F476973

General Info

Members Datasets Scaffolds Average Seq Length
715 328 708 452

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100003218|Ga0070670_10000321811
Length 504
Sequence MRADEGNQAIPNPTLPLKGRAHSFAAVVGAAQFSDTLRMLPVVALVGRPNVGKSTLFNVLTRTRDALVHDLPGLTRDRHYGICRLGEREFVVVDTGGLSGEKEGIDALTAHQAELAIDEADIVALVVDARDGVLPQDRNILGRLRKHDKPLLLIVNKIDGVDEGNARSEFASFGFAEPVLTSSAHSRGLSELLEAVEAHLPAVDADALEAADPTDEGIRVAIVGRPNVGKSTLVNRLLGEDRVVVSDIAGTTRDSIRVPLERDGKKYTLIDTAGVRRRARVEEAVEKFSVIKTLQSIAAANVVVLMLDAKEGVSEQDATLIGHVLDEGRALVVAANKWDGLSTYEREQCRNSLERRLDFVPFVKPVFISGLHGSGLAELMRAIVRAHKSATREFGSSELTKALEQAYEGYQPPLVRGHAPKLRFAHPGGTNPPTIVIHGSRTRHIAEGYQRYLENFFRKRFKLEGTPIRIAFKETVNPFAGRKNVLTEGQLRKRQRMIRNAKKR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
6 2739367700 Dyella sp. YR388 Isolate Unclassified
7 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
201 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
202 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
203 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
204 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
221 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
222 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
223 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
224 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
225 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 1.12
Rhizosphere 92.87
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001335 3300001915 Bacteria 7179
2 JGI24735J21928_10000384 3300002067 Bacteria 15443
3 JGI25162J39368_1002209 3300002737 Bacteria 8012
4 JGI25162J39368_1002625 3300002737 Bacteria 6685
5 JGI25157J39369_1000653 3300002741 Bacteria 19231
6 JGI25165J46597_1002505 3300003214 Bacteria 5821
7 rootH2_10029880 3300003320 Bacteria 4608
8 rootH2_10072900 3300003320 Bacteria 3477
9 rootH1_10006213 3300003323 Bacteria 24132
10 rootH1_10012258 3300003323 Bacteria 148276
11 Ga0065715_10098672 3300005293 Bacteria 3514
12 Ga0065707_10000479 3300005295 Bacteria 32900
13 Ga0065707_10082343 3300005295 Bacteria 16603
14 Ga0065707_10155562 3300005295 Bacteria 1612
15 Ga0070658_10005958 3300005327 Bacteria 9891
16 Ga0070658_10016622 3300005327 Bacteria 5888
17 Ga0070658_10031632 3300005327 Bacteria 4250
18 Ga0070658_10186300 3300005327 Bacteria 1748
19 Ga0070676_10029821 3300005328 Bacteria 3106
20 Ga0070676_10038981 3300005328 Bacteria 2746
21 Ga0070683_100063514 3300005329 Bacteria 3435
22 Ga0070683_100166358 3300005329 Bacteria 2092
23 Ga0070690_100000927 3300005330 Bacteria 14948
24 Ga0070670_100003218 3300005331 Bacteria 13478
25 Ga0068869_100001406 3300005334 Bacteria 14234
26 Ga0068869_100077913 3300005334 Bacteria 2467
27 Ga0070666_10000763 3300005335 Bacteria 19462
28 Ga0070666_10003471 3300005335 Bacteria 9553
29 Ga0070680_100001378 3300005336 Bacteria 17575
30 Ga0070680_100002509 3300005336 Bacteria 13595
