | 3300005337 | Bacteria | 4010 |
| 36 | Ga0068868_100000449 | 3300005338 | Bacteria | 27621 |
| 37 | Ga0070660_100000988 | 3300005339 | Bacteria | 19062 |
| 38 | Ga0070660_100023049 | 3300005339 | Bacteria | 4609 |
| 39 | Ga0070660_100043099 | 3300005339 | Bacteria | 3447 |
| 40 | Ga0070660_100138456 | 3300005339 | Bacteria | 1951 |
| 41 | Ga0070689_100007325 | 3300005340 | Bacteria | 7701 |
| 42 | Ga0070689_100032645 | 3300005340 | Bacteria | 3961 |
| 43 | Ga0070689_100117232 | 3300005340 | Bacteria | 2124 |
| 44 | Ga0070689_100181860 | 3300005340 | Bacteria | 1708 |
| 45 | Ga0070691_10009951 | 3300005341 | Bacteria | 4332 |
| 46 | Ga0070687_100000354 | 3300005343 | Bacteria | 15624 |
| 47 | Ga0070661_100008376 | 3300005344 | Bacteria | 7144 |
| 48 | Ga0070661_100076407 | 3300005344 | Bacteria | 2468 |
| 49 | Ga0070661_100107019 | 3300005344 | Bacteria | 2085 |
| 50 | Ga0070692_10005127 | 3300005345 | Bacteria | 5544 |
| 51 | Ga0070692_10041774 | 3300005345 | Bacteria | 2351 |
| 52 | Ga0070669_100007517 | 3300005353 | Bacteria | 7802 |
| 53 | Ga0070669_100015837 | 3300005353 | Bacteria | 5377 |
| 54 | Ga0070675_100093364 | 3300005354 | Bacteria | 2523 |
| 55 | Ga0070675_100141778 | 3300005354 | Bacteria | 2054 |
| 56 | Ga0070671_100205013 | 3300005355 | Bacteria | 1672 |
| 57 | Ga0070674_100010563 | 3300005356 | Bacteria | 5587 |
| 58 | Ga0070674_100041348 | 3300005356 | Bacteria | 3123 |
| 59 | Ga0070673_100001486 | 3300005364 | Bacteria | 13747 |
| 60 | Ga0070673_100144925 | 3300005364 | Bacteria | 2007 |
| 61 | Ga0070688_100003937 | 3300005365 | Bacteria | 7702 |
| 62 | Ga0070688_100065229 | 3300005365 | Bacteria | 2314 |
| 63 | Ga0070659_100022398 | 3300005366 | Bacteria | 4823 |
| 64 | Ga0070659_100032548 | 3300005366 | Bacteria | 4045 |
| 65 | Ga0070659_100203791 | 3300005366 | Bacteria | 1629 |
| 66 | Ga0070667_100000090 | 3300005367 | Bacteria | 112981 |
| 67 | Ga0070667_100047125 | 3300005367 | Bacteria | 3626 |
| 68 | Ga0070709_10011801 | 3300005434 | Bacteria | 4879 |
| 69 | Ga0070714_100000068 | 3300005435 | Bacteria | 94765 |
| 70 | Ga0070714_100020772 | 3300005435 | Bacteria | 5367 |
| 71 | Ga0070714_100091409 | 3300005435 | Bacteria | 2667 |
| 72 | Ga0070701_10000241 | 3300005438 | Bacteria | 17477 |
| 73 | Ga0070711_100021793 | 3300005439 | Bacteria | 4147 |
| 74 | Ga0070705_100000525 | 3300005440 | Bacteria | 22115 |
| 75 | Ga0070705_100019239 | 3300005440 | Bacteria | 3592 |
| 76 | Ga0070700_100000221 | 3300005441 | Bacteria | 31693 |
| 77 | Ga0070694_100005866 | 3300005444 | Bacteria | 7450 |
| 78 | Ga0070694_100010329 | 3300005444 | Bacteria | 5757 |
| 79 | Ga0070662_100001964 | 3300005457 | Bacteria | 12628 |
| 80 | Ga0070662_100019012 | 3300005457 | Bacteria | 4657 |
| 81 | Ga0070681_10000615 | 3300005458 | Bacteria | 29209 |
| 82 | Ga0070681_10001087 | 3300005458 | Bacteria | 23195 |
| 83 | Ga0070681_10006571 | 3300005458 | Bacteria | 11322 |
| 84 | Ga0070681_10042696 | 3300005458 | Bacteria | 4543 |
| 85 | Ga0070681_10076625 | 3300005458 | Bacteria | 3302 |
| 86 | Ga0068867_100001122 | 3300005459 | Bacteria | 18326 |
| 87 | Ga0068867_100002129 | 3300005459 | Bacteria | 13901 |
| 88 | Ga0070685_10007098 | 3300005466 | Bacteria | 5722 |
| 89 | Ga0070685_10087084 | 3300005466 | Bacteria | 1884 |
| 90 | Ga0070679_100001221 | 3300005530 | Bacteria | 22602 |
| 91 | Ga0070679_100018677 | 3300005530 | Bacteria | 6730 |
| 92 | Ga0070679_100029808 | 3300005530 | Bacteria | 5383 |
| 93 | Ga0070679_100046853 | 3300005530 | Bacteria | 4310 |
| 94 | Ga0070684_100010615 | 3300005535 | Bacteria | 7305 |
| 95 | Ga0070684_100016924 | 3300005535 | Bacteria | 5972 |
| 96 | Ga0070684_100154571 | 3300005535 | Bacteria | 2080 |
| 97 | Ga0070684_100250333 | 3300005535 | Bacteria | 1619 |
| 98 | Ga0070697_100001109 | 3300005536 | Bacteria | 20376 |
| 99 | Ga0068853_100002360 | 3300005539 | Bacteria | 14123 |
| 100 | Ga0068853_100015189 | 3300005539 | Bacteria | 6331 |
| 101 | Ga0068853_100016632 | 3300005539 | Bacteria | 6056 |
| 102 | Ga0068853_100029306 | 3300005539 | Bacteria | 4638 |
| 103 | Ga0068853_100037242 | 3300005539 | Bacteria | 4139 |
| 104 | Ga0068853_100058181 | 3300005539 | Bacteria | 3337 |
| 105 | Ga0068853_100073602 | 3300005539 | Bacteria | 2979 |
| 106 | Ga0068853_100156727 | 3300005539 | Bacteria | 2052 |
| 107 | Ga0070672_100013257 | 3300005543 | Bacteria | 5817 |
| 108 | Ga0070672_100024344 | 3300005543 | Bacteria | 4472 |
| 109 | Ga0070686_100001169 | 3300005544 | Bacteria | 14948 |
| 110 | Ga0070686_100001796 | 3300005544 | Bacteria | 11966 |
| 111 | Ga0070695_100001228 | 3300005545 | Bacteria | 14082 |
| 112 | Ga0070695_100015323 | 3300005545 | Bacteria | 4629 |
| 113 | Ga0070696_100000073 | 3300005546 | Bacteria | 49104 |
| 114 | Ga0070696_100000392 | 3300005546 | Bacteria | 27022 |
| 115 | Ga0070693_100000174 | 3300005547 | Bacteria | 29811 |
| 116 | Ga0070665_100001823 | 3300005548 | Bacteria | 24183 |
| 117 | Ga0070704_100013328 | 3300005549 | Bacteria | 5099 |
| 118 | Ga0070704_100112476 | 3300005549 | Bacteria | 2075 |
| 119 | Ga0068855_100007320 | 3300005563 | Bacteria | 13374 |
| 120 | Ga0068855_100018068 | 3300005563 | Bacteria | 8474 |
| 121 | Ga0068855_100030133 | 3300005563 | Bacteria | 6489 |
| 122 | Ga0068855_100049919 | 3300005563 | Bacteria | 4933 |
| 123 | Ga0068855_100128558 | 3300005563 | Bacteria | 2895 |
| 124 | Ga0068855_100129020 | 3300005563 | Bacteria | 2889 |
| 125 | Ga0068855_100213461 | 3300005563 | Bacteria | 2167 |
| 126 | Ga0070664_100006476 | 3300005564 | Bacteria | 9439 |
| 127 | Ga0070664_100056291 | 3300005564 | Bacteria | 3341 |
| 128 | Ga0070664_100094160 | 3300005564 | Bacteria | 2597 |
| 129 | Ga0068857_100019274 | 3300005577 | Bacteria | 5990 |
| 130 | Ga0068857_100045342 | 3300005577 | Bacteria | 3900 |
| 131 | Ga0068857_100142325 | 3300005577 | Bacteria | 2168 |
| 132 | Ga0068856_100002977 | 3300005614 | Bacteria | 17350 |
| 133 | Ga0068856_100016934 | 3300005614 | Bacteria | 7062 |
| 134 | Ga0068856_100191927 | 3300005614 | Bacteria | 2056 |
| 135 | Ga0068856_100222297 | 3300005614 | Bacteria | 1904 |
| 136 | Ga0070702_100000064 | 3300005615 | Bacteria | 30037 |
| 137 | Ga0070702_100036127 | 3300005615 | Bacteria | 2734 |
| 138 | Ga0070702_100045490 | 3300005615 | Bacteria | 2483 |
| 139 | Ga0068852_100001074 | 3300005616 | Bacteria | 18054 |
| 140 | Ga0068852_100008384 | 3300005616 | Bacteria | 7617 |
| 141 | Ga0068852_100018925 | 3300005616 | Bacteria | 5438 |
| 142 | Ga0068852_100033731 | 3300005616 | Bacteria | 4254 |
| 143 | Ga0068859_100003983 | 3300005617 | Bacteria | 15063 |
| 144 | Ga0068859_100019099 | 3300005617 | Bacteria | 6883 |
| 145 | Ga0068859_100034196 | 3300005617 | Bacteria | 5102 |
| 146 | Ga0068864_100098390 | 3300005618 | Bacteria | 2591 |
| 147 | Ga0068864_100173452 | 3300005618 | Bacteria | 1968 |
| 148 | Ga0068866_10000767 | 3300005718 | Bacteria | 14425 |
| 149 | Ga0068861_100000142 | 3300005719 | Bacteria | 36697 |
| 150 | Ga0068861_100002290 | 3300005719 | Bacteria | 12425 |
| 151 | Ga0068861_100003787 | 3300005719 | Bacteria | 10101 |
| 152 | Ga0068861_100007637 | 3300005719 | Bacteria | 7421 |
| 153 | Ga0068861_100022685 | 3300005719 | Bacteria | 4526 |
| 154 | Ga0068870_10003836 | 3300005840 | Bacteria | 6405 |
| 155 | Ga0068870_10009164 | 3300005840 | Bacteria | 4488 |
| 156 | Ga0068870_10105310 | 3300005840 | Bacteria | 1601 |
| 157 | Ga0068863_100000945 | 3300005841 | Bacteria | 29155 |
| 158 | Ga0068863_100013995 | 3300005841 | Bacteria | 7731 |
| 159 | Ga0068863_100052569 | 3300005841 | Bacteria | 3860 |
| 160 | Ga0068863_100258857 | 3300005841 | Bacteria | 1682 |
| 161 | Ga0068858_100007715 | 3300005842 | Bacteria | 10388 |
| 162 | Ga0068858_100007811 | 3300005842 | Bacteria | 10326 |
| 163 | Ga0068858_100070821 | 3300005842 | Bacteria | 3232 |
| 164 | Ga0068858_100194623 | 3300005842 | Bacteria | 1916 |
| 165 | Ga0068860_100005459 | 3300005843 | Bacteria | 12888 |
| 166 | Ga0068860_100029693 | 3300005843 | Bacteria | 5260 |
| 167 | Ga0068860_100190677 | 3300005843 | Bacteria | 1984 |
| 168 | Ga0068862_100001495 | 3300005844 | Bacteria | 21445 |
| 169 | Ga0068862_100002417 | 3300005844 | Bacteria | 16576 |
| 170 | Ga0068862_100020222 | 3300005844 | Bacteria | 5560 |
| 171 | Ga0068862_100042302 | 3300005844 | Bacteria | 3881 |
| 172 | Ga0081539_10000178 | 3300005985 | Bacteria | 149201 |
| 173 | Ga0097621_100001935 | 3300006237 | Bacteria | 14131 |
| 174 | Ga0097621_100002704 | 3300006237 | Bacteria | 12132 |
| 175 | Ga0068871_100002401 | 3300006358 | Bacteria | 12776 |
| 176 | Ga0068871_100106008 | 3300006358 | Bacteria | 2359 |
| 177 | Ga0075428_100003071 | 3300006844 | Bacteria | 18219 |
| 178 | Ga0075428_100009779 | 3300006844 | Bacteria | 10658 |
| 179 | Ga0075428_100111284 | 3300006844 | Bacteria | 2983 |
| 180 | Ga0075430_100004514 | 3300006846 | Bacteria | 11733 |
| 181 | Ga0075430_100006176 | 3300006846 | Bacteria | 10096 |
| 182 | Ga0075430_100049441 | 3300006846 | Bacteria | 3549 |
| 183 | Ga0075430_100071649 | 3300006846 | Bacteria | 2907 |
| 184 | Ga0075431_100000374 | 3300006847 | Bacteria | 35679 |
| 185 | Ga0075431_100032494 | 3300006847 | Bacteria | 5377 |
| 186 | Ga0075431_100076507 | 3300006847 | Bacteria | 3454 |
| 187 | Ga0075434_100007320 | 3300006871 | Bacteria | 10215 |
| 188 | Ga0075434_100084733 | 3300006871 | Bacteria | 3168 |
| 189 | Ga0075434_100089130 | 3300006871 | Bacteria | 3087 |
| 190 | Ga0075429_100002001 | 3300006880 | Bacteria | 16939 |
| 191 | Ga0075429_100002247 | 3300006880 | Bacteria | 16165 |
| 192 | Ga0075429_100006783 | 3300006880 | Bacteria | 9933 |
| 193 | Ga0068865_100000441 | 3300006881 | Bacteria | 23086 |
| 194 | Ga0068865_100008175 | 3300006881 | Bacteria | 6458 |
| 195 | Ga0068865_100072545 | 3300006881 | Bacteria | 2446 |
| 196 | Ga0068865_100090835 | 3300006881 | Bacteria | 2215 |
| 197 | Ga0075436_100010683 | 3300006914 | Bacteria | 6298 |
| 198 | Ga0075436_100016605 | 3300006914 | Bacteria | 5039 |
| 199 | Ga0075436_100031882 | 3300006914 | Bacteria | 3631 |
| 200 | Ga0075436_100046885 | 3300006914 | Bacteria | 2981 |
| 201 | Ga0097620_100003983 | 3300006931 | Bacteria | 15063 |
| 202 | Ga0097620_100019100 | 3300006931 | Bacteria | 6883 |
| 203 | Ga0097620_100034197 | 3300006931 | Bacteria | 5102 |
| 204 | Ga0075435_100143319 | 3300007076 | Bacteria | 2006 |
| 205 | Ga0105250_10000036 | 3300009092 | Bacteria | 147009 |
| 206 | Ga0105240_10001034 | 3300009093 | Bacteria | 49457 |
| 207 | Ga0105240_10030687 | 3300009093 | Bacteria | 6983 |
| 208 | Ga0105240_10152333 | 3300009093 | Bacteria | 2753 |
| 209 | Ga0105240_10164319 | 3300009093 | Bacteria | 2634 |
| 210 | Ga0111539_10009546 | 3300009094 | Bacteria | 12248 |
| 211 | Ga0111539_10029435 | 3300009094 | Bacteria | 6689 |
| 212 | Ga0111539_10037545 | 3300009094 | Bacteria | 5848 |
| 213 | Ga0105245_10003281 | 3300009098 | Bacteria | 14520 |
| 214 | Ga0114129_10018142 | 3300009147 | Bacteria | 10021 |
| 215 | Ga0114129_10028984 | 3300009147 | Bacteria | 7842 |
| 216 | Ga0105243_10003096 | 3300009148 | Bacteria | 13681 |
| 217 | Ga0105243_10004954 | 3300009148 | Bacteria | 10435 |
| 218 | Ga0105241_10011051 | 3300009174 | Bacteria | 6623 |
| 219 | Ga0105241_10011676 | 3300009174 | Bacteria | 6447 |
| 220 | Ga0105241_10054550 | 3300009174 | Bacteria | 3060 |
| 221 | Ga0105242_10000524 | 3300009176 | Bacteria | 30157 |
| 222 | Ga0105248_10001365 | 3300009177 | Bacteria | 27260 |
| 223 | Ga0105248_10022243 | 3300009177 | Bacteria | 7031 |
| 224 | Ga0105237_10000345 | 3300009545 | Bacteria | 65477 |
| 225 | Ga0105237_10013282 | 3300009545 | Bacteria | 8640 |
| 226 | Ga0105237_10019747 | 3300009545 | Bacteria | 6957 |
| 227 | Ga0105237_10055904 | 3300009545 | Bacteria | 3952 |
| 228 | Ga0105237_10069292 | 3300009545 | Bacteria | 3523 |
| 229 | Ga0105237_10078248 | 3300009545 | Bacteria | 3296 |
| 230 | Ga0105238_10001167 | 3300009551 | Bacteria | 26450 |
| 231 | Ga0105238_10002155 | 3300009551 | Bacteria | 19900 |
| 232 | Ga0105238_10006217 | 3300009551 | Bacteria | 11864 |
| 233 | Ga0105238_10012095 | 3300009551 | Bacteria | 8697 |
| 234 | Ga0105238_10014238 | 3300009551 | Bacteria | 8043 |
| 235 | Ga0105238_10119898 | 3300009551 | Bacteria | 2611 |
| 236 | Ga0105249_10002096 | 3300009553 | Bacteria | 17301 |
| 237 | Ga0105249_10002650 | 3300009553 | Bacteria | 15482 |
| 238 | Ga0105249_10012640 | 3300009553 | Bacteria | 7443 |
| 239 | Ga0105249_10013387 | 3300009553 | Bacteria | 7245 |
| 240 | Ga0105249_10016277 | 3300009553 | Bacteria | 6596 |
| 241 | Ga0105239_10011975 | 3300010375 | Bacteria | 9670 |
| 242 | Ga0105239_10012223 | 3300010375 | Bacteria | 9569 |
| 243 | Ga0105239_10025373 | 3300010375 | Bacteria | 6525 |
| 244 | Ga0105239_10055437 | 3300010375 | Bacteria | 4347 |
| 245 | Ga0105239_10092959 | 3300010375 | Bacteria | 3330 |
| 246 | Ga0105239_10336360 | 3300010375 | Bacteria | 1704 |
| 247 | Ga0105246_10020958 | 3300011119 | Bacteria | 4198 |
| 248 | Ga0157373_10006832 | 3300013100 | Bacteria | 8495 |
| 249 | Ga0157373_10011153 | 3300013100 | Bacteria | 6614 |
| 250 | Ga0157373_10022516 | 3300013100 | Bacteria | 4572 |
| 251 | Ga0157371_10011744 | 3300013102 | Bacteria | 6729 |
| 252 | Ga0157370_10005696 | 3300013104 | Bacteria | 13928 |
| 253 | Ga0157370_10006493 | 3300013104 | Bacteria | 12883 |
| 254 | Ga0157370_10008585 | 3300013104 | Bacteria | 11003 |
| 255 | Ga0157370_10017218 | 3300013104 | Bacteria | 7294 |
| 256 | Ga0157370_10107158 | 3300013104 | Bacteria | 2614 |
| 257 | Ga0157369_10000027 | 3300013105 | Bacteria | 213988 |
| 258 | Ga0157369_10001075 | 3300013105 | Bacteria | 34218 |
| 259 | Ga0157369_10005545 | 3300013105 | Bacteria | 14659 |
| 260 | Ga0157369_10018714 | 3300013105 | Bacteria | 7767 |
| 261 | Ga0157369_10186937 | 3300013105 | Bacteria | 2178 |
| 262 | Ga0157374_10014468 | 3300013296 | Bacteria | 6904 |
| 263 | Ga0157378_10000016 | 3300013297 | Bacteria | 142649 |
| 264 | Ga0157378_10002315 | 3300013297 | Bacteria | 16942 |
| 265 | Ga0157378_10150433 | 3300013297 | Bacteria | 2168 |
| 266 | Ga0163162_10000107 | 3300013306 | Bacteria | 74745 |
| 267 | Ga0163162_10013240 | 3300013306 | Bacteria | 8056 |
| 268 | Ga0157372_10000662 | 3300013307 | Bacteria | 37834 |
| 269 | Ga0157372_10002592 | 3300013307 | Bacteria | 19566 |
| 270 | Ga0157372_10005146 | 3300013307 | Bacteria | 13902 |
| 271 | Ga0157372_10026323 | 3300013307 | Bacteria | 6329 |
| 272 | Ga0157372_10026717 | 3300013307 | Bacteria | 6282 |
| 273 | Ga0157372_10062321 | 3300013307 | Bacteria | 4178 |
| 274 | Ga0157372_10071886 | 3300013307 | Bacteria | 3898 |
| 275 | Ga0157372_10097654 | 3300013307 | Bacteria | 3350 |
| 276 | Ga0157372_10132408 | 3300013307 | Bacteria | 2870 |
| 277 | Ga0157372_10141180 | 3300013307 | Bacteria | 2775 |
| 278 | Ga0157375_10004020 | 3300013308 | Bacteria | 12761 |
| 279 | Ga0157375_10366856 | 3300013308 | Bacteria | 1606 |
| 280 | Ga0163163_10000117 | 3300014325 | Bacteria | 84938 |
| 281 | Ga0163163_10000796 | 3300014325 | Bacteria | 26715 |
| 282 | Ga0163163_10001624 | 3300014325 | Bacteria | 18915 |
| 283 | Ga0163163_10266894 | 3300014325 | Bacteria | 1763 |
| 284 | Ga0163163_10379391 | 3300014325 | Bacteria | 1471 |
| 285 | Ga0157380_10003701 | 3300014326 | Bacteria | 10513 |
| 286 | Ga0157380_10010235 | 3300014326 | Bacteria | 6739 |
| 287 | Ga0157377_10001418 | 3300014745 | Bacteria | 10340 |
| 288 | Ga0157379_10002463 | 3300014968 | Bacteria | 15500 |
| 289 | Ga0157379_10018237 | 3300014968 | Bacteria | 6185 |
| 290 | Ga0157379_10200589 | 3300014968 | Bacteria | 1804 |
| 291 | Ga0157376_10014239 | 3300014969 | Bacteria | 5964 |
| 292 | Ga0157376_10071820 | 3300014969 | Bacteria | 2943 |
| 293 | Ga0157376_10148990 | 3300014969 | Bacteria | 2108 |
| 294 | Ga0209233_1002561 | 3300025261 | Bacteria | 6623 |
| 295 | Ga0207696_1001712 | 3300025711 | Bacteria | 11378 |
| 296 | Ga0207642_10015485 | 3300025899 | Bacteria | 2843 |
| 297 | Ga0207680_10006404 | 3300025903 | Bacteria | 5693 |
| 298 | Ga0207647_10000440 | 3300025904 | Bacteria | 33864 |
| 299 | Ga0207647_10003399 | 3300025904 | Bacteria | 11928 |
| 300 | Ga0207647_10005409 | 3300025904 | Bacteria | 9373 |
| 301 | Ga0207647_10010135 | 3300025904 | Bacteria | 6663 |
| 302 | Ga0207699_10013731 | 3300025906 | Bacteria | 4154 |
| 303 | Ga0207645_10017101 | 3300025907 | Bacteria | 4791 |
| 304 | Ga0207645_10043647 | 3300025907 | Bacteria | 2870 |
| 305 | Ga0207643_10001974 | 3300025908 | Bacteria | 11324 |
| 306 | Ga0207705_10010173 | 3300025909 | Bacteria | 6844 |
| 307 | Ga0207705_10036624 | 3300025909 | Bacteria | 3511 |
| 308 | Ga0207705_10041241 | 3300025909 | Bacteria | 3311 |
| 309 | Ga0207654_10001663 | 3300025911 | Bacteria | 11613 |
| 310 | Ga0207654_10068813 | 3300025911 | Bacteria | 2096 |
| 311 | Ga0207707_10001306 | 3300025912 | Bacteria | 23212 |
| 312 | Ga0207707_10010940 | 3300025912 | Bacteria | 7892 |
| 313 | Ga0207707_10014780 | 3300025912 | Bacteria | 6802 |
| 314 | Ga0207707_10038182 | 3300025912 | Bacteria | 4197 |
| 315 | Ga0207707_10052405 | 3300025912 | Bacteria | 3553 |
| 316 | Ga0207707_10147574 | 3300025912 | Bacteria | 2056 |
| 317 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 318 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 319 | Ga0207695_10003459 | 3300025913 | Bacteria | 22244 |
| 320 | Ga0207695_10004403 | 3300025913 | Bacteria | 19258 |
| 321 | Ga0207695_10006570 | 3300025913 | Bacteria | 15048 |
| 322 | Ga0207695_10007320 | 3300025913 | Bacteria | 14094 |
| 323 | Ga0207695_10044722 | 3300025913 | Bacteria | 4707 |
| 324 | Ga0207695_10067763 | 3300025913 | Bacteria | 3660 |
| 325 | Ga0207671_10000870 | 3300025914 | Bacteria | 38250 |
| 326 | Ga0207671_10029456 | 3300025914 | Bacteria | 4099 |
| 327 | Ga0207671_10197032 | 3300025914 | Bacteria | 1572 |
| 328 | Ga0207693_10101830 | 3300025915 | Bacteria | 2252 |
| 329 | Ga0207660_10001321 | 3300025917 | Bacteria | 16577 |
| 330 | Ga0207660_10008950 | 3300025917 | Bacteria | 6477 |
| 331 | Ga0207660_10031717 | 3300025917 | Bacteria | 3643 |
| 332 | Ga0207662_10000112 | 3300025918 | Bacteria | 38862 |
| 333 | Ga0207657_10000432 | 3300025919 | Bacteria | 44554 |
| 334 | Ga0207657_10000801 | 3300025919 | Bacteria | 33295 |
| 335 | Ga0207657_10009593 | 3300025919 | Bacteria | 9716 |
| 336 | Ga0207657_10088550 | 3300025919 | Bacteria | 2587 |
| 337 | Ga0207649_10002267 | 3300025920 | Bacteria | 10834 |
| 338 | Ga0207649_10138583 | 3300025920 | Bacteria | 1661 |
| 339 | Ga0207649_10169938 | 3300025920 | Bacteria | 1518 |
| 340 | Ga0207652_10001132 | 3300025921 | Bacteria | 24000 |
| 341 | Ga0207652_10014913 | 3300025921 | Bacteria | 6301 |
| 342 | Ga0207652_10029999 | 3300025921 | Bacteria | 4552 |
| 343 | Ga0207652_10054362 | 3300025921 | Bacteria | 3442 |
| 344 | Ga0207652_10072821 | 3300025921 | Bacteria | 2988 |
| 345 | Ga0207681_10001243 | 3300025923 | Bacteria | 16430 |
| 346 | Ga0207681_10016713 | 3300025923 | Bacteria | 4597 |
| 347 | Ga0207694_10000733 | 3300025924 | Bacteria | 29483 |
| 348 | Ga0207694_10003366 | 3300025924 | Bacteria | 12732 |
| 349 | Ga0207694_10035694 | 3300025924 | Bacteria | 3814 |
| 350 | Ga0207694_10041668 | 3300025924 | Bacteria | 3539 |
| 351 | Ga0207694_10144034 | 3300025924 | Bacteria | 1917 |
| 352 | Ga0207694_10158582 | 3300025924 | Bacteria | 1826 |
| 353 | Ga0207650_10038845 | 3300025925 | Bacteria | 3478 |
| 354 | Ga0207650_10050493 | 3300025925 | Bacteria | 3076 |
| 355 | Ga0207659_10030850 | 3300025926 | Bacteria | 3665 |
| 356 | Ga0207659_10083691 | 3300025926 | Bacteria | 2365 |
| 357 | Ga0207687_10012569 | 3300025927 | Bacteria | 5530 |
| 358 | Ga0207687_10164084 | 3300025927 | Bacteria | 1708 |
| 359 | Ga0207700_10101039 | 3300025928 | Bacteria | 2300 |
| 360 | Ga0207664_10000056 | 3300025929 | Bacteria | 125763 |
| 361 | Ga0207664_10027443 | 3300025929 | Bacteria | 4315 |
| 362 | Ga0207664_10058856 | 3300025929 | Bacteria | 3058 |
| 363 | Ga0207644_10060048 | 3300025931 | Bacteria | 2751 |
| 364 | Ga0207644_10187942 | 3300025931 | Bacteria | 1623 |
| 365 | Ga0207690_10001271 | 3300025932 | Bacteria | 15954 |
| 366 | Ga0207690_10010257 | 3300025932 | Bacteria | 5564 |
| 367 | Ga0207690_10013552 | 3300025932 | Bacteria | 4900 |
| 368 | Ga0207690_10034784 | 3300025932 | Bacteria | 3249 |
| 369 | Ga0207706_10006467 | 3300025933 | Bacteria | 10880 |
| 370 | Ga0207706_10055575 | 3300025933 | Bacteria | 3490 |
| 371 | Ga0207706_10090999 | 3300025933 | Bacteria | 2682 |
| 372 | Ga0207706_10215706 | 3300025933 | Bacteria | 1681 |
| 373 | Ga0207686_10003086 | 3300025934 | Bacteria | 8973 |
| 374 | Ga0207709_10003484 | 3300025935 | Bacteria | 9336 |
| 375 | Ga0207709_10006880 | 3300025935 | Bacteria | 6367 |
| 376 | Ga0207670_10005633 | 3300025936 | Bacteria | 6887 |
| 377 | Ga0207670_10012276 | 3300025936 | Bacteria | 5005 |
| 378 | Ga0207704_10002482 | 3300025938 | Bacteria | 8315 |
| 379 | Ga0207704_10022349 | 3300025938 | Bacteria | 3388 |
| 380 | Ga0207704_10126093 | 3300025938 | Bacteria | 1763 |
| 381 | Ga0207691_10002785 | 3300025940 | Bacteria | 17044 |
| 382 | Ga0207691_10010708 | 3300025940 | Bacteria | 8804 |
| 383 | Ga0207691_10094133 | 3300025940 | Bacteria | 2681 |
| 384 | Ga0207691_10098222 | 3300025940 | Bacteria | 2616 |
| 385 | Ga0207689_10002184 | 3300025942 | Bacteria | 18348 |
| 386 | Ga0207689_10008435 | 3300025942 | Bacteria | 8975 |
| 387 | Ga0207661_10049586 | 3300025944 | Bacteria | 3342 |
| 388 | Ga0207679_10007012 | 3300025945 | Bacteria | 7143 |
| 389 | Ga0207667_10008959 | 3300025949 | Bacteria | 11838 |
| 390 | Ga0207667_10041717 | 3300025949 | Bacteria | 4879 |
| 391 | Ga0207667_10131369 | 3300025949 | Bacteria | 2579 |
| 392 | Ga0207667_10137158 | 3300025949 | Bacteria | 2519 |
| 393 | Ga0207651_10002395 | 3300025960 | Bacteria | 8962 |
| 394 | Ga0207651_10081931 | 3300025960 | Bacteria | 2328 |
| 395 | Ga0207712_10002072 | 3300025961 | Bacteria | 13168 |
| 396 | Ga0207712_10004411 | 3300025961 | Bacteria | 8889 |
| 397 | Ga0207712_10021076 | 3300025961 | Bacteria | 4275 |
| 398 | Ga0207712_10129932 | 3300025961 | Bacteria | 1918 |
| 399 | Ga0207668_10103504 | 3300025972 | Bacteria | 2120 |
| 400 | Ga0207640_10015463 | 3300025981 | Bacteria | 4418 |
| 401 | Ga0207658_10000111 | 3300025986 | Bacteria | 89180 |
| 402 | Ga0207658_10022299 | 3300025986 | Bacteria | 4408 |
| 403 | Ga0207677_10010268 | 3300026023 | Bacteria | 5295 |
| 404 | Ga0207677_10079380 | 3300026023 | Bacteria | 2347 |
| 405 | Ga0207703_10009416 | 3300026035 | Bacteria | 7673 |
| 406 | Ga0207703_10009557 | 3300026035 | Bacteria | 7614 |
| 407 | Ga0207703_10024405 | 3300026035 | Bacteria | 4758 |
| 408 | Ga0207703_10248058 | 3300026035 | Bacteria | 1603 |
| 409 | Ga0207639_10000129 | 3300026041 | Bacteria | 55422 |
| 410 | Ga0207639_10005207 | 3300026041 | Bacteria | 8771 |
| 411 | Ga0207639_10040679 | 3300026041 | Bacteria | 3471 |
| 412 | Ga0207678_10000802 | 3300026067 | Bacteria | 28836 |
| 413 | Ga0207708_10000324 | 3300026075 | Bacteria | 37852 |
| 414 | Ga0207708_10050243 | 3300026075 | Bacteria | 3175 |
| 415 | Ga0207708_10140064 | 3300026075 | Bacteria | 1897 |
| 416 | Ga0207702_10006092 | 3300026078 | Bacteria | 10452 |
| 417 | Ga0207702_10051973 | 3300026078 | Bacteria | 3465 |
| 418 | Ga0207702_10109363 | 3300026078 | Bacteria | 2454 |
| 419 | Ga0207641_10114377 | 3300026088 | Bacteria | 2398 |
| 420 | Ga0207648_10000205 | 3300026089 | Bacteria | 62995 |
| 421 | Ga0207648_10000680 | 3300026089 | Bacteria | 38152 |
| 422 | Ga0207648_10015021 | 3300026089 | Bacteria | 7132 |
| 423 | Ga0207648_10015986 | 3300026089 | Bacteria | 6877 |
| 424 | Ga0207676_10018749 | 3300026095 | Bacteria | 5037 |
| 425 | Ga0207676_10235807 | 3300026095 | Bacteria | 1638 |