31 Ga0070680_100005660 3300005336 Bacteria 9473
32 Ga0070680_100039071 3300005336 Bacteria 3840
33 Ga0070680_100051977 3300005336 Bacteria 3345
34 Ga0070682_100001534 3300005337 Bacteria 12954
35 Ga0070682_100019159 3300005337 Bacteria 4010
36 Ga0068868_100000449 3300005338 Bacteria 27621
37 Ga0070660_100000988 3300005339 Bacteria 19062
38 Ga0070660_100023049 3300005339 Bacteria 4609
39 Ga0070660_100043099 3300005339 Bacteria 3447
40 Ga0070660_100138456 3300005339 Bacteria 1951
41 Ga0070689_100007325 3300005340 Bacteria 7701
42 Ga0070689_100032645 3300005340 Bacteria 3961
43 Ga0070689_100117232 3300005340 Bacteria 2124
44 Ga0070689_100181860 3300005340 Bacteria 1708
45 Ga0070691_10009951 3300005341 Bacteria 4332
46 Ga0070687_100000354 3300005343 Bacteria 15624
47 Ga0070661_100008376 3300005344 Bacteria 7144
48 Ga0070661_100076407 3300005344 Bacteria 2468
49 Ga0070661_100107019 3300005344 Bacteria 2085
50 Ga0070692_10005127 3300005345 Bacteria 5544
51 Ga0070692_10041774 3300005345 Bacteria 2351
52 Ga0070669_100007517 3300005353 Bacteria 7802
53 Ga0070669_100015837 3300005353 Bacteria 5377
54 Ga0070675_100093364 3300005354 Bacteria 2523
55 Ga0070675_100141778 3300005354 Bacteria 2054
56 Ga0070671_100205013 3300005355 Bacteria 1672
57 Ga0070674_100010563 3300005356 Bacteria 5587
58 Ga0070674_100041348 3300005356 Bacteria 3123
59 Ga0070673_100001486 3300005364 Bacteria 13747
60 Ga0070673_100144925 3300005364 Bacteria 2007
61 Ga0070688_100003937 3300005365 Bacteria 7702
62 Ga0070688_100065229 3300005365 Bacteria 2314
63 Ga0070659_100022398 3300005366 Bacteria 4823
64 Ga0070659_100032548 3300005366 Bacteria 4045
65 Ga0070659_100203791 3300005366 Bacteria 1629
66 Ga0070667_100000090 3300005367 Bacteria 112981
67 Ga0070667_100047125 3300005367 Bacteria 3626
68 Ga0070709_10011801 3300005434 Bacteria 4879
69 Ga0070714_100000068 3300005435 Bacteria 94765
70 Ga0070714_100020772 3300005435 Bacteria 5367
71 Ga0070714_100091409 3300005435 Bacteria 2667
72 Ga0070701_10000241 3300005438 Bacteria 17477
73 Ga0070711_100021793 3300005439 Bacteria 4147
74 Ga0070705_100000525 3300005440 Bacteria 22115
75 Ga0070705_100019239 3300005440 Bacteria 3592
76 Ga0070700_100000221 3300005441 Bacteria 31693
77 Ga0070694_100005866 3300005444 Bacteria 7450
78 Ga0070694_100010329 3300005444 Bacteria 5757
79 Ga0070662_100001964 3300005457 Bacteria 12628
80 Ga0070662_100019012 3300005457 Bacteria 4657
81 Ga0070681_10000615 3300005458 Bacteria 29209
82 Ga0070681_10001087 3300005458 Bacteria 23195
83 Ga0070681_10006571 3300005458 Bacteria 11322
84 Ga0070681_10042696 3300005458 Bacteria 4543
85 Ga0070681_10076625 3300005458 Bacteria 3302
86 Ga0068867_100001122 3300005459 Bacteria 18326
87 Ga0068867_100002129 3300005459 Bacteria 13901
88 Ga0070685_10007098 3300005466 Bacteria 5722
89 Ga0070685_10087084 3300005466 Bacteria 1884
90 Ga0070679_100001221 3300005530 Bacteria 22602
91 Ga0070679_100018677 3300005530 Bacteria 6730
92 Ga0070679_100029808 3300005530 Bacteria 5383
93 Ga0070679_100046853 3300005530 Bacteria 4310
94 Ga0070684_100010615 3300005535 Bacteria 7305
95 Ga0070684_100016924 3300005535 Bacteria 5972
96 Ga0070684_100154571 3300005535 Bacteria 2080
97 Ga0070684_100250333 3300005535 Bacteria 1619
98 Ga0070697_100001109 3300005536 Bacteria 20376
99 Ga0068853_100002360 3300005539 Bacteria 14123
100 Ga0068853_100015189 3300005539 Bacteria 6331
101 Ga0068853_100016632 3300005539 Bacteria 6056
102 Ga0068853_100029306 3300005539 Bacteria 4638
103 Ga0068853_100037242 3300005539 Bacteria 4139
104 Ga0068853_100058181 3300005539 Bacteria 3337
105 Ga0068853_100073602 3300005539 Bacteria 2979
106 Ga0068853_100156727 3300005539 Bacteria 2052
107 Ga0070672_100013257 3300005543 Bacteria 5817
108 Ga0070672_100024344 3300005543 Bacteria 4472
109 Ga0070686_100001169 3300005544 Bacteria 14948
110 Ga0070686_100001796 3300005544 Bacteria 11966
111 Ga0070695_100001228 3300005545 Bacteria 14082
112 Ga0070695_100015323 3300005545 Bacteria 4629
113 Ga0070696_100000073 3300005546 Bacteria 49104
114 Ga0070696_100000392 3300005546 Bacteria 27022
115 Ga0070693_100000174 3300005547 Bacteria 29811
116 Ga0070665_100001823 3300005548 Bacteria 24183
117 Ga0070704_100013328 3300005549 Bacteria 5099
118 Ga0070704_100112476 3300005549 Bacteria 2075
119 Ga0068855_100007320 3300005563 Bacteria 13374
120 Ga0068855_100018068 3300005563 Bacteria 8474
121 Ga0068855_100030133 3300005563 Bacteria 6489
122 Ga0068855_100049919 3300005563 Bacteria 4933
123 Ga0068855_100128558 3300005563 Bacteria 2895
124 Ga0068855_100129020 3300005563 Bacteria 2889
125 Ga0068855_100213461 3300005563 Bacteria 2167
126 Ga0070664_100006476 3300005564 Bacteria 9439
127 Ga0070664_100056291 3300005564 Bacteria 3341
128 Ga0070664_100094160 3300005564 Bacteria 2597
129 Ga0068857_100019274 3300005577 Bacteria 5990
130 Ga0068857_100045342 3300005577 Bacteria 3900
131 Ga0068857_100142325 3300005577 Bacteria 2168
132 Ga0068856_100002977 3300005614 Bacteria 17350
133 Ga0068856_100016934 3300005614 Bacteria 7062
134 Ga0068856_100191927 3300005614 Bacteria 2056
135 Ga0068856_100222297 3300005614 Bacteria 1904
136 Ga0070702_100000064 3300005615 Bacteria 30037
137 Ga0070702_100036127 3300005615 Bacteria 2734
138 Ga0070702_100045490 3300005615 Bacteria 2483
139 Ga0068852_100001074 3300005616 Bacteria 18054
140 Ga0068852_100008384 3300005616 Bacteria 7617
141 Ga0068852_100018925 3300005616 Bacteria 5438
142 Ga0068852_100033731 3300005616 Bacteria 4254
143 Ga0068859_100003983 3300005617 Bacteria 15063
144 Ga0068859_100019099 3300005617 Bacteria 6883
145 Ga0068859_100034196 3300005617 Bacteria 5102
146 Ga0068864_100098390 3300005618 Bacteria 2591
147 Ga0068864_100173452 3300005618 Bacteria 1968
148 Ga0068866_10000767 3300005718 Bacteria 14425
149 Ga0068861_100000142 3300005719 Bacteria 36697