| 426 | Ga0207674_10005372 | 3300026116 | Bacteria | 15240 |
| 427 | Ga0207674_10020189 | 3300026116 | Bacteria | 7204 |
| 428 | Ga0207674_10105915 | 3300026116 | Bacteria | 2790 |
| 429 | Ga0207674_10164413 | 3300026116 | Bacteria | 2173 |
| 430 | Ga0207674_10312041 | 3300026116 | Bacteria | 1522 |
| 431 | Ga0207675_100000353 | 3300026118 | Bacteria | 43874 |
| 432 | Ga0207675_100001096 | 3300026118 | Bacteria | 26828 |
| 433 | Ga0207675_100039099 | 3300026118 | Bacteria | 4428 |
| 434 | Ga0207675_100294094 | 3300026118 | Bacteria | 1580 |
| 435 | Ga0207698_10001110 | 3300026142 | Bacteria | 15683 |
| 436 | Ga0207698_10016726 | 3300026142 | Bacteria | 4955 |
| 437 | Ga0207698_10023093 | 3300026142 | Bacteria | 4340 |
| 438 | Ga0207698_10031550 | 3300026142 | Bacteria | 3826 |
| 439 | Ga0209588_1023653 | 3300027671 | Bacteria | 1938 |
| 440 | Ga0207428_10005769 | 3300027907 | Bacteria | 11493 |
| 441 | Ga0207428_10058516 | 3300027907 | Bacteria | 3058 |
| 442 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 443 | Ga0268266_10011560 | 3300028379 | Bacteria | 7664 |
| 444 | Ga0268266_10192885 | 3300028379 | Bacteria | 1861 |
| 445 | Ga0268265_10001008 | 3300028380 | Bacteria | 25465 |
| 446 | Ga0268265_10001090 | 3300028380 | Bacteria | 24159 |
| 447 | Ga0268265_10007957 | 3300028380 | Bacteria | 7157 |
| 448 | Ga0268265_10016086 | 3300028380 | Bacteria | 5133 |
| 449 | Ga0268264_10002873 | 3300028381 | Bacteria | 14997 |
| 450 | Ga0268264_10017752 | 3300028381 | Bacteria | 5825 |
| 451 | Ga0265334_10005231 | 3300028573 | Bacteria | 5683 |
| 452 | Ga0265318_10003631 | 3300028577 | Bacteria | 7703 |
| 453 | Ga0265338_10049560 | 3300028800 | Bacteria | 3806 |
| 454 | Ga0265331_10002428 | 3300031250 | Bacteria | 12626 |
| 455 | Ga0265327_10000184 | 3300031251 | Bacteria | 133023 |
| 456 | Ga0265327_10003280 | 3300031251 | Bacteria | 15675 |
| 457 | Ga0265316_10003412 | 3300031344 | Bacteria | 16076 |
| 458 | Ga0307509_10000455 | 3300031507 | Bacteria | 69145 |
| 459 | Ga0307408_100001669 | 3300031548 | Bacteria | 16353 |
| 460 | Ga0307408_100090295 | 3300031548 | Bacteria | 2311 |
| 461 | Ga0307508_10136020 | 3300031616 | Bacteria | 2061 |
| 462 | Ga0316575_10001433 | 3300031665 | Bacteria | 7678 |
| 463 | Ga0316575_10011108 | 3300031665 | Bacteria | 3325 |
| 464 | Ga0316575_10029350 | 3300031665 | Bacteria | 2147 |
| 465 | Ga0316575_10030846 | 3300031665 | Bacteria | 2097 |
| 466 | Ga0316575_10031370 | 3300031665 | Bacteria | 2080 |
| 467 | Ga0316579_10000520 | 3300031691 | Bacteria | 12608 |
| 468 | Ga0316579_10001295 | 3300031691 | Bacteria | 9026 |
| 469 | Ga0265314_10009958 | 3300031711 | Bacteria | 7969 |
| 470 | Ga0316576_10005095 | 3300031727 | Bacteria | 7974 |
| 471 | Ga0316576_10007291 | 3300031727 | Bacteria | 6948 |
| 472 | Ga0316576_10009785 | 3300031727 | Bacteria | 6206 |
| 473 | Ga0316578_10002338 | 3300031728 | Bacteria | 8257 |
| 474 | Ga0316578_10006368 | 3300031728 | Bacteria | 5818 |
| 475 | Ga0316578_10007974 | 3300031728 | Bacteria | 5353 |
| 476 | Ga0316578_10015641 | 3300031728 | Bacteria | 4084 |
| 477 | Ga0316578_10023749 | 3300031728 | Bacteria | 3433 |
| 478 | Ga0307516_10074905 | 3300031730 | Bacteria | 3239 |
| 479 | Ga0307406_10001966 | 3300031901 | Bacteria | 11229 |
| 480 | Ga0307407_10098414 | 3300031903 | Bacteria | 1810 |
| 481 | Ga0307407_10182721 | 3300031903 | Bacteria | 1391 |
| 482 | Ga0307412_10116550 | 3300031911 | Bacteria | 1916 |
| 483 | Ga0307409_100065015 | 3300031995 | Bacteria | 2868 |
| 484 | Ga0307416_100040075 | 3300032002 | Bacteria | 3635 |
| 485 | Ga0307416_100068623 | 3300032002 | Bacteria | 2930 |
| 486 | Ga0307414_10072866 | 3300032004 | Bacteria | 2483 |
| 487 | Ga0307411_10108348 | 3300032005 | Bacteria | 1982 |
| 488 | Ga0316583_10000416 | 3300032133 | Bacteria | 12491 |
| 489 | Ga0316585_10000238 | 3300032137 | Bacteria | 11638 |
| 490 | Ga0316580_10002362 | 3300032139 | Bacteria | 5174 |
| 491 | Ga0316580_10003666 | 3300032139 | Bacteria | 4391 |
| 492 | Ga0373948_0001938 | 3300034817 | Bacteria | 2976 |
| 493 | Ga0373928_0002412 | 3300035084 | Bacteria | 3626 |
| 494 | Ga0373940_0000559 | 3300035088 | Bacteria | 5884 |
| 495 | Ga0373939_0002762 | 3300035114 | Bacteria | 4114 |
| 496 | Ga0373942_0002838 | 3300035207 | Bacteria | 4121 |
| 497 | Ga0373962_0009194 | 3300035242 | Bacteria | 2443 |
| 498 | Ga0316574_0005025 | 3300035398 | Bacteria | 7024 |
| 499 | Ga0316574_0023616 | 3300035398 | Bacteria | 3673 |
| 500 | Ga0316574_0053472 | 3300035398 | Bacteria | 2521 |
| 501 | Ga0373931_0003641 | 3300035691 | Bacteria | 6960 |
| 502 | Ga0316582_0004106 | 3300036647 | Bacteria | 7287 |
| 503 | Ga0316582_0023726 | 3300036647 | Bacteria | 3659 |
| 504 | Ga0316582_0066102 | 3300036647 | Bacteria | 2330 |
| 505 | Ga0316584_0004423 | 3300036712 | Bacteria | 9307 |
| 506 | Ga0373925_0008471 | 3300037068 | Bacteria | 7494 |
| 507 | Ga0395899_0001353 | 3300037312 | Bacteria | 21108 |
| 508 | Ga0395900_0002023 | 3300037418 | Bacteria | 22811 |
| 509 | Ga0395900_0230317 | 3300037418 | Bacteria | 1864 |
| 510 | Ga0395898_0203179 | 3300037466 | Bacteria | 1891 |
| 511 | Ga0395905_0000373 | 3300037471 | Bacteria | 63927 |
| 512 | Ga0316581_0000502 | 3300037588 | Bacteria | 7581 |
| 513 | Ga0395901_0001656 | 3300038443 | Bacteria | 23013 |
| 514 | Ga0395901_0048189 | 3300038443 | Bacteria | 4425 |
| 515 | Ga0400484_36483 | 3300038725 | Bacteria | 8766 |
| 516 | Ga0400490_20921 | 3300038726 | Bacteria | 35909 |
| 517 | Ga0400485_13101 | 3300038735 | Bacteria | 31485 |
| 518 | Ga0400486_01752 | 3300038742 | Bacteria | 4209 |
| 519 | Ga0400483_084870 | 3300039062 | Bacteria | 8827 |
| 520 | Ga0400483_159554 | 3300039062 | Bacteria | 2209 |
| 521 | Ga0400483_258475 | 3300039062 | Bacteria | 12766 |
| 522 | Ga0400487_38243 | 3300039110 | Bacteria | 71080 |
| 523 | Ga0400487_49882 | 3300039110 | Bacteria | 2001 |
| 524 | Ga0400487_50178 | 3300039110 | Bacteria | 3428 |
| 525 | Ga0451807_1628056 | 3300041486 | Bacteria | 1877 |
| 526 | Ga0451833_1404377 | 3300041491 | Bacteria | 1874 |
| 527 | Ga0451837_0349640 | 3300041494 | Bacteria | 1600 |
| 528 | Ga0439455_0000953 | 3300042012 | Bacteria | 4513 |
| 529 | Ga0439435_0015286 | 3300042436 | Bacteria | 1908 |
| 530 | Ga0439444_0005968 | 3300042437 | Bacteria | 1823 |
| 531 | Ga0439460_0006049 | 3300042461 | Bacteria | 2986 |
| 532 | Ga0451577_0026410 | 3300042876 | Bacteria | 5260 |
| 533 | Ga0466969_0000478 | 3300044656 | Bacteria | 21890 |
| 534 | Ga0466972_0003141 | 3300044658 | Bacteria | 8201 |
| 535 | Ga0466966_0019315 | 3300044684 | Bacteria | 4485 |
| 536 | Ga0453684_0000003 | 3300044712 | Bacteria | 1481694 |
| 537 | Ga0453684_0000863 | 3300044712 | Bacteria | 101954 |
| 538 | Ga0453684_0015282 | 3300044712 | Bacteria | 12170 |
| 539 | Ga0453684_0262442 | 3300044712 | Bacteria | 1978 |
| 540 | Ga0466959_0038358 | 3300045049 | Bacteria | 3540 |
| 541 | Ga0451576_0000490 | 3300045051 | Bacteria | 87626 |
| 542 | Ga0451576_0032272 | 3300045051 | Bacteria | 5579 |
| 543 | Ga0451576_0311961 | 3300045051 | Bacteria | 1645 |
| 544 | Ga0495592_0000656 | 3300046454 | Bacteria | 24042 |
| 545 | Ga0495629_0084832 | 3300046459 | Bacteria | 2210 |
| 546 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 547 | Ga0495651_0104114 | 3300046462 | Bacteria | 2107 |
| 548 | Ga0495662_0006979 | 3300046476 | Bacteria | 5612 |
| 549 | Ga0495662_0018438 | 3300046476 | Bacteria | 3378 |
| 550 | Ga0495608_0002698 | 3300046511 | Bacteria | 12749 |
| 551 | Ga0495628_0027333 | 3300046516 | Bacteria | 4643 |
| 552 | Ga0495630_0008098 | 3300046517 | Bacteria | 7554 |
| 553 | Ga0495630_0168475 | 3300046517 | Bacteria | 1668 |
| 554 | Ga0495640_0003691 | 3300046533 | Bacteria | 12301 |
| 555 | Ga0495586_0003235 | 3300046535 | Bacteria | 8752 |
| 556 | Ga0495586_0004912 | 3300046535 | Bacteria | 7153 |
| 557 | Ga0495587_0033246 | 3300046536 | Bacteria | 3114 |
| 558 | Ga0495587_0044145 | 3300046536 | Bacteria | 2652 |
| 559 | Ga0495645_0046901 | 3300046543 | Bacteria | 3149 |
| 560 | Ga0495667_0039319 | 3300046559 | Bacteria | 3145 |
| 561 | Ga0495634_0015543 | 3300046642 | Bacteria | 5464 |
| 562 | Ga0495625_0003057 | 3300046660 | Bacteria | 17149 |
| 563 | Ga0495635_0081089 | 3300046663 | Bacteria | 2220 |
| 564 | Ga0495599_0004947 | 3300046678 | Bacteria | 7923 |
| 565 | Ga0495647_0000618 | 3300046681 | Bacteria | 10481 |
| 566 | Ga0495658_0018241 | 3300046683 | Bacteria | 3644 |
| 567 | Ga0495613_0026267 | 3300046689 | Bacteria | 4339 |
| 568 | Ga0495624_0064682 | 3300046690 | Bacteria | 2286 |
| 569 | Ga0495604_0026863 | 3300047317 | Bacteria | 4581 |
| 570 | Ga0495604_0156204 | 3300047317 | Bacteria | 1616 |
| 571 | Ga0495636_0010874 | 3300047318 | Bacteria | 3600 |
| 572 | Ga0495676_0163596 | 3300047321 | Bacteria | 1572 |
| 573 | Ga0495680_0002481 | 3300047322 | Bacteria | 18867 |
| 574 | Ga0495680_0065975 | 3300047322 | Bacteria | 2771 |
| 575 | Ga0495686_0006564 | 3300047472 | Bacteria | 8878 |
| 576 | Ga0495686_0036227 | 3300047472 | Bacteria | 3167 |
| 577 | Ga0495593_0046786 | 3300047673 | Bacteria | 2304 |
| 578 | Ga0496102_0093734 | 3300048905 | Bacteria | 2782 |
| 579 | Ga0496103_0021637 | 3300048906 | Bacteria | 3870 |
| 580 | Ga0496106_0078727 | 3300048909 | Bacteria | 2530 |
| 581 | Ga0496110_0078151 | 3300048913 | Bacteria | 2946 |
| 582 | Ga0496112_0002009 | 3300048915 | Bacteria | 16097 |
| 583 | Ga0496115_0000040 | 3300048918 | Bacteria | 122975 |
| 584 | Ga0496115_0000113 | 3300048918 | Bacteria | 74536 |
| 585 | Ga0496117_0000108 | 3300048920 | Bacteria | 185583 |
| 586 | Ga0496121_0027550 | 3300048924 | Bacteria | 5316 |
| 587 | Ga0496121_0060801 | 3300048924 | Bacteria | 3105 |
| 588 | Ga0496122_0000129 | 3300048925 | Bacteria | 173688 |
| 589 | Ga0496123_0000113 | 3300048926 | Bacteria | 163689 |
| 590 | Ga0496126_0000226 | 3300048929 | Bacteria | 122150 |
| 591 | Ga0501031_0004545 | 3300049568 | Bacteria | 8996 |
| 592 | Ga0501032_0032566 | 3300049569 | Bacteria | 3572 |
| 593 | Ga0501033_0004399 | 3300049570 | Bacteria | 11287 |
| 594 | Ga0501034_0020678 | 3300049571 | Bacteria | 6722 |
| 595 | Ga0501034_0046831 | 3300049571 | Bacteria | 4369 |
| 596 | Ga0501034_0054130 | 3300049571 | Bacteria | 4040 |
| 597 | Ga0501036_0000101 | 3300049572 | Bacteria | 53813 |
| 598 | Ga0501036_0060923 | 3300049572 | Bacteria | 3196 |
| 599 | Ga0501037_0013300 | 3300049573 | Bacteria | 6065 |
| 600 | Ga0501037_0069825 | 3300049573 | Bacteria | 2557 |
| 601 | Ga0501037_0121937 | 3300049573 | Bacteria | 1874 |
| 602 | Ga0501038_0001381 | 3300049574 | Bacteria | 22182 |
| 603 | Ga0501038_0076015 | 3300049574 | Bacteria | 2838 |
| 604 | Ga0501039_0000117 | 3300049575 | Bacteria | 54402 |
| 605 | Ga0501039_0040772 | 3300049575 | Bacteria | 3583 |
| 606 | Ga0501040_0063395 | 3300049576 | Bacteria | 2543 |
| 607 | Ga0501041_0000040 | 3300049577 | Bacteria | 43977 |
| 608 | Ga0501042_0000026 | 3300049578 | Bacteria | 48274 |
| 609 | Ga0501042_0045776 | 3300049578 | Bacteria | 3119 |
| 610 | Ga0501043_0003448 | 3300049579 | Bacteria | 12994 |
| 611 | Ga0501043_0014067 | 3300049579 | Bacteria | 6264 |
| 612 | Ga0501043_0021471 | 3300049579 | Bacteria | 5062 |
| 613 | Ga0501046_0000705 | 3300049580 | Bacteria | 32282 |
| 614 | Ga0501046_0016337 | 3300049580 | Bacteria | 6219 |
| 615 | Ga0501047_0009204 | 3300049581 | Bacteria | 9323 |
| 616 | Ga0501047_0017450 | 3300049581 | Bacteria | 6875 |
| 617 | Ga0501047_0020198 | 3300049581 | Bacteria | 6395 |
| 618 | Ga0501048_0000707 | 3300049582 | Bacteria | 24361 |
| 619 | Ga0501048_0018723 | 3300049582 | Bacteria | 5090 |
| 620 | Ga0501068_0002805 | 3300049584 | Bacteria | 9270 |
| 621 | Ga0501068_0003419 | 3300049584 | Bacteria | 8543 |
| 622 | Ga0501069_0009513 | 3300049585 | Bacteria | 5130 |
| 623 | Ga0501070_0004718 | 3300049586 | Bacteria | 11677 |
| 624 | Ga0501070_0011155 | 3300049586 | Bacteria | 7585 |
| 625 | Ga0501070_0029805 | 3300049586 | Bacteria | 4572 |
| 626 | Ga0501070_0034090 | 3300049586 | Bacteria | 4258 |
| 627 | Ga0501070_0073191 | 3300049586 | Bacteria | 2835 |
| 628 | Ga0501071_0000133 | 3300049587 | Bacteria | 30216 |
| 629 | Ga0501071_0028153 | 3300049587 | Bacteria | 3958 |
| 630 | Ga0501072_0000528 | 3300049588 | Bacteria | 27443 |
| 631 | Ga0501072_0006732 | 3300049588 | Bacteria | 8736 |
| 632 | Ga0501072_0009355 | 3300049588 | Bacteria | 7449 |
| 633 | Ga0501073_0090630 | 3300049589 | Bacteria | 2125 |
| 634 | Ga0501073_0155223 | 3300049589 | Bacteria | 1586 |
| 635 | Ga0501074_0003355 | 3300049590 | Bacteria | 11347 |
| 636 | Ga0501074_0011400 | 3300049590 | Bacteria | 6462 |
| 637 | Ga0501074_0020073 | 3300049590 | Bacteria | 4856 |
| 638 | Ga0501075_0000036 | 3300049591 | Bacteria | 55260 |
| 639 | Ga0501075_0004331 | 3300049591 | Bacteria | 9606 |
| 640 | Ga0501076_0000220 | 3300049592 | Bacteria | 34479 |
| 641 | Ga0501076_0001278 | 3300049592 | Bacteria | 16771 |
| 642 | Ga0501077_0000855 | 3300049593 | Bacteria | 18401 |
| 643 | Ga0501079_0000807 | 3300049741 | Bacteria | 21328 |
| 644 | Ga0501080_0001158 | 3300049742 | Bacteria | 21765 |
| 645 | Ga0501080_0036929 | 3300049742 | Bacteria | 4561 |
| 646 | Ga0501080_0225828 | 3300049742 | Bacteria | 1712 |
| 647 | Ga0501081_0000074 | 3300049743 | Bacteria | 39073 |
| 648 | Ga0501081_0003533 | 3300049743 | Bacteria | 9987 |
| 649 | Ga0501083_0005792 | 3300049744 | Bacteria | 8750 |
| 650 | Ga0501241_006518 | 3300049758 | Bacteria | 2148 |
| 651 | Ga0501035_0006460 | 3300049822 | Bacteria | 11010 |
| 652 | Ga0501035_0075939 | 3300049822 | Bacteria | 2972 |
| 653 | Ga0501035_0122745 | 3300049822 | Bacteria | 2269 |
| 654 | Ga0501044_0027394 | 3300049823 | Bacteria | 6024 |
| 655 | Ga0501044_0066659 | 3300049823 | Bacteria | 3670 |
| 656 | Ga0501044_0074782 | 3300049823 | Bacteria | 3441 |
| 657 | Ga0501044_0080146 | 3300049823 | Bacteria | 3307 |
| 658 | Ga0501045_0000438 | 3300049824 | Bacteria | 25526 |
| 659 | Ga0501045_0009431 | 3300049824 | Bacteria | 6827 |
| 660 | Ga0501045_0143922 | 3300049824 | Bacteria | 1773 |
| 661 | Ga0501045_0163522 | 3300049824 | Bacteria | 1657 |
| 662 | nmdc:mga05p37_12883_c1 | 3300050507 | Bacteria | 9999 |
| 663 | nmdc:mga05p37_210277_c1 | 3300050507 | Bacteria | 2352 |
| 664 | nmdc:mga05p37_5534_c1 | 3300050507 | Bacteria | 14836 |
| 665 | nmdc:mga05p37_751_c1 | 3300050507 | Bacteria | 35968 |
| 666 | nmdc:mga09592_127895_c1 | 3300050508 | Bacteria | 2184 |
| 667 | nmdc:mga09592_20132_c1 | 3300050508 | Bacteria | 5484 |
| 668 | nmdc:mga09592_2143_c1 | 3300050508 | Bacteria | 15926 |
| 669 | nmdc:mga09592_2163_c1 | 3300050508 | Bacteria | 15862 |
| 670 | nmdc:mga0qj67_1265_c1 | 3300050509 | Bacteria | 17724 |
| 671 | nmdc:mga0qj67_38754_c1 | 3300050509 | Bacteria | 3740 |
| 672 | nmdc:mga0qj67_69187_c1 | 3300050509 | Bacteria | 2815 |
| 673 | nmdc:mga06r32_36183_c1 | 3300050510 | Bacteria | 4663 |
| 674 | nmdc:mga06r32_5547_c1 | 3300050510 | Bacteria | 11371 |
| 675 | nmdc:mga06r32_682_c1 | 3300050510 | Bacteria | 29573 |
| 676 | nmdc:mga08y16_12428_c1 | 3300050511 | Bacteria | 8959 |
| 677 | nmdc:mga08y16_129903_c1 | 3300050511 | Bacteria | 2621 |
| 678 | nmdc:mga08y16_17066_c1 | 3300050511 | Bacteria | 7644 |
| 679 | nmdc:mga08y16_174969_c1 | 3300050511 | Bacteria | 2229 |
| 680 | nmdc:mga08y16_33186_c1 | 3300050511 | Bacteria | 5423 |
| 681 | nmdc:mga08y16_46419_c1 | 3300050511 | Bacteria | 4548 |
| 682 | nmdc:mga0n895_12691_c1 | 3300050512 | Bacteria | 7565 |
| 683 | nmdc:mga0n895_142429_c1 | 3300050512 | Bacteria | 2426 |
| 684 | nmdc:mga0n895_353_c1 | 3300050512 | Bacteria | 30930 |
| 685 | nmdc:mga0rr50_180967_c1 | 3300050513 | Bacteria | 1723 |
| 686 | nmdc:mga0rr50_3379_c1 | 3300050513 | Bacteria | 9170 |
| 687 | nmdc:mga08x19_131346_c1 | 3300050514 | Bacteria | 1685 |
| 688 | nmdc:mga08x19_15709_c1 | 3300050514 | Bacteria | 4606 |
| 689 | nmdc:mga08x19_2759_c1 | 3300050514 | Bacteria | 10604 |
| 690 | nmdc:mga08x19_31475_c1 | 3300050514 | Bacteria | 3337 |
| 691 | nmdc:mga0a205_198283_c1 | 3300050515 | Bacteria | 1898 |
| 692 | nmdc:mga0a205_9448_c1 | 3300050515 | Bacteria | 8916 |
| 693 | Ga0500643_007178 | 3300053087 | Bacteria | 4551 |
| 694 | Ga0500651_0000070 | 3300053093 | Bacteria | 67252 |
| 695 | Ga0500651_0003497 | 3300053093 | Bacteria | 8584 |
| 696 | Ga0500556_0000594 | 3300053104 | Bacteria | 23774 |
| 697 | Ga0500597_000277 | 3300053120 | Bacteria | 10325 |
| 698 | Ga0500588_0002957 | 3300053146 | Bacteria | 3535 |
| 699 | Ga0500637_0016589 | 3300053178 | Bacteria | 3928 |
| 700 | Ga0501084_0002058 | 3300054114 | Bacteria | 16062 |
| 701 | Ga0501084_0010130 | 3300054114 | Bacteria | 7790 |
| 702 | Ga0501084_0028024 | 3300054114 | Bacteria | 4707 |
| 703 | Ga0501082_0000619 | 3300060353 | Bacteria | 31222 |
| 704 | Ga0501082_0006786 | 3300060353 | Bacteria | 9894 |
| 705 | Ga0501082_0070959 | 3300060353 | Bacteria | 2999 |
| 706 | Ga0501082_0222215 | 3300060353 | Bacteria | 1643 |
| 707 | Ga0530510_0000117 | 3300061734 | Bacteria | 45062 |
| 708 | Ga0530510_0003517 | 3300061734 | Bacteria | 10775 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025933 | Ga0207706_10090999 | Ga0207706_100909992 | 349 |
| 2 | 3300050508 | nmdc:mga09592_127895_c1 | nmdc:mga09592_127895_c1_996_2174 | 364 |
| 3 | 3300037466 | Ga0395898_0203179 | Ga0395898_0203179_679_1875 | 370 |
| 4 | 3300049586 | Ga0501070_0004718 | Ga0501070_0004718_10477_11667 | 375 |
| 5 | 3300041486 | Ga0451807_1628056 | Ga0451807_1628056_635_1843 | 377 |
| 6 | 3300009174 | Ga0105241_10054550 | Ga0105241_100545502 | 381 |
| 7 | 3300028573 | Ga0265334_10005231 | Ga0265334_100052311 | 386 |
| 8 | 3300028577 | Ga0265318_10003631 | Ga0265318_100036314 | 386 |
| 9 | 3300028800 | Ga0265338_10049560 | Ga0265338_100495602 | 386 |
| 10 | 3300060353 | Ga0501082_0222215 | Ga0501082_0222215_412_1632 | 389 |
| 11 | 3300050507 | nmdc:mga05p37_210277_c1 | nmdc:mga05p37_210277_c1_171_1505 | 391 |
| 12 | 3300013297 | Ga0157378_10002315 | Ga0157378_100023154 | 395 |
| 13 | 3300009094 | Ga0111539_10037545 | Ga0111539_100375455 | 398 |
| 14 | 3300050511 | nmdc:mga08y16_12428_c1 | nmdc:mga08y16_12428_c1_3126_4454 | 398 |
| 15 | 3300031903 | Ga0307407_10182721 | Ga0307407_101827211 | 401 |
| 16 | 3300003320 | rootH2_10029880 | rootH2_100298802 | 403 |
| 17 | 3300031995 | Ga0307409_100065015 | Ga0307409_1000650152 | 404 |
| 18 | 3300048913 | Ga0496110_0078151 | Ga0496110_0078151_1404_2702 | 404 |
| 19 | 3300053093 | Ga0500651_0003497 | Ga0500651_0003497_4268_5668 | 405 |
| 20 | 3300050515 | nmdc:mga0a205_198283_c1 | nmdc:mga0a205_198283_c1_380_1702 | 407 |
| 21 | 3300006358 | Ga0068871_100106008 | Ga0068871_1001060082 | 409 |
| 22 | 3300031250 | Ga0265331_10002428 | Ga0265331_100024282 | 409 |
| 23 | 3300005327 | Ga0070658_10016622 | Ga0070658_100166225 | 410 |
| 24 | 3300005530 | Ga0070679_100029808 | Ga0070679_1000298085 | 410 |
| 25 | 3300005563 | Ga0068855_100213461 | Ga0068855_1002134612 | 410 |
| 26 | 3300005616 | Ga0068852_100008384 | Ga0068852_1000083848 | 410 |
| 27 | 3300006914 | Ga0075436_100046885 | Ga0075436_1000468852 | 410 |
| 28 | 3300009093 | Ga0105240_10030687 | Ga0105240_100306876 | 410 |
| 29 | 3300009093 | Ga0105240_10152333 | Ga0105240_101523333 | 410 |
| 30 | 3300009174 | Ga0105241_10011051 | Ga0105241_100110515 | 410 |
| 31 | 3300009545 | Ga0105237_10069292 | Ga0105237_100692922 | 410 |
| 32 | 3300010375 | Ga0105239_10055437 | Ga0105239_100554373 | 410 |
| 33 | 3300011119 | Ga0105246_10020958 | Ga0105246_100209584 | 410 |
| 34 | 3300013104 | Ga0157370_10008585 | Ga0157370_100085853 | 410 |
| 35 | 3300013104 | Ga0157370_10107158 | Ga0157370_101071583 | 410 |
| 36 | 3300013105 | Ga0157369_10005545 | Ga0157369_100055455 | 410 |
| 37 | 3300013105 | Ga0157369_10018714 | Ga0157369_100187146 | 410 |
| 38 | 3300013105 | Ga0157369_10186937 | Ga0157369_101869372 | 410 |
| 39 | 3300013307 | Ga0157372_10026323 | Ga0157372_100263237 | 410 |
| 40 | 3300013307 | Ga0157372_10062321 | Ga0157372_100623213 | 410 |
| 41 | 3300013307 | Ga0157372_10071886 | Ga0157372_100718863 | 410 |
| 42 | 3300025913 | Ga0207695_10007320 | Ga0207695_100073207 | 410 |
| 43 | 3300025913 | Ga0207695_10067763 | Ga0207695_100677633 | 410 |
| 44 | 3300025919 | Ga0207657_10088550 | Ga0207657_100885502 | 410 |
| 45 | 3300025921 | Ga0207652_10072821 | Ga0207652_100728212 | 410 |
| 46 | 3300025929 | Ga0207664_10058856 | Ga0207664_100588562 | 410 |
| 47 | 3300026041 | Ga0207639_10040679 | Ga0207639_100406793 | 410 |
| 48 | 3300026142 | Ga0207698_10031550 | Ga0207698_100315502 | 410 |
| 49 | 3300050514 | nmdc:mga08x19_131346_c1 | nmdc:mga08x19_131346_c1_160_1476 | 410 |
| 50 | 3300031665 | Ga0316575_10029350 | Ga0316575_100293502 | 411 |
| 51 | 3300013307 | Ga0157372_10132408 | Ga0157372_101324082 | 412 |
| 52 | 3300005327 | Ga0070658_10005958 | Ga0070658_100059583 | 413 |
| 53 | 3300005327 | Ga0070658_10031632 | Ga0070658_100316324 | 413 |
| 54 | 3300005327 | Ga0070658_10186300 | Ga0070658_101863002 | 413 |
| 55 | 3300005339 | Ga0070660_100000988 | Ga0070660_1000009884 | 413 |
| 56 | 3300005434 | Ga0070709_10011801 | Ga0070709_100118014 | 413 |
| 57 | 3300005458 | Ga0070681_10006571 | Ga0070681_1000657111 | 413 |
| 58 | 3300005535 | Ga0070684_100154571 | Ga0070684_1001545712 | 413 |
| 59 | 3300005539 | Ga0068853_100015189 | Ga0068853_1000151899 | 413 |
| 60 | 3300005545 | Ga0070695_100015323 | Ga0070695_1000153234 | 413 |
| 61 | 3300005616 | Ga0068852_100033731 | Ga0068852_1000337313 | 413 |
| 62 | 3300013100 | Ga0157373_10011153 | Ga0157373_100111532 | 413 |
| 63 | 3300013307 | Ga0157372_10002592 | Ga0157372_100025922 | 413 |
| 64 | 3300013307 | Ga0157372_10141180 | Ga0157372_101411802 | 413 |
| 65 | 3300025906 | Ga0207699_10013731 | Ga0207699_100137312 | 413 |
| 66 | 3300025909 | Ga0207705_10010173 | Ga0207705_100101733 | 413 |
| 67 | 3300025909 | Ga0207705_10036624 | Ga0207705_100366242 | 413 |
| 68 | 3300025912 | Ga0207707_10014780 | Ga0207707_100147806 | 413 |
| 69 | 3300025919 | Ga0207657_10000432 | Ga0207657_1000043210 | 413 |
| 70 | 3300026142 | Ga0207698_10023093 | Ga0207698_100230933 | 413 |
| 71 | 3300044712 | Ga0453684_0000863 | Ga0453684_0000863_48167_49534 | 413 |
| 72 | 3300046536 | Ga0495587_0044145 | Ga0495587_0044145_1051_2373 | 413 |
| 73 | 3300047317 | Ga0495604_0156204 | Ga0495604_0156204_225_1556 | 413 |
| 74 | 3300049571 | Ga0501034_0054130 | Ga0501034_0054130_1499_2821 | 413 |
| 75 | 3300049581 | Ga0501047_0017450 | Ga0501047_0017450_4161_5483 | 413 |
| 76 | 3300049586 | Ga0501070_0034090 | Ga0501070_0034090_1508_2830 | 413 |
| 77 | 3300005328 | Ga0070676_10029821 | Ga0070676_100298212 | 414 |
| 78 | 3300005328 | Ga0070676_10038981 | Ga0070676_100389812 | 414 |
| 79 | 3300005329 | Ga0070683_100166358 | Ga0070683_1001663582 | 414 |
| 80 | 3300005340 | Ga0070689_100117232 | Ga0070689_1001172322 | 414 |
| 81 | 3300005344 | Ga0070661_100076407 | Ga0070661_1000764072 | 414 |
| 82 | 3300005353 | Ga0070669_100015837 | Ga0070669_1000158374 | 414 |
| 83 | 3300005354 | Ga0070675_100141778 | Ga0070675_1001417782 | 414 |
| 84 | 3300005356 | Ga0070674_100010563 | Ga0070674_1000105633 | 414 |
| 85 | 3300005365 | Ga0070688_100065229 | Ga0070688_1000652292 | 414 |
| 86 | 3300005366 | Ga0070659_100203791 | Ga0070659_1002037912 | 414 |
| 87 | 3300005564 | Ga0070664_100056291 | Ga0070664_1000562912 | 414 |
| 88 | 3300005564 | Ga0070664_100094160 | Ga0070664_1000941602 | 414 |
| 89 | 3300005618 | Ga0068864_100173452 | Ga0068864_1001734522 | 414 |
| 90 | 3300005840 | Ga0068870_10009164 | Ga0068870_100091643 | 414 |
| 91 | 3300005841 | Ga0068863_100258857 | Ga0068863_1002588572 | 414 |
| 92 | 3300025907 | Ga0207645_10017101 | Ga0207645_100171012 | 414 |
| 93 | 3300025907 | Ga0207645_10043647 | Ga0207645_100436472 | 414 |