150 Ga0068861_100002290 3300005719 Bacteria 12425
151 Ga0068861_100003787 3300005719 Bacteria 10101
152 Ga0068861_100007637 3300005719 Bacteria 7421
153 Ga0068861_100022685 3300005719 Bacteria 4526
154 Ga0068870_10003836 3300005840 Bacteria 6405
155 Ga0068870_10009164 3300005840 Bacteria 4488
156 Ga0068870_10105310 3300005840 Bacteria 1601
157 Ga0068863_100000945 3300005841 Bacteria 29155
158 Ga0068863_100013995 3300005841 Bacteria 7731
159 Ga0068863_100052569 3300005841 Bacteria 3860
160 Ga0068863_100258857 3300005841 Bacteria 1682
161 Ga0068858_100007715 3300005842 Bacteria 10388
162 Ga0068858_100007811 3300005842 Bacteria 10326
163 Ga0068858_100070821 3300005842 Bacteria 3232
164 Ga0068858_100194623 3300005842 Bacteria 1916
165 Ga0068860_100005459 3300005843 Bacteria 12888
166 Ga0068860_100029693 3300005843 Bacteria 5260
167 Ga0068860_100190677 3300005843 Bacteria 1984
168 Ga0068862_100001495 3300005844 Bacteria 21445
169 Ga0068862_100002417 3300005844 Bacteria 16576
170 Ga0068862_100020222 3300005844 Bacteria 5560
171 Ga0068862_100042302 3300005844 Bacteria 3881
172 Ga0081539_10000178 3300005985 Bacteria 149201
173 Ga0097621_100001935 3300006237 Bacteria 14131
174 Ga0097621_100002704 3300006237 Bacteria 12132
175 Ga0068871_100002401 3300006358 Bacteria 12776
176 Ga0068871_100106008 3300006358 Bacteria 2359
177 Ga0075428_100003071 3300006844 Bacteria 18219
178 Ga0075428_100009779 3300006844 Bacteria 10658
179 Ga0075428_100111284 3300006844 Bacteria 2983
180 Ga0075430_100004514 3300006846 Bacteria 11733
181 Ga0075430_100006176 3300006846 Bacteria 10096
182 Ga0075430_100049441 3300006846 Bacteria 3549
183 Ga0075430_100071649 3300006846 Bacteria 2907
184 Ga0075431_100000374 3300006847 Bacteria 35679
185 Ga0075431_100032494 3300006847 Bacteria 5377
186 Ga0075431_100076507 3300006847 Bacteria 3454
187 Ga0075434_100007320 3300006871 Bacteria 10215
188 Ga0075434_100084733 3300006871 Bacteria 3168
189 Ga0075434_100089130 3300006871 Bacteria 3087
190 Ga0075429_100002001 3300006880 Bacteria 16939
191 Ga0075429_100002247 3300006880 Bacteria 16165
192 Ga0075429_100006783 3300006880 Bacteria 9933
193 Ga0068865_100000441 3300006881 Bacteria 23086
194 Ga0068865_100008175 3300006881 Bacteria 6458
195 Ga0068865_100072545 3300006881 Bacteria 2446
196 Ga0068865_100090835 3300006881 Bacteria 2215
197 Ga0075436_100010683 3300006914 Bacteria 6298
198 Ga0075436_100016605 3300006914 Bacteria 5039
199 Ga0075436_100031882 3300006914 Bacteria 3631
200 Ga0075436_100046885 3300006914 Bacteria 2981
201 Ga0097620_100003983 3300006931 Bacteria 15063
202 Ga0097620_100019100 3300006931 Bacteria 6883
203 Ga0097620_100034197 3300006931 Bacteria 5102
204 Ga0075435_100143319 3300007076 Bacteria 2006
205 Ga0105250_10000036 3300009092 Bacteria 147009
206 Ga0105240_10001034 3300009093 Bacteria 49457
207 Ga0105240_10030687 3300009093 Bacteria 6983
208 Ga0105240_10152333 3300009093 Bacteria 2753