| 94 | 3300025908 | Ga0207643_10001974 | Ga0207643_100019746 | 414 |
| 95 | 3300025923 | Ga0207681_10016713 | Ga0207681_100167133 | 414 |
| 96 | 3300025926 | Ga0207659_10030850 | Ga0207659_100308502 | 414 |
| 97 | 3300025926 | Ga0207659_10083691 | Ga0207659_100836912 | 414 |
| 98 | 3300025933 | Ga0207706_10215706 | Ga0207706_102157062 | 414 |
| 99 | 3300025940 | Ga0207691_10010708 | Ga0207691_100107085 | 414 |
| 100 | 3300025940 | Ga0207691_10098222 | Ga0207691_100982222 | 414 |
| 101 | 3300026088 | Ga0207641_10114377 | Ga0207641_101143772 | 414 |
| 102 | 3300026095 | Ga0207676_10235807 | Ga0207676_102358072 | 414 |
| 103 | 3300032004 | Ga0307414_10072866 | Ga0307414_100728661 | 414 |
| 104 | 3300042876 | Ga0451577_0026410 | Ga0451577_0026410_1558_2928 | 414 |
| 105 | 3300044658 | Ga0466972_0003141 | Ga0466972_0003141_5428_6762 | 414 |
| 106 | 3300044712 | Ga0453684_0000003 | Ga0453684_0000003_1207108_1208478 | 414 |
| 107 | 3300048909 | Ga0496106_0078727 | Ga0496106_0078727_506_1831 | 414 |
| 108 | 3300048915 | Ga0496112_0002009 | Ga0496112_0002009_14727_16052 | 414 |
| 109 | 3300025911 | Ga0207654_10001663 | Ga0207654_1000166311 | 415 |
| 110 | 3300005329 | Ga0070683_100063514 | Ga0070683_1000635143 | 416 |
| 111 | 3300005336 | Ga0070680_100001378 | Ga0070680_1000013782 | 416 |
| 112 | 3300005339 | Ga0070660_100023049 | Ga0070660_1000230493 | 416 |
| 113 | 3300005366 | Ga0070659_100032548 | Ga0070659_1000325483 | 416 |
| 114 | 3300005367 | Ga0070667_100047125 | Ga0070667_1000471253 | 416 |
| 115 | 3300005535 | Ga0070684_100016924 | Ga0070684_1000169243 | 416 |
| 116 | 3300005535 | Ga0070684_100250333 | Ga0070684_1002503331 | 416 |
| 117 | 3300005577 | Ga0068857_100019274 | Ga0068857_1000192746 | 416 |
| 118 | 3300005614 | Ga0068856_100016934 | Ga0068856_1000169343 | 416 |
| 119 | 3300005842 | Ga0068858_100070821 | Ga0068858_1000708213 | 416 |
| 120 | 3300005843 | Ga0068860_100029693 | Ga0068860_1000296933 | 416 |
| 121 | 3300009545 | Ga0105237_10055904 | Ga0105237_100559043 | 416 |
| 122 | 3300013100 | Ga0157373_10022516 | Ga0157373_100225164 | 416 |
| 123 | 3300014325 | Ga0163163_10379391 | Ga0163163_103793911 | 416 |
| 124 | 3300014968 | Ga0157379_10200589 | Ga0157379_102005892 | 416 |
| 125 | 3300025904 | Ga0207647_10003399 | Ga0207647_1000339910 | 416 |
| 126 | 3300025912 | Ga0207707_10147574 | Ga0207707_101475742 | 416 |
| 127 | 3300025914 | Ga0207671_10197032 | Ga0207671_101970321 | 416 |
| 128 | 3300025919 | Ga0207657_10000801 | Ga0207657_100008019 | 416 |
| 129 | 3300025920 | Ga0207649_10138583 | Ga0207649_101385831 | 416 |
| 130 | 3300025924 | Ga0207694_10158582 | Ga0207694_101585821 | 416 |
| 131 | 3300025944 | Ga0207661_10049586 | Ga0207661_100495863 | 416 |
| 132 | 3300025949 | Ga0207667_10041717 | Ga0207667_100417172 | 416 |
| 133 | 3300026116 | Ga0207674_10005372 | Ga0207674_1000537214 | 416 |
| 134 | 3300028381 | Ga0268264_10017752 | Ga0268264_100177523 | 416 |
| 135 | 3300005614 | Ga0068856_100002977 | Ga0068856_1000029779 | 417 |
| 136 | 3300026078 | Ga0207702_10006092 | Ga0207702_1000609210 | 417 |
| 137 | 3300031251 | Ga0265327_10000184 | Ga0265327_1000018414 | 417 |
| 138 | 3300005295 | Ga0065707_10082343 | Ga0065707_1008234315 | 419 |
| 139 | 3300005719 | Ga0068861_100002290 | Ga0068861_1000022905 | 419 |
| 140 | 3300037312 | Ga0395899_0001353 | Ga0395899_0001353_6286_7632 | 419 |
| 141 | 3300037418 | Ga0395900_0230317 | Ga0395900_0230317_169_1515 | 419 |
| 142 | 3300038443 | Ga0395901_0048189 | Ga0395901_0048189_1885_3231 | 419 |
| 143 | 3300046660 | Ga0495625_0003057 | Ga0495625_0003057_252_1646 | 419 |
| 144 | 3300048924 | Ga0496121_0027550 | Ga0496121_0027550_3291_4682 | 419 |
| 145 | 3300025915 | Ga0207693_10101830 | Ga0207693_101018302 | 420 |
| 146 | 3300046459 | Ga0495629_0084832 | Ga0495629_0084832_31_1395 | 420 |
| 147 | 3300046476 | Ga0495662_0018438 | Ga0495662_0018438_380_1744 | 420 |
| 148 | 3300046517 | Ga0495630_0168475 | Ga0495630_0168475_240_1604 | 420 |
| 149 | 3300046535 | Ga0495586_0004912 | Ga0495586_0004912_2570_3934 | 420 |
| 150 | 3300046690 | Ga0495624_0064682 | Ga0495624_0064682_122_1486 | 420 |
| 151 | 3300053104 | Ga0500556_0000594 | Ga0500556_0000594_17967_19373 | 421 |
| 152 | 3300005985 | Ga0081539_10000178 | Ga0081539_10000178103 | 422 |
| 153 | 3300006846 | Ga0075430_100004514 | Ga0075430_10000451412 | 422 |
| 154 | 3300006914 | Ga0075436_100016605 | Ga0075436_1000166053 | 422 |
| 155 | 3300007076 | Ga0075435_100143319 | Ga0075435_1001433192 | 422 |
| 156 | 3300049573 | Ga0501037_0121937 | Ga0501037_0121937_465_1793 | 422 |
| 157 | 3300049574 | Ga0501038_0076015 | Ga0501038_0076015_1101_2429 | 422 |
| 158 | 3300049575 | Ga0501039_0040772 | Ga0501039_0040772_1799_3127 | 422 |
| 159 | 3300049576 | Ga0501040_0063395 | Ga0501040_0063395_246_1574 | 422 |
| 160 | 3300049578 | Ga0501042_0045776 | Ga0501042_0045776_1301_2629 | 422 |
| 161 | 3300049587 | Ga0501071_0028153 | Ga0501071_0028153_958_2286 | 422 |
| 162 | 3300049588 | Ga0501072_0006732 | Ga0501072_0006732_1642_2970 | 422 |
| 163 | 3300049589 | Ga0501073_0090630 | Ga0501073_0090630_332_1660 | 422 |
| 164 | 3300049591 | Ga0501075_0004331 | Ga0501075_0004331_2944_4272 | 422 |
| 165 | 3300049592 | Ga0501076_0001278 | Ga0501076_0001278_10782_12110 | 422 |
| 166 | 3300049742 | Ga0501080_0036929 | Ga0501080_0036929_1286_2614 | 422 |
| 167 | 3300049743 | Ga0501081_0003533 | Ga0501081_0003533_4158_5486 | 422 |
| 168 | 3300049824 | Ga0501045_0009431 | Ga0501045_0009431_906_2234 | 422 |
| 169 | 3300050509 | nmdc:mga0qj67_38754_c1 | nmdc:mga0qj67_38754_c1_1125_2453 | 422 |
| 170 | 3300050513 | nmdc:mga0rr50_180967_c1 | nmdc:mga0rr50_180967_c1_190_1518 | 422 |
| 171 | 3300050514 | nmdc:mga08x19_2759_c1 | nmdc:mga08x19_2759_c1_5954_7282 | 422 |
| 172 | 3300054114 | Ga0501084_0010130 | Ga0501084_0010130_1181_2509 | 422 |
| 173 | 3300060353 | Ga0501082_0006786 | Ga0501082_0006786_8120_9448 | 422 |
| 174 | 3300061734 | Ga0530510_0003517 | Ga0530510_0003517_3047_4375 | 422 |
| 175 | 3300005354 | Ga0070675_100093364 | Ga0070675_1000933641 | 423 |
| 176 | 3300005536 | Ga0070697_100001109 | Ga0070697_10000110911 | 423 |
| 177 | 3300006871 | Ga0075434_100089130 | Ga0075434_1000891302 | 423 |
| 178 | 3300006914 | Ga0075436_100010683 | Ga0075436_1000106835 | 423 |
| 179 | 3300006914 | Ga0075436_100031882 | Ga0075436_1000318823 | 423 |
| 180 | 3300027671 | Ga0209588_1023653 | Ga0209588_10236532 | 423 |
| 181 | 3300044712 | Ga0453684_0015282 | Ga0453684_0015282_4572_6014 | 423 |
| 182 | 3300050512 | nmdc:mga0n895_142429_c1 | nmdc:mga0n895_142429_c1_370_1746 | 423 |
| 183 | 3300050514 | nmdc:mga08x19_31475_c1 | nmdc:mga08x19_31475_c1_1598_2974 | 423 |
| 184 | 3300005458 | Ga0070681_10000615 | Ga0070681_1000061523 | 424 |
| 185 | 3300005840 | Ga0068870_10105310 | Ga0068870_101053101 | 424 |
| 186 | 3300025921 | Ga0207652_10014913 | Ga0207652_100149132 | 424 |
| 187 | 3300026118 | Ga0207675_100294094 | Ga0207675_1002940941 | 424 |
| 188 | 3300042437 | Ga0439444_0005968 | Ga0439444_0005968_53_1387 | 424 |
| 189 | 3300042461 | Ga0439460_0006049 | Ga0439460_0006049_208_1542 | 424 |
| 190 | 3300005353 | Ga0070669_100007517 | Ga0070669_1000075174 | 425 |
| 191 | 3300005441 | Ga0070700_100000221 | Ga0070700_1000002214 | 425 |
| 192 | 3300005459 | Ga0068867_100002129 | Ga0068867_10000212912 | 425 |
| 193 | 3300005719 | Ga0068861_100000142 | Ga0068861_10000014227 | 425 |
| 194 | 3300005844 | Ga0068862_100020222 | Ga0068862_1000202223 | 425 |
| 195 | 3300006881 | Ga0068865_100008175 | Ga0068865_1000081753 | 425 |
| 196 | 3300009094 | Ga0111539_10029435 | Ga0111539_100294355 | 425 |
| 197 | 3300009148 | Ga0105243_10004954 | Ga0105243_100049547 | 425 |
| 198 | 3300009553 | Ga0105249_10012640 | Ga0105249_100126405 | 425 |
| 199 | 3300014326 | Ga0157380_10003701 | Ga0157380_100037013 | 425 |
| 200 | 3300025899 | Ga0207642_10015485 | Ga0207642_100154852 | 425 |
| 201 | 3300025923 | Ga0207681_10001243 | Ga0207681_100012438 | 425 |
| 202 | 3300025935 | Ga0207709_10003484 | Ga0207709_100034847 | 425 |
| 203 | 3300025938 | Ga0207704_10002482 | Ga0207704_100024824 | 425 |
| 204 | 3300025940 | Ga0207691_10094133 | Ga0207691_100941332 | 425 |
| 205 | 3300025961 | Ga0207712_10021076 | Ga0207712_100210765 | 425 |
| 206 | 3300026075 | Ga0207708_10000324 | Ga0207708_100003244 | 425 |
| 207 | 3300026089 | Ga0207648_10000680 | Ga0207648_1000068029 | 425 |
| 208 | 3300026116 | Ga0207674_10312041 | Ga0207674_103120411 | 425 |
| 209 | 3300026118 | Ga0207675_100001096 | Ga0207675_1000010968 | 425 |
| 210 | 3300027907 | Ga0207428_10058516 | Ga0207428_100585161 | 425 |
| 211 | 3300028380 | Ga0268265_10001008 | Ga0268265_1000100820 | 425 |
| 212 | 3300035207 | Ga0373942_0002838 | Ga0373942_0002838_1878_3218 | 425 |
| 213 | 3300037471 | Ga0395905_0000373 | Ga0395905_0000373_20717_22078 | 425 |
| 214 | 3300049568 | Ga0501031_0004545 | Ga0501031_0004545_7176_8513 | 425 |
| 215 | 3300049570 | Ga0501033_0004399 | Ga0501033_0004399_7580_8917 | 425 |
| 216 | 3300049572 | Ga0501036_0000101 | Ga0501036_0000101_24721_26058 | 425 |
| 217 | 3300049573 | Ga0501037_0013300 | Ga0501037_0013300_3918_5255 | 425 |
| 218 | 3300049574 | Ga0501038_0001381 | Ga0501038_0001381_10890_12227 | 425 |
| 219 | 3300049575 | Ga0501039_0000117 | Ga0501039_0000117_39910_41247 | 425 |
| 220 | 3300049577 | Ga0501041_0000040 | Ga0501041_0000040_4409_5746 | 425 |
| 221 | 3300049578 | Ga0501042_0000026 | Ga0501042_0000026_39536_40873 | 425 |
| 222 | 3300049579 | Ga0501043_0003448 | Ga0501043_0003448_2137_3474 | 425 |
| 223 | 3300049580 | Ga0501046_0000705 | Ga0501046_0000705_11571_12908 | 425 |
| 224 | 3300049582 | Ga0501048_0000707 | Ga0501048_0000707_20309_21646 | 425 |
| 225 | 3300049584 | Ga0501068_0003419 | Ga0501068_0003419_950_2287 | 425 |
| 226 | 3300049586 | Ga0501070_0011155 | Ga0501070_0011155_2503_3840 | 425 |
| 227 | 3300049587 | Ga0501071_0000133 | Ga0501071_0000133_16202_17539 | 425 |
| 228 | 3300049588 | Ga0501072_0000528 | Ga0501072_0000528_21289_22626 | 425 |
| 229 | 3300049590 | Ga0501074_0011400 | Ga0501074_0011400_699_2036 | 425 |
| 230 | 3300049591 | Ga0501075_0000036 | Ga0501075_0000036_30193_31530 | 425 |
| 231 | 3300049592 | Ga0501076_0000220 | Ga0501076_0000220_12502_13839 | 425 |
| 232 | 3300049593 | Ga0501077_0000855 | Ga0501077_0000855_4957_6294 | 425 |
| 233 | 3300049741 | Ga0501079_0000807 | Ga0501079_0000807_1415_2752 | 425 |
| 234 | 3300049743 | Ga0501081_0000074 | Ga0501081_0000074_16448_17785 | 425 |
| 235 | 3300049822 | Ga0501035_0006460 | Ga0501035_0006460_3259_4596 | 425 |
| 236 | 3300049823 | Ga0501044_0074782 | Ga0501044_0074782_1207_2544 | 425 |
| 237 | 3300049824 | Ga0501045_0000438 | Ga0501045_0000438_19909_21246 | 425 |
| 238 | 3300050511 | nmdc:mga08y16_129903_c1 | nmdc:mga08y16_129903_c1_1244_2581 | 425 |
| 239 | 3300050511 | nmdc:mga08y16_33186_c1 | nmdc:mga08y16_33186_c1_2106_3443 | 425 |
| 240 | 3300050511 | nmdc:mga08y16_46419_c1 | nmdc:mga08y16_46419_c1_873_2222 | 425 |
| 241 | 3300054114 | Ga0501084_0002058 | Ga0501084_0002058_7463_8800 | 425 |
| 242 | 3300060353 | Ga0501082_0000619 | Ga0501082_0000619_7494_8831 | 425 |
| 243 | 3300061734 | Ga0530510_0000117 | Ga0530510_0000117_39445_40782 | 425 |
| 244 | 3300005336 | Ga0070680_100051977 | Ga0070680_1000519772 | 426 |
| 245 | 3300006846 | Ga0075430_100071649 | Ga0075430_1000716492 | 426 |
| 246 | 3300025917 | Ga0207660_10031717 | Ga0207660_100317174 | 426 |
| 247 | 3300042436 | Ga0439435_0015286 | Ga0439435_0015286_439_1794 | 426 |
| 248 | 3300049582 | Ga0501048_0018723 | Ga0501048_0018723_761_2101 | 426 |
| 249 | 3300049824 | Ga0501045_0143922 | Ga0501045_0143922_218_1558 | 426 |
| 250 | 3300050509 | nmdc:mga0qj67_69187_c1 | nmdc:mga0qj67_69187_c1_1026_2366 | 426 |
| 251 | 3300005444 | Ga0070694_100005866 | Ga0070694_1000058664 | 427 |
| 252 | 3300005549 | Ga0070704_100112476 | Ga0070704_1001124762 | 427 |
| 253 | 3300031665 | Ga0316575_10011108 | Ga0316575_100111082 | 427 |
| 254 | 3300031691 | Ga0316579_10000520 | Ga0316579_100005208 | 427 |
| 255 | 3300031728 | Ga0316578_10015641 | Ga0316578_100156411 | 427 |
| 256 | 3300032133 | Ga0316583_10000416 | Ga0316583_100004164 | 427 |
| 257 | 3300036647 | Ga0316582_0004106 | Ga0316582_0004106_1266_2609 | 427 |
| 258 | 3300037588 | Ga0316581_0000502 | Ga0316581_0000502_4697_6040 | 427 |
| 259 | 3300006871 | Ga0075434_100007320 | Ga0075434_1000073203 | 429 |
| 260 | 3300025927 | Ga0207687_10164084 | Ga0207687_101640841 | 429 |
| 261 | 3300050512 | nmdc:mga0n895_12691_c1 | nmdc:mga0n895_12691_c1_1405_2775 | 429 |
| 262 | 3300005330 | Ga0070690_100000927 | Ga0070690_10000092715 | 430 |
| 263 | 3300005334 | Ga0068869_100001406 | Ga0068869_10000140611 | 430 |
| 264 | 3300005336 | Ga0070680_100002509 | Ga0070680_1000025095 | 430 |
| 265 | 3300005337 | Ga0070682_100019159 | Ga0070682_1000191594 | 430 |
| 266 | 3300005338 | Ga0068868_100000449 | Ga0068868_10000044918 | 430 |
| 267 | 3300005340 | Ga0070689_100007325 | Ga0070689_1000073258 | 430 |
| 268 | 3300005340 | Ga0070689_100181860 | Ga0070689_1001818601 | 430 |
| 269 | 3300005341 | Ga0070691_10009951 | Ga0070691_100099516 | 430 |
| 270 | 3300005343 | Ga0070687_100000354 | Ga0070687_1000003544 | 430 |
| 271 | 3300005345 | Ga0070692_10005127 | Ga0070692_100051274 | 430 |
| 272 | 3300005438 | Ga0070701_10000241 | Ga0070701_1000024113 | 430 |
| 273 | 3300005440 | Ga0070705_100000525 | Ga0070705_10000052515 | 430 |
| 274 | 3300005444 | Ga0070694_100010329 | Ga0070694_1000103294 | 430 |
| 275 | 3300005459 | Ga0068867_100001122 | Ga0068867_1000011227 | 430 |
| 276 | 3300005539 | Ga0068853_100058181 | Ga0068853_1000581814 | 430 |
| 277 | 3300005544 | Ga0070686_100001169 | Ga0070686_10000116915 | 430 |
| 278 | 3300005545 | Ga0070695_100001228 | Ga0070695_10000122815 | 430 |
| 279 | 3300005546 | Ga0070696_100000073 | Ga0070696_10000007310 | 430 |
| 280 | 3300005547 | Ga0070693_100000174 | Ga0070693_10000017415 | 430 |
| 281 | 3300005549 | Ga0070704_100013328 | Ga0070704_1000133284 | 430 |
| 282 | 3300005563 | Ga0068855_100049919 | Ga0068855_1000499196 | 430 |
| 283 | 3300005563 | Ga0068855_100128558 | Ga0068855_1001285582 | 430 |
| 284 | 3300005615 | Ga0070702_100000064 | Ga0070702_10000006421 | 430 |
| 285 | 3300005617 | Ga0068859_100003983 | Ga0068859_10000398312 | 430 |
| 286 | 3300005718 | Ga0068866_10000767 | Ga0068866_100007673 | 430 |
| 287 | 3300005719 | Ga0068861_100007637 | Ga0068861_1000076374 | 430 |
| 288 | 3300005842 | Ga0068858_100007715 | Ga0068858_1000077156 | 430 |
| 289 | 3300005842 | Ga0068858_100194623 | Ga0068858_1001946232 | 430 |
| 290 | 3300005843 | Ga0068860_100005459 | Ga0068860_10000545912 | 430 |
| 291 | 3300005843 | Ga0068860_100190677 | Ga0068860_1001906772 | 430 |
| 292 | 3300005844 | Ga0068862_100002417 | Ga0068862_1000024174 | 430 |
| 293 | 3300006237 | Ga0097621_100001935 | Ga0097621_1000019353 | 430 |
| 294 | 3300006358 | Ga0068871_100002401 | Ga0068871_10000240113 | 430 |
| 295 | 3300006844 | Ga0075428_100003071 | Ga0075428_10000307115 | 430 |
| 296 | 3300006871 | Ga0075434_100084733 | Ga0075434_1000847332 | 430 |
| 297 | 3300006880 | Ga0075429_100002001 | Ga0075429_10000200114 | 430 |
| 298 | 3300006881 | Ga0068865_100000441 | Ga0068865_10000044113 | 430 |
| 299 | 3300006931 | Ga0097620_100003983 | Ga0097620_10000398312 | 430 |
| 300 | 3300009098 | Ga0105245_10003281 | Ga0105245_1000328115 | 430 |
| 301 | 3300009148 | Ga0105243_10003096 | Ga0105243_1000309612 | 430 |
| 302 | 3300009174 | Ga0105241_10011676 | Ga0105241_100116764 | 430 |
| 303 | 3300009176 | Ga0105242_10000524 | Ga0105242_1000052420 | 430 |
| 304 | 3300009553 | Ga0105249_10002650 | Ga0105249_1000265014 | 430 |
| 305 | 3300025912 | Ga0207707_10038182 | Ga0207707_100381823 | 430 |
| 306 | 3300025917 | Ga0207660_10008950 | Ga0207660_100089505 | 430 |
| 307 | 3300025918 | Ga0207662_10000112 | Ga0207662_1000011219 | 430 |
| 308 | 3300025927 | Ga0207687_10012569 | Ga0207687_100125694 | 430 |
| 309 | 3300025934 | Ga0207686_10003086 | Ga0207686_100030864 | 430 |
| 310 | 3300025935 | Ga0207709_10006880 | Ga0207709_100068806 | 430 |
| 311 | 3300025936 | Ga0207670_10012276 | Ga0207670_100122764 | 430 |
| 312 | 3300025942 | Ga0207689_10002184 | Ga0207689_1000218415 | 430 |
| 313 | 3300026023 | Ga0207677_10010268 | Ga0207677_100102684 | 430 |
| 314 | 3300026035 | Ga0207703_10009416 | Ga0207703_100094167 | 430 |
| 315 | 3300026035 | Ga0207703_10024405 | Ga0207703_100244054 | 430 |
| 316 | 3300026089 | Ga0207648_10000205 | Ga0207648_1000020546 | 430 |
| 317 | 3300026118 | Ga0207675_100000353 | Ga0207675_10000035315 | 430 |
| 318 | 3300028380 | Ga0268265_10016086 | Ga0268265_100160864 | 430 |
| 319 | 3300028381 | Ga0268264_10002873 | Ga0268264_1000287313 | 430 |
| 320 | 3300037068 | Ga0373925_0008471 | Ga0373925_0008471_636_1988 | 430 |
| 321 | 3300045051 | Ga0451576_0000490 | Ga0451576_0000490_64394_65746 | 430 |
| 322 | 3300046681 | Ga0495647_0000618 | Ga0495647_0000618_8506_9858 | 430 |
| 323 | 3300047321 | Ga0495676_0163596 | Ga0495676_0163596_156_1508 | 430 |
| 324 | 3300049824 | Ga0501045_0163522 | Ga0501045_0163522_112_1497 | 430 |
| 325 | 3300050507 | nmdc:mga05p37_5534_c1 | nmdc:mga05p37_5534_c1_342_1694 | 430 |
| 326 | 3300050508 | nmdc:mga09592_2143_c1 | nmdc:mga09592_2143_c1_10403_11755 | 430 |
| 327 | 3300050511 | nmdc:mga08y16_174969_c1 | nmdc:mga08y16_174969_c1_65_1417 | 430 |
| 328 | 3300050512 | nmdc:mga0n895_353_c1 | nmdc:mga0n895_353_c1_28759_30111 | 430 |
| 329 | 3300050513 | nmdc:mga0rr50_3379_c1 | nmdc:mga0rr50_3379_c1_1020_2372 | 430 |
| 330 | 3300050514 | nmdc:mga08x19_15709_c1 | nmdc:mga08x19_15709_c1_2469_3821 | 430 |
| 331 | 3300050515 | nmdc:mga0a205_9448_c1 | nmdc:mga0a205_9448_c1_6660_8012 | 430 |
| 332 | 3300005435 | Ga0070714_100020772 | Ga0070714_1000207724 | 431 |
| 333 | 3300005435 | Ga0070714_100091409 | Ga0070714_1000914092 | 431 |
| 334 | 3300005439 | Ga0070711_100021793 | Ga0070711_1000217932 | 431 |
| 335 | 3300005546 | Ga0070696_100000392 | Ga0070696_10000039215 | 431 |
| 336 | 3300005615 | Ga0070702_100036127 | Ga0070702_1000361272 | 431 |
| 337 | 3300025928 | Ga0207700_10101039 | Ga0207700_101010392 | 431 |
| 338 | 3300025929 | Ga0207664_10027443 | Ga0207664_100274434 | 431 |
| 339 | 3300026075 | Ga0207708_10140064 | Ga0207708_101400642 | 431 |
| 340 | 3300034817 | Ga0373948_0001938 | Ga0373948_0001938_141_1499 | 431 |
| 341 | 3300035084 | Ga0373928_0002412 | Ga0373928_0002412_1778_3136 | 431 |
| 342 | 3300035088 | Ga0373940_0000559 | Ga0373940_0000559_2900_4258 | 431 |
| 343 | 3300035114 | Ga0373939_0002762 | Ga0373939_0002762_1110_2468 | 431 |
| 344 | 3300035242 | Ga0373962_0009194 | Ga0373962_0009194_674_2032 | 431 |
| 345 | 3300035691 | Ga0373931_0003641 | Ga0373931_0003641_1073_2431 | 431 |
| 346 | 3300045051 | Ga0451576_0032272 | Ga0451576_0032272_3111_4469 | 431 |
| 347 | 3300046454 | Ga0495592_0000656 | Ga0495592_0000656_5168_6541 | 431 |
| 348 | 3300046476 | Ga0495662_0006979 | Ga0495662_0006979_968_2341 | 431 |
| 349 | 3300046511 | Ga0495608_0002698 | Ga0495608_0002698_9197_10570 | 431 |
| 350 | 3300046516 | Ga0495628_0027333 | Ga0495628_0027333_2902_4275 | 431 |
| 351 | 3300046517 | Ga0495630_0008098 | Ga0495630_0008098_279_1652 | 431 |
| 352 | 3300046533 | Ga0495640_0003691 | Ga0495640_0003691_10091_11464 | 431 |
| 353 | 3300046535 | Ga0495586_0003235 | Ga0495586_0003235_2436_3809 | 431 |
| 354 | 3300046536 | Ga0495587_0033246 | Ga0495587_0033246_1076_2449 | 431 |
| 355 | 3300046543 | Ga0495645_0046901 | Ga0495645_0046901_164_1537 | 431 |
| 356 | 3300046559 | Ga0495667_0039319 | Ga0495667_0039319_934_2307 | 431 |
| 357 | 3300046642 | Ga0495634_0015543 | Ga0495634_0015543_2093_3466 | 431 |
| 358 | 3300046663 | Ga0495635_0081089 | Ga0495635_0081089_295_1668 | 431 |
| 359 | 3300046678 | Ga0495599_0004947 | Ga0495599_0004947_1938_3311 | 431 |
| 360 | 3300046683 | Ga0495658_0018241 | Ga0495658_0018241_838_2211 | 431 |
| 361 | 3300046689 | Ga0495613_0026267 | Ga0495613_0026267_2903_4276 | 431 |
| 362 | 3300047317 | Ga0495604_0026863 | Ga0495604_0026863_1746_3119 | 431 |
| 363 | 3300047318 | Ga0495636_0010874 | Ga0495636_0010874_706_2085 | 431 |
| 364 | 3300047322 | Ga0495680_0002481 | Ga0495680_0002481_14890_16263 | 431 |
| 365 | 3300047673 | Ga0495593_0046786 | Ga0495593_0046786_222_1595 | 431 |
| 366 | 3300005617 | Ga0068859_100034196 | Ga0068859_1000341962 | 433 |
| 367 | 3300006931 | Ga0097620_100034197 | Ga0097620_1000341975 | 433 |
| 368 | 3300035398 | Ga0316574_0023616 | Ga0316574_0023616_517_1905 | 433 |
| 369 | 3300009147 | Ga0114129_10028984 | Ga0114129_100289845 | 434 |
| 370 | 3300031730 | Ga0307516_10074905 | Ga0307516_100749053 | 434 |
| 371 | 3300050507 | nmdc:mga05p37_12883_c1 | nmdc:mga05p37_12883_c1_3855_5243 | 434 |
| 372 | 3300035398 | Ga0316574_0005025 | Ga0316574_0005025_3514_4902 | 435 |
| 373 | 3300046462 | Ga0495651_0104114 | Ga0495651_0104114_684_2075 | 435 |
| 374 | 3300044712 | Ga0453684_0262442 | Ga0453684_0262442_476_1891 | 436 |
| 375 | 3300005616 | Ga0068852_100018925 | Ga0068852_1000189254 | 437 |
| 376 | 3300005618 | Ga0068864_100098390 | Ga0068864_1000983902 | 437 |
| 377 | 3300048920 | Ga0496117_0000108 | Ga0496117_0000108_74193_75602 | 438 |
| 378 | 3300005539 | Ga0068853_100156727 | Ga0068853_1001567272 | 439 |
| 379 | 3300009093 | Ga0105240_10164319 | Ga0105240_101643192 | 439 |
| 380 | 3300009545 | Ga0105237_10013282 | Ga0105237_100132823 | 439 |
| 381 | 3300009551 | Ga0105238_10001167 | Ga0105238_1000116710 | 439 |
| 382 | 3300010375 | Ga0105239_10025373 | Ga0105239_100253733 | 439 |
| 383 | 3300013105 | Ga0157369_10000027 | Ga0157369_10000027133 | 439 |
| 384 | 3300025911 | Ga0207654_10068813 | Ga0207654_100688131 | 439 |
| 385 | 3300025913 | Ga0207695_10003459 | Ga0207695_1000345911 | 439 |
| 386 | 3300025914 | Ga0207671_10000870 | Ga0207671_1000087014 | 439 |
| 387 | 3300025924 | Ga0207694_10000733 | Ga0207694_1000073312 | 439 |
| 388 | 3300005344 | Ga0070661_100107019 | Ga0070661_1001070192 | 440 |
| 389 | 3300005539 | Ga0068853_100016632 | Ga0068853_1000166323 | 440 |
| 390 | 3300005563 | Ga0068855_100030133 | Ga0068855_1000301332 | 440 |
| 391 | 3300005614 | Ga0068856_100191927 | Ga0068856_1001919272 | 440 |
| 392 | 3300009545 | Ga0105237_10019747 | Ga0105237_100197475 | 440 |
| 393 | 3300009551 | Ga0105238_10006217 | Ga0105238_100062174 | 440 |
| 394 | 3300013105 | Ga0157369_10001075 | Ga0157369_1000107518 | 440 |
| 395 | 3300013307 | Ga0157372_10000662 | Ga0157372_1000066226 | 440 |
| 396 | 3300025913 | Ga0207695_10000094 | Ga0207695_1000009489 | 440 |
| 397 | 3300025914 | Ga0207671_10029456 | Ga0207671_100294564 | 440 |
| 398 | 3300025920 | Ga0207649_10002267 | Ga0207649_1000226711 | 440 |
| 399 | 3300026041 | Ga0207639_10005207 | Ga0207639_100052079 | 440 |
| 400 | 3300014326 | Ga0157380_10010235 | Ga0157380_100102353 | 441 |
| 401 | 3300005293 | Ga0065715_10098672 | Ga0065715_100986723 | 442 |
| 402 | 3300005295 | Ga0065707_10155562 | Ga0065707_101555621 | 442 |
| 403 | 3300005334 | Ga0068869_100077913 | Ga0068869_1000779132 | 442 |
| 404 | 3300005340 | Ga0070689_100032645 | Ga0070689_1000326454 | 442 |
| 405 | 3300005344 | Ga0070661_100008376 | Ga0070661_1000083767 | 442 |
| 406 | 3300005355 | Ga0070671_100205013 | Ga0070671_1002050132 | 442 |
| 407 | 3300005356 | Ga0070674_100041348 | Ga0070674_1000413482 | 442 |
| 408 | 3300005364 | Ga0070673_100001486 | Ga0070673_1000014867 | 442 |
| 409 | 3300005365 | Ga0070688_100003937 | Ga0070688_1000039377 | 442 |
| 410 | 3300005440 | Ga0070705_100019239 | Ga0070705_1000192392 | 442 |
| 411 | 3300005457 | Ga0070662_100001964 | Ga0070662_1000019648 | 442 |
| 412 | 3300005458 | Ga0070681_10042696 | Ga0070681_100426962 | 442 |