209 Ga0105240_10164319 3300009093 Bacteria 2634
210 Ga0111539_10009546 3300009094 Bacteria 12248
211 Ga0111539_10029435 3300009094 Bacteria 6689
212 Ga0111539_10037545 3300009094 Bacteria 5848
213 Ga0105245_10003281 3300009098 Bacteria 14520
214 Ga0114129_10018142 3300009147 Bacteria 10021
215 Ga0114129_10028984 3300009147 Bacteria 7842
216 Ga0105243_10003096 3300009148 Bacteria 13681
217 Ga0105243_10004954 3300009148 Bacteria 10435
218 Ga0105241_10011051 3300009174 Bacteria 6623
219 Ga0105241_10011676 3300009174 Bacteria 6447
220 Ga0105241_10054550 3300009174 Bacteria 3060
221 Ga0105242_10000524 3300009176 Bacteria 30157
222 Ga0105248_10001365 3300009177 Bacteria 27260
223 Ga0105248_10022243 3300009177 Bacteria 7031
224 Ga0105237_10000345 3300009545 Bacteria 65477
225 Ga0105237_10013282 3300009545 Bacteria 8640
226 Ga0105237_10019747 3300009545 Bacteria 6957
227 Ga0105237_10055904 3300009545 Bacteria 3952
228 Ga0105237_10069292 3300009545 Bacteria 3523
229 Ga0105237_10078248 3300009545 Bacteria 3296
230 Ga0105238_10001167 3300009551 Bacteria 26450
231 Ga0105238_10002155 3300009551 Bacteria 19900
232 Ga0105238_10006217 3300009551 Bacteria 11864
233 Ga0105238_10012095 3300009551 Bacteria 8697
234 Ga0105238_10014238 3300009551 Bacteria 8043
235 Ga0105238_10119898 3300009551 Bacteria 2611
236 Ga0105249_10002096 3300009553 Bacteria 17301
237 Ga0105249_10002650 3300009553 Bacteria 15482
238 Ga0105249_10012640 3300009553 Bacteria 7443
239 Ga0105249_10013387 3300009553 Bacteria 7245
240 Ga0105249_10016277 3300009553 Bacteria 6596
241 Ga0105239_10011975 3300010375 Bacteria 9670
242 Ga0105239_10012223 3300010375 Bacteria 9569
243 Ga0105239_10025373 3300010375 Bacteria 6525
244 Ga0105239_10055437 3300010375 Bacteria 4347
245 Ga0105239_10092959 3300010375 Bacteria 3330
246 Ga0105239_10336360 3300010375 Bacteria 1704
247 Ga0105246_10020958 3300011119 Bacteria 4198
248 Ga0157373_10006832 3300013100 Bacteria 8495
249 Ga0157373_10011153 3300013100 Bacteria 6614
250 Ga0157373_10022516 3300013100 Bacteria 4572
251 Ga0157371_10011744 3300013102 Bacteria 6729
252 Ga0157370_10005696 3300013104 Bacteria 13928
253 Ga0157370_10006493 3300013104 Bacteria 12883
254 Ga0157370_10008585 3300013104 Bacteria 11003
255 Ga0157370_10017218 3300013104 Bacteria 7294
256 Ga0157370_10107158 3300013104 Bacteria 2614
257 Ga0157369_10000027 3300013105 Bacteria 213988
258 Ga0157369_10001075 3300013105 Bacteria 34218
259 Ga0157369_10005545 3300013105 Bacteria 14659
260 Ga0157369_10018714 3300013105 Bacteria 7767
261 Ga0157369_10186937 3300013105 Bacteria 2178
262 Ga0157374_10014468 3300013296 Bacteria 6904
263 Ga0157378_10000016 3300013297 Bacteria 142649
264 Ga0157378_10002315 3300013297 Bacteria 16942
265 Ga0157378_10150433 3300013297 Bacteria 2168
266 Ga0163162_10000107 3300013306 Bacteria 74745
267 Ga0163162_10013240 3300013306 Bacteria 8056
268 Ga0157372_10000662 3300013307 Bacteria 37834
269 Ga0157372_10002592 3300013307 Bacteria 19566
270 Ga0157372_10005146 3300013307 Bacteria 13902
271 Ga0157372_10026323 3300013307 Bacteria 6329
272 Ga0157372_10026717 3300013307 Bacteria 6282
273 Ga0157372_10062321 3300013307 Bacteria 4178
274 Ga0157372_10071886 3300013307 Bacteria 3898
275 Ga0157372_10097654 3300013307 Bacteria 3350
276 Ga0157372_10132408 3300013307 Bacteria 2870
277 Ga0157372_10141180 3300013307 Bacteria 2775
278 Ga0157375_10004020 3300013308 Bacteria 12761
279 Ga0157375_10366856 3300013308 Bacteria 1606
280 Ga0163163_10000117 3300014325 Bacteria 84938
281 Ga0163163_10000796 3300014325 Bacteria 26715
282 Ga0163163_10001624 3300014325 Bacteria 18915
283 Ga0163163_10266894 3300014325 Bacteria 1763
284 Ga0163163_10379391 3300014325 Bacteria 1471
285 Ga0157380_10003701 3300014326 Bacteria 10513
286 Ga0157380_10010235 3300014326 Bacteria 6739
287 Ga0157377_10001418 3300014745 Bacteria 10340
288 Ga0157379_10002463 3300014968 Bacteria 15500
289 Ga0157379_10018237 3300014968 Bacteria 6185
290 Ga0157379_10200589 3300014968 Bacteria 1804
291 Ga0157376_10014239 3300014969 Bacteria 5964
292 Ga0157376_10071820 3300014969 Bacteria 2943
293 Ga0157376_10148990 3300014969 Bacteria 2108
294 Ga0209233_1002561 3300025261 Bacteria 6623
295 Ga0207696_1001712 3300025711 Bacteria 11378
296 Ga0207642_10015485 3300025899 Bacteria 2843
297 Ga0207680_10006404 3300025903 Bacteria 5693
298 Ga0207647_10000440 3300025904 Bacteria 33864
299 Ga0207647_10003399 3300025904 Bacteria 11928
300 Ga0207647_10005409 3300025904 Bacteria 9373
301 Ga0207647_10010135 3300025904 Bacteria 6663
302 Ga0207699_10013731 3300025906 Bacteria 4154
303 Ga0207645_10017101 3300025907 Bacteria 4791
304 Ga0207645_10043647 3300025907 Bacteria 2870
305 Ga0207643_10001974 3300025908 Bacteria 11324
306 Ga0207705_10010173 3300025909 Bacteria 6844
307 Ga0207705_10036624 3300025909 Bacteria 3511
308 Ga0207705_10041241 3300025909 Bacteria 3311
309 Ga0207654_10001663 3300025911 Bacteria 11613
310 Ga0207654_10068813 3300025911 Bacteria 2096
311 Ga0207707_10001306 3300025912 Bacteria 23212
312 Ga0207707_10010940 3300025912 Bacteria 7892
313 Ga0207707_10014780 3300025912 Bacteria 6802
314 Ga0207707_10038182 3300025912 Bacteria 4197
315 Ga0207707_10052405 3300025912 Bacteria 3553
316 Ga0207707_10147574 3300025912 Bacteria 2056
317 Ga0207695_10000007 3300025913 Bacteria 1092551
318 Ga0207695_10000094 3300025913 Bacteria 265779
319 Ga0207695_10003459 3300025913 Bacteria 22244
320 Ga0207695_10004403 3300025913 Bacteria 19258
321 Ga0207695_10006570 3300025913 Bacteria 15048
322 Ga0207695_10007320 3300025913 Bacteria 14094
323 Ga0207695_10044722 3300025913 Bacteria 4707
324 Ga0207695_10067763 3300025913 Bacteria 3660
325 Ga0207671_10000870 3300025914 Bacteria 38250
326 Ga0207671_10029456 3300025914 Bacteria 4099
327 Ga0207671_10197032 3300025914 Bacteria 1572
328 Ga0207