| 413 | 3300005466 | Ga0070685_10087084 | Ga0070685_100870841 | 442 |
| 414 | 3300005535 | Ga0070684_100010615 | Ga0070684_1000106156 | 442 |
| 415 | 3300005543 | Ga0070672_100013257 | Ga0070672_1000132575 | 442 |
| 416 | 3300005544 | Ga0070686_100001796 | Ga0070686_1000017964 | 442 |
| 417 | 3300005564 | Ga0070664_100006476 | Ga0070664_1000064767 | 442 |
| 418 | 3300005615 | Ga0070702_100045490 | Ga0070702_1000454902 | 442 |
| 419 | 3300005617 | Ga0068859_100019099 | Ga0068859_1000190992 | 442 |
| 420 | 3300005719 | Ga0068861_100003787 | Ga0068861_1000037877 | 442 |
| 421 | 3300005719 | Ga0068861_100022685 | Ga0068861_1000226852 | 442 |
| 422 | 3300005840 | Ga0068870_10003836 | Ga0068870_100038362 | 442 |
| 423 | 3300005841 | Ga0068863_100013995 | Ga0068863_1000139957 | 442 |
| 424 | 3300005844 | Ga0068862_100001495 | Ga0068862_10000149514 | 442 |
| 425 | 3300005844 | Ga0068862_100042302 | Ga0068862_1000423022 | 442 |
| 426 | 3300006844 | Ga0075428_100009779 | Ga0075428_1000097794 | 442 |
| 427 | 3300006844 | Ga0075428_100111284 | Ga0075428_1001112842 | 442 |
| 428 | 3300006846 | Ga0075430_100006176 | Ga0075430_1000061767 | 442 |
| 429 | 3300006846 | Ga0075430_100049441 | Ga0075430_1000494414 | 442 |
| 430 | 3300006847 | Ga0075431_100000374 | Ga0075431_10000037410 | 442 |
| 431 | 3300006847 | Ga0075431_100032494 | Ga0075431_1000324942 | 442 |
| 432 | 3300006847 | Ga0075431_100076507 | Ga0075431_1000765071 | 442 |
| 433 | 3300006880 | Ga0075429_100002247 | Ga0075429_1000022474 | 442 |
| 434 | 3300006880 | Ga0075429_100006783 | Ga0075429_1000067836 | 442 |
| 435 | 3300006881 | Ga0068865_100090835 | Ga0068865_1000908352 | 442 |
| 436 | 3300006931 | Ga0097620_100019100 | Ga0097620_1000191002 | 442 |
| 437 | 3300009094 | Ga0111539_10009546 | Ga0111539_100095464 | 442 |
| 438 | 3300009147 | Ga0114129_10018142 | Ga0114129_100181426 | 442 |
| 439 | 3300009177 | Ga0105248_10001365 | Ga0105248_100013656 | 442 |
| 440 | 3300009545 | Ga0105237_10078248 | Ga0105237_100782482 | 442 |
| 441 | 3300009553 | Ga0105249_10016277 | Ga0105249_100162775 | 442 |
| 442 | 3300010375 | Ga0105239_10012223 | Ga0105239_100122233 | 442 |
| 443 | 3300013297 | Ga0157378_10150433 | Ga0157378_101504332 | 442 |
| 444 | 3300014325 | Ga0163163_10001624 | Ga0163163_100016247 | 442 |
| 445 | 3300014745 | Ga0157377_10001418 | Ga0157377_100014187 | 442 |
| 446 | 3300025912 | Ga0207707_10052405 | Ga0207707_100524052 | 442 |
| 447 | 3300025920 | Ga0207649_10169938 | Ga0207649_101699381 | 442 |
| 448 | 3300025925 | Ga0207650_10050493 | Ga0207650_100504932 | 442 |
| 449 | 3300025931 | Ga0207644_10060048 | Ga0207644_100600482 | 442 |
| 450 | 3300025933 | Ga0207706_10006467 | Ga0207706_100064674 | 442 |
| 451 | 3300025936 | Ga0207670_10005633 | Ga0207670_100056336 | 442 |
| 452 | 3300025938 | Ga0207704_10022349 | Ga0207704_100223493 | 442 |
| 453 | 3300025938 | Ga0207704_10126093 | Ga0207704_101260932 | 442 |
| 454 | 3300025942 | Ga0207689_10008435 | Ga0207689_100084352 | 442 |
| 455 | 3300025945 | Ga0207679_10007012 | Ga0207679_100070125 | 442 |
| 456 | 3300025960 | Ga0207651_10002395 | Ga0207651_100023957 | 442 |
| 457 | 3300025972 | Ga0207668_10103504 | Ga0207668_101035042 | 442 |
| 458 | 3300026075 | Ga0207708_10050243 | Ga0207708_100502432 | 442 |
| 459 | 3300026089 | Ga0207648_10015021 | Ga0207648_100150217 | 442 |
| 460 | 3300026118 | Ga0207675_100039099 | Ga0207675_1000390993 | 442 |
| 461 | 3300027907 | Ga0207428_10005769 | Ga0207428_100057692 | 442 |
| 462 | 3300028379 | Ga0268266_10011560 | Ga0268266_100115605 | 442 |
| 463 | 3300028380 | Ga0268265_10001090 | Ga0268265_100010907 | 442 |
| 464 | 3300028380 | Ga0268265_10007957 | Ga0268265_100079572 | 442 |
| 465 | 3300031344 | Ga0265316_10003412 | Ga0265316_1000341215 | 442 |
| 466 | 3300031507 | Ga0307509_10000455 | Ga0307509_1000045551 | 442 |
| 467 | 3300031711 | Ga0265314_10009958 | Ga0265314_100099584 | 442 |
| 468 | 3300031727 | Ga0316576_10005095 | Ga0316576_100050953 | 442 |
| 469 | 3300031728 | Ga0316578_10006368 | Ga0316578_100063684 | 442 |
| 470 | 3300031911 | Ga0307412_10116550 | Ga0307412_101165502 | 442 |
| 471 | 3300032002 | Ga0307416_100040075 | Ga0307416_1000400752 | 442 |
| 472 | 3300032002 | Ga0307416_100068623 | Ga0307416_1000686232 | 442 |
| 473 | 3300032005 | Ga0307411_10108348 | Ga0307411_101083481 | 442 |
| 474 | 3300036712 | Ga0316584_0004423 | Ga0316584_0004423_7304_8710 | 442 |
| 475 | 3300045051 | Ga0451576_0311961 | Ga0451576_0311961_159_1544 | 442 |
| 476 | 3300047472 | Ga0495686_0036227 | Ga0495686_0036227_1692_3077 | 442 |
| 477 | 3300050507 | nmdc:mga05p37_751_c1 | nmdc:mga05p37_751_c1_13535_14920 | 442 |
| 478 | 3300050508 | nmdc:mga09592_20132_c1 | nmdc:mga09592_20132_c1_1596_2981 | 442 |
| 479 | 3300050508 | nmdc:mga09592_2163_c1 | nmdc:mga09592_2163_c1_10924_12309 | 442 |
| 480 | 3300050509 | nmdc:mga0qj67_1265_c1 | nmdc:mga0qj67_1265_c1_3109_4494 | 442 |
| 481 | 3300050510 | nmdc:mga06r32_36183_c1 | nmdc:mga06r32_36183_c1_2401_3786 | 442 |
| 482 | 3300050510 | nmdc:mga06r32_5547_c1 | nmdc:mga06r32_5547_c1_3227_4612 | 442 |
| 483 | 3300050510 | nmdc:mga06r32_682_c1 | nmdc:mga06r32_682_c1_17973_19358 | 442 |
| 484 | 3300050511 | nmdc:mga08y16_17066_c1 | nmdc:mga08y16_17066_c1_5646_7031 | 442 |
| 485 | 3300053178 | Ga0500637_0016589 | Ga0500637_0016589_2333_3718 | 442 |
| 486 | 3300003320 | rootH2_10072900 | rootH2_100729003 | 443 |
| 487 | 3300003323 | rootH1_10006213 | rootH1_1000621317 | 443 |
| 488 | 3300003323 | rootH1_10012258 | rootH1_1001225821 | 443 |
| 489 | 3300005295 | Ga0065707_10000479 | Ga0065707_100004797 | 443 |
| 490 | 3300005335 | Ga0070666_10003471 | Ga0070666_1000347110 | 443 |
| 491 | 3300005530 | Ga0070679_100018677 | Ga0070679_1000186774 | 443 |
| 492 | 3300005616 | Ga0068852_100001074 | Ga0068852_1000010744 | 443 |
| 493 | 3300005841 | Ga0068863_100000945 | Ga0068863_10000094531 | 443 |
| 494 | 3300009092 | Ga0105250_10000036 | Ga0105250_100000362 | 443 |
| 495 | 3300009551 | Ga0105238_10014238 | Ga0105238_100142382 | 443 |
| 496 | 3300013308 | Ga0157375_10366856 | Ga0157375_103668562 | 443 |
| 497 | 3300014325 | Ga0163163_10000117 | Ga0163163_100001179 | 443 |
| 498 | 3300014325 | Ga0163163_10000796 | Ga0163163_1000079621 | 443 |
| 499 | 3300014968 | Ga0157379_10002463 | Ga0157379_1000246310 | 443 |
| 500 | 3300014968 | Ga0157379_10018237 | Ga0157379_100182372 | 443 |
| 501 | 3300025711 | Ga0207696_1001712 | Ga0207696_10017122 | 443 |
| 502 | 3300025921 | Ga0207652_10029999 | Ga0207652_100299992 | 443 |
| 503 | 3300025924 | Ga0207694_10041668 | Ga0207694_100416682 | 443 |
| 504 | 3300025931 | Ga0207644_10187942 | Ga0207644_101879422 | 443 |
| 505 | 3300026035 | Ga0207703_10248058 | Ga0207703_102480581 | 443 |
| 506 | 3300026095 | Ga0207676_10018749 | Ga0207676_100187494 | 443 |
| 507 | 3300026142 | Ga0207698_10001110 | Ga0207698_100011104 | 443 |
| 508 | 3300031251 | Ga0265327_10003280 | Ga0265327_100032803 | 443 |
| 509 | 3300031548 | Ga0307408_100001669 | Ga0307408_1000016692 | 443 |
| 510 | 3300031548 | Ga0307408_100090295 | Ga0307408_1000902952 | 443 |
| 511 | 3300031616 | Ga0307508_10136020 | Ga0307508_101360202 | 443 |
| 512 | 3300031665 | Ga0316575_10031370 | Ga0316575_100313702 | 443 |
| 513 | 3300031727 | Ga0316576_10009785 | Ga0316576_100097852 | 443 |
| 514 | 3300031728 | Ga0316578_10007974 | Ga0316578_100079742 | 443 |
| 515 | 3300031901 | Ga0307406_10001966 | Ga0307406_100019662 | 443 |
| 516 | 3300031903 | Ga0307407_10098414 | Ga0307407_100984142 | 443 |
| 517 | 3300039110 | Ga0400487_38243 | Ga0400487_38243_38840_40228 | 443 |
| 518 | 3300039110 | Ga0400487_50178 | Ga0400487_50178_1491_2879 | 443 |
| 519 | 3300041491 | Ga0451833_1404377 | Ga0451833_1404377_259_1647 | 443 |
| 520 | 3300048905 | Ga0496102_0093734 | Ga0496102_0093734_803_2197 | 443 |
| 521 | 3300048906 | Ga0496103_0021637 | Ga0496103_0021637_1561_2955 | 443 |
| 522 | 3300049758 | Ga0501241_006518 | Ga0501241_006518_578_1975 | 443 |
| 523 | 3300053146 | Ga0500588_0002957 | Ga0500588_0002957_1072_2460 | 443 |
| 524 | iso_pu_bacteria | 2738541276 | 2738715070 | 443 |
| 525 | 3300013297 | Ga0157378_10000016 | Ga0157378_1000001658 | 444 |
| 526 | 3300031665 | Ga0316575_10030846 | Ga0316575_100308462 | 444 |
| 527 | 3300031727 | Ga0316576_10007291 | Ga0316576_100072912 | 444 |
| 528 | 3300031728 | Ga0316578_10002338 | Ga0316578_100023388 | 444 |
| 529 | 3300032139 | Ga0316580_10003666 | Ga0316580_100036664 | 444 |
| 530 | 3300036647 | Ga0316582_0066102 | Ga0316582_0066102_204_1604 | 444 |
| 531 | 3300038725 | Ga0400484_36483 | Ga0400484_36483_228_1619 | 444 |
| 532 | 3300038726 | Ga0400490_20921 | Ga0400490_20921_3752_5143 | 444 |
| 533 | 3300038735 | Ga0400485_13101 | Ga0400485_13101_17453_18844 | 444 |
| 534 | 3300038742 | Ga0400486_01752 | Ga0400486_01752_1256_2647 | 444 |
| 535 | 3300039062 | Ga0400483_084870 | Ga0400483_084870_6521_7912 | 444 |
| 536 | 3300039062 | Ga0400483_159554 | Ga0400483_159554_491_1915 | 444 |
| 537 | 3300039062 | Ga0400483_258475 | Ga0400483_258475_3047_4438 | 444 |
| 538 | 3300039110 | Ga0400487_49882 | Ga0400487_49882_89_1480 | 444 |
| 539 | 3300047322 | Ga0495680_0065975 | Ga0495680_0065975_863_2269 | 444 |
| 540 | 3300049571 | Ga0501034_0046831 | Ga0501034_0046831_1091_2488 | 444 |
| 541 | 3300049579 | Ga0501043_0021471 | Ga0501043_0021471_784_2181 | 444 |
| 542 | 3300049580 | Ga0501046_0016337 | Ga0501046_0016337_1877_3274 | 444 |
| 543 | 3300049581 | Ga0501047_0009204 | Ga0501047_0009204_4634_6031 | 444 |
| 544 | 3300049581 | Ga0501047_0020198 | Ga0501047_0020198_580_1977 | 444 |
| 545 | 3300049586 | Ga0501070_0029805 | Ga0501070_0029805_167_1564 | 444 |
| 546 | 3300049589 | Ga0501073_0155223 | Ga0501073_0155223_136_1533 | 444 |
| 547 | 3300049590 | Ga0501074_0020073 | Ga0501074_0020073_173_1570 | 444 |
| 548 | 3300049742 | Ga0501080_0001158 | Ga0501080_0001158_10250_11647 | 444 |
| 549 | 3300049742 | Ga0501080_0225828 | Ga0501080_0225828_205_1602 | 444 |
| 550 | 3300049823 | Ga0501044_0066659 | Ga0501044_0066659_2097_3494 | 444 |
| 551 | 3300060353 | Ga0501082_0070959 | Ga0501082_0070959_609_2006 | 444 |
| 552 | iso_pu_bacteria | 2739367700 | 2739731419 | 445 |
| 553 | 3300005466 | Ga0070685_10007098 | Ga0070685_100070983 | 446 |
| 554 | 3300009093 | Ga0105240_10001034 | Ga0105240_1000103412 | 446 |
| 555 | 3300010375 | Ga0105239_10336360 | Ga0105239_103363601 | 446 |
| 556 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007470 | 446 |
| 557 | 3300025924 | Ga0207694_10144034 | Ga0207694_101440342 | 446 |
| 558 | 3300035398 | Ga0316574_0053472 | Ga0316574_0053472_263_1660 | 446 |
| 559 | iso_pu_bacteria | 2537561836 | 2538834483 | 446 |
| 560 | iso_pu_bacteria | 2643221562 | 2643830011 | 446 |
| 561 | iso_pu_bacteria | 2643221577 | 2643894584 | 446 |
| 562 | iso_pu_bacteria | 2643221685 | 2644476739 | 446 |
| 563 | iso_pu_bacteria | 2939611941 | 2939612054 | 446 |
| 564 | 3300005577 | Ga0068857_100142325 | Ga0068857_1001423252 | 447 |
| 565 | 3300010375 | Ga0105239_10011975 | Ga0105239_100119753 | 447 |
| 566 | 3300026116 | Ga0207674_10164413 | Ga0207674_101644132 | 447 |
| 567 | 3300013296 | Ga0157374_10014468 | Ga0157374_100144686 | 448 |
| 568 | 3300025261 | Ga0209233_1002561 | Ga0209233_10025613 | 448 |
| 569 | 3300026023 | Ga0207677_10079380 | Ga0207677_100793802 | 448 |
| 570 | 3300028379 | Ga0268266_10192885 | Ga0268266_101928852 | 448 |
| 571 | 3300031665 | Ga0316575_10001433 | Ga0316575_100014335 | 448 |
| 572 | 3300031691 | Ga0316579_10001295 | Ga0316579_100012951 | 448 |
| 573 | 3300031728 | Ga0316578_10023749 | Ga0316578_100237492 | 448 |
| 574 | 3300032137 | Ga0316585_10000238 | Ga0316585_100002389 | 448 |
| 575 | 3300032139 | Ga0316580_10002362 | Ga0316580_100023622 | 448 |
| 576 | 3300036647 | Ga0316582_0023726 | Ga0316582_0023726_2043_3449 | 448 |
| 577 | 3300046460 | Ga0495638_0000069 | Ga0495638_0000069_71111_72508 | 448 |
| 578 | 3300048918 | Ga0496115_0000113 | Ga0496115_0000113_53898_55292 | 448 |
| 579 | 3300048929 | Ga0496126_0000226 | Ga0496126_0000226_90544_91938 | 448 |
| 580 | 3300049569 | Ga0501032_0032566 | Ga0501032_0032566_453_1850 | 448 |
| 581 | 3300049571 | Ga0501034_0020678 | Ga0501034_0020678_5165_6562 | 448 |
| 582 | 3300049572 | Ga0501036_0060923 | Ga0501036_0060923_502_1899 | 448 |
| 583 | 3300049573 | Ga0501037_0069825 | Ga0501037_0069825_1142_2539 | 448 |
| 584 | 3300049579 | Ga0501043_0014067 | Ga0501043_0014067_3478_4875 | 448 |
| 585 | 3300049584 | Ga0501068_0002805 | Ga0501068_0002805_2958_4355 | 448 |
| 586 | 3300049585 | Ga0501069_0009513 | Ga0501069_0009513_1350_2747 | 448 |
| 587 | 3300049586 | Ga0501070_0073191 | Ga0501070_0073191_522_1919 | 448 |
| 588 | 3300049588 | Ga0501072_0009355 | Ga0501072_0009355_2260_3657 | 448 |
| 589 | 3300049590 | Ga0501074_0003355 | Ga0501074_0003355_8406_9803 | 448 |
| 590 | 3300049744 | Ga0501083_0005792 | Ga0501083_0005792_1593_2990 | 448 |
| 591 | 3300049822 | Ga0501035_0075939 | Ga0501035_0075939_1395_2792 | 448 |
| 592 | 3300049823 | Ga0501044_0027394 | Ga0501044_0027394_2619_4016 | 448 |
| 593 | 3300054114 | Ga0501084_0028024 | Ga0501084_0028024_825_2222 | 448 |
| 594 | 3300002067 | JGI24735J21928_10000384 | JGI24735J21928_100003848 | 449 |
| 595 | 3300005364 | Ga0070673_100144925 | Ga0070673_1001449252 | 449 |
| 596 | 3300005367 | Ga0070667_100000090 | Ga0070667_10000009023 | 449 |
| 597 | 3300005539 | Ga0068853_100029306 | Ga0068853_1000293064 | 449 |
| 598 | 3300005543 | Ga0070672_100024344 | Ga0070672_1000243443 | 449 |
| 599 | 3300005563 | Ga0068855_100129020 | Ga0068855_1001290202 | 449 |
| 600 | 3300005614 | Ga0068856_100222297 | Ga0068856_1002222972 | 449 |
| 601 | 3300005841 | Ga0068863_100052569 | Ga0068863_1000525693 | 449 |
| 602 | 3300006237 | Ga0097621_100002704 | Ga0097621_10000270410 | 449 |
| 603 | 3300009177 | Ga0105248_10022243 | Ga0105248_100222437 | 449 |
| 604 | 3300009545 | Ga0105237_10000345 | Ga0105237_1000034512 | 449 |
| 605 | 3300009553 | Ga0105249_10002096 | Ga0105249_100020964 | 449 |
| 606 | 3300013306 | Ga0163162_10013240 | Ga0163162_100132409 | 449 |
| 607 | 3300013307 | Ga0157372_10026717 | Ga0157372_100267176 | 449 |
| 608 | 3300013308 | Ga0157375_10004020 | Ga0157375_1000402012 | 449 |
| 609 | 3300014325 | Ga0163163_10266894 | Ga0163163_102668942 | 449 |
| 610 | 3300014969 | Ga0157376_10014239 | Ga0157376_100142394 | 449 |
| 611 | 3300014969 | Ga0157376_10071820 | Ga0157376_100718202 | 449 |
| 612 | 3300025904 | Ga0207647_10010135 | Ga0207647_100101356 | 449 |
| 613 | 3300025940 | Ga0207691_10002785 | Ga0207691_100027856 | 449 |
| 614 | 3300025949 | Ga0207667_10137158 | Ga0207667_101371582 | 449 |
| 615 | 3300025960 | Ga0207651_10081931 | Ga0207651_100819312 | 449 |
| 616 | 3300025961 | Ga0207712_10004411 | Ga0207712_100044114 | 449 |
| 617 | 3300025961 | Ga0207712_10129932 | Ga0207712_101299322 | 449 |
| 618 | 3300025986 | Ga0207658_10000111 | Ga0207658_1000011137 | 449 |
| 619 | 3300026089 | Ga0207648_10015986 | Ga0207648_100159864 | 449 |
| 620 | 3300037418 | Ga0395900_0002023 | Ga0395900_0002023_7343_8743 | 449 |
| 621 | 3300041494 | Ga0451837_0349640 | Ga0451837_0349640_140_1540 | 449 |
| 622 | 3300044656 | Ga0466969_0000478 | Ga0466969_0000478_14632_16029 | 449 |
| 623 | 3300044684 | Ga0466966_0019315 | Ga0466966_0019315_2797_4194 | 449 |
| 624 | 3300045049 | Ga0466959_0038358 | Ga0466959_0038358_957_2354 | 449 |
| 625 | 3300047472 | Ga0495686_0006564 | Ga0495686_0006564_4768_6171 | 449 |
| 626 | 3300048918 | Ga0496115_0000040 | Ga0496115_0000040_29149_30549 | 449 |
| 627 | 3300048924 | Ga0496121_0060801 | Ga0496121_0060801_750_2153 | 449 |
| 628 | 3300048925 | Ga0496122_0000129 | Ga0496122_0000129_40915_42318 | 449 |
| 629 | 3300048926 | Ga0496123_0000113 | Ga0496123_0000113_161810_163213 | 449 |
| 630 | 3300049822 | Ga0501035_0122745 | Ga0501035_0122745_590_1990 | 449 |
| 631 | 3300049823 | Ga0501044_0080146 | Ga0501044_0080146_468_1868 | 449 |
| 632 | 3300053087 | Ga0500643_007178 | Ga0500643_007178_2549_3952 | 449 |
| 633 | 3300053093 | Ga0500651_0000070 | Ga0500651_0000070_22913_24337 | 449 |
| 634 | 3300053120 | Ga0500597_000277 | Ga0500597_000277_4630_6033 | 449 |
| 635 | 3300002737 | JGI25162J39368_1002209 | JGI25162J39368_10022093 | 450 |
| 636 | 3300002737 | JGI25162J39368_1002625 | JGI25162J39368_10026252 | 450 |
| 637 | 3300002741 | JGI25157J39369_1000653 | JGI25157J39369_100065314 | 450 |
| 638 | 3300003214 | JGI25165J46597_1002505 | JGI25165J46597_10025056 | 450 |
| 639 | 3300005331 | Ga0070670_100003218 | Ga0070670_10000321811 | 450 |
| 640 | 3300005335 | Ga0070666_10000763 | Ga0070666_1000076313 | 450 |
| 641 | 3300005336 | Ga0070680_100039071 | Ga0070680_1000390714 | 450 |
| 642 | 3300005337 | Ga0070682_100001534 | Ga0070682_1000015345 | 450 |
| 643 | 3300005339 | Ga0070660_100043099 | Ga0070660_1000430993 | 450 |
| 644 | 3300005339 | Ga0070660_100138456 | Ga0070660_1001384561 | 450 |
| 645 | 3300005345 | Ga0070692_10041774 | Ga0070692_100417742 | 450 |
| 646 | 3300005366 | Ga0070659_100022398 | Ga0070659_1000223984 | 450 |
| 647 | 3300005435 | Ga0070714_100000068 | Ga0070714_10000006851 | 450 |
| 648 | 3300005457 | Ga0070662_100019012 | Ga0070662_1000190123 | 450 |
| 649 | 3300005458 | Ga0070681_10076625 | Ga0070681_100766252 | 450 |
| 650 | 3300005530 | Ga0070679_100046853 | Ga0070679_1000468533 | 450 |
| 651 | 3300005539 | Ga0068853_100002360 | Ga0068853_1000023608 | 450 |
| 652 | 3300005539 | Ga0068853_100037242 | Ga0068853_1000372422 | 450 |
| 653 | 3300005539 | Ga0068853_100073602 | Ga0068853_1000736022 | 450 |
| 654 | 3300005548 | Ga0070665_100001823 | Ga0070665_10000182312 | 450 |
| 655 | 3300005563 | Ga0068855_100007320 | Ga0068855_1000073206 | 450 |
| 656 | 3300005563 | Ga0068855_100018068 | Ga0068855_1000180689 | 450 |
| 657 | 3300005577 | Ga0068857_100045342 | Ga0068857_1000453423 | 450 |
| 658 | 3300005842 | Ga0068858_100007811 | Ga0068858_1000078119 | 450 |
| 659 | 3300006881 | Ga0068865_100072545 | Ga0068865_1000725451 | 450 |
| 660 | 3300009551 | Ga0105238_10002155 | Ga0105238_1000215515 | 450 |
| 661 | 3300009551 | Ga0105238_10012095 | Ga0105238_100120954 | 450 |
| 662 | 3300009551 | Ga0105238_10119898 | Ga0105238_101198982 | 450 |
| 663 | 3300009553 | Ga0105249_10013387 | Ga0105249_100133875 | 450 |
| 664 | 3300010375 | Ga0105239_10092959 | Ga0105239_100929592 | 450 |
| 665 | 3300013100 | Ga0157373_10006832 | Ga0157373_100068326 | 450 |
| 666 | 3300013102 | Ga0157371_10011744 | Ga0157371_100117442 | 450 |
| 667 | 3300013104 | Ga0157370_10005696 | Ga0157370_1000569610 | 450 |
| 668 | 3300013104 | Ga0157370_10006493 | Ga0157370_100064939 | 450 |
| 669 | 3300013104 | Ga0157370_10017218 | Ga0157370_100172184 | 450 |
| 670 | 3300013306 | Ga0163162_10000107 | Ga0163162_1000010736 | 450 |
| 671 | 3300013307 | Ga0157372_10005146 | Ga0157372_100051469 | 450 |
| 672 | 3300013307 | Ga0157372_10097654 | Ga0157372_100976542 | 450 |
| 673 | 3300014969 | Ga0157376_10148990 | Ga0157376_101489902 | 450 |
| 674 | 3300025903 | Ga0207680_10006404 | Ga0207680_100064045 | 450 |
| 675 | 3300025904 | Ga0207647_10000440 | Ga0207647_1000044020 | 450 |
| 676 | 3300025904 | Ga0207647_10005409 | Ga0207647_100054099 | 450 |
| 677 | 3300025909 | Ga0207705_10041241 | Ga0207705_100412412 | 450 |
| 678 | 3300025912 | Ga0207707_10010940 | Ga0207707_100109409 | 450 |
| 679 | 3300025913 | Ga0207695_10004403 | Ga0207695_100044033 | 450 |
| 680 | 3300025913 | Ga0207695_10006570 | Ga0207695_100065702 | 450 |
| 681 | 3300025913 | Ga0207695_10044722 | Ga0207695_100447222 | 450 |
| 682 | 3300025919 | Ga0207657_10009593 | Ga0207657_100095936 | 450 |
| 683 | 3300025921 | Ga0207652_10054362 | Ga0207652_100543622 | 450 |
| 684 | 3300025924 | Ga0207694_10003366 | Ga0207694_100033668 | 450 |
| 685 | 3300025924 | Ga0207694_10035694 | Ga0207694_100356943 | 450 |
| 686 | 3300025925 | Ga0207650_10038845 | Ga0207650_100388452 | 450 |
| 687 | 3300025929 | Ga0207664_10000056 | Ga0207664_1000005662 | 450 |
| 688 | 3300025932 | Ga0207690_10001271 | Ga0207690_1000127111 | 450 |
| 689 | 3300025932 | Ga0207690_10010257 | Ga0207690_100102572 | 450 |
| 690 | 3300025932 | Ga0207690_10013552 | Ga0207690_100135522 | 450 |
| 691 | 3300025932 | Ga0207690_10034784 | Ga0207690_100347843 | 450 |
| 692 | 3300025933 | Ga0207706_10055575 | Ga0207706_100555752 | 450 |
| 693 | 3300025949 | Ga0207667_10008959 | Ga0207667_100089595 | 450 |
| 694 | 3300025949 | Ga0207667_10131369 | Ga0207667_101313692 | 450 |
| 695 | 3300025961 | Ga0207712_10002072 | Ga0207712_100020729 | 450 |
| 696 | 3300025981 | Ga0207640_10015463 | Ga0207640_100154633 | 450 |
| 697 | 3300025986 | Ga0207658_10022299 | Ga0207658_100222992 | 450 |
| 698 | 3300026035 | Ga0207703_10009557 | Ga0207703_100095577 | 450 |
| 699 | 3300026041 | Ga0207639_10000129 | Ga0207639_100001293 | 450 |
| 700 | 3300026067 | Ga0207678_10000802 | Ga0207678_1000080218 | 450 |
| 701 | 3300026078 | Ga0207702_10109363 | Ga0207702_101093633 | 450 |
| 702 | 3300026116 | Ga0207674_10020189 | Ga0207674_100201896 | 450 |
| 703 | 3300026116 | Ga0207674_10105915 | Ga0207674_101059152 | 450 |
| 704 | 3300026142 | Ga0207698_10016726 | Ga0207698_100167264 | 450 |
| 705 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006421 | 450 |
| 706 | 3300038443 | Ga0395901_0001656 | Ga0395901_0001656_1108_2511 | 450 |
| 707 | 3300042012 | Ga0439455_0000953 | Ga0439455_0000953_1649_3052 | 450 |
| 708 | 3300001915 | JGI24741J21665_1001335 | JGI24741J21665_10013356 | 451 |
| 709 | 3300005336 | Ga0070680_100005660 | Ga0070680_1000056609 | 451 |
| 710 | 3300005458 | Ga0070681_10001087 | Ga0070681_1000108721 | 451 |
| 711 | 3300005530 | Ga0070679_100001221 | Ga0070679_1000012212 | 451 |
| 712 | 3300025912 | Ga0207707_10001306 | Ga0207707_1000130621 | 451 |
| 713 | 3300025917 | Ga0207660_10001321 | Ga0207660_1000132116 | 451 |
| 714 | 3300025921 | Ga0207652_10001132 | Ga0207652_100011324 | 451 |
| 715 | 3300026078 | Ga0207702_10051973 | Ga0207702_100519731 | 451 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dyk-assembly2.cif.gz_B | crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 | 0.8772 | 2 | 163 |
| 2dyk-assembly2.cif.gz_B | crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 | 0.8717 | 2 | 163 |
| 5x4b-assembly2.cif.gz_B | crystal structure of n-terminal g-domain of enga from bacillus subtilis | 0.8649 | 3 | 157 |
| 5x4b-assembly1.cif.gz_A | crystal structure of n-terminal g-domain of enga from bacillus subtilis | 0.8398 | 3 | 161 |
| 1wf3-assembly1.cif.gz_A | crystal structure of gtp-binding protein tt1341 from thermus thermophilus hb8 | 0.8301 | 4 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6P5_199_372_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.896 | 177 | 346 | 3.40.50.300 |
| 2dykB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8772 | 2 | 163 | 3.40.50.300 |
| af_P0A6P5_199_372_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.872 | 177 | 346 | 3.40.50.300 |
| 2dykB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8717 | 2 | 163 | 3.40.50.300 |
| 3r9xA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8689 | 2 | 165 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258SWP5-F1-model_v4 | Ribosome biogenesis GTPase Der | 0.894 | 1 | 137 |
GO:0005525
GO:0043022 |
| AF-A0A7C1DRL4-F1-model_v4 | GTP-binding protein | 0.8922 | 1 | 158 |
GO:0005525
GO:0043022 |
| AF-A0A7C1JEJ0-F1-model_v4 | GTP-binding protein | 0.8794 | 1 | 163 |
GO:0005525
GO:0043022 |
| AF-X1JK79-F1-model_v4 | Era-type G domain-containing protein | 0.878 | 3 | 165 |
GO:0000028
GO:0005525 GO:0005829 GO:0019843 GO:0043024 |
| AF-A0A847IIU0-F1-model_v4 | GTPase Era | 0.876 | 4 | 165 |
GO:0000028
GO:0005525 GO:0005829 GO:0019843 GO:0043024 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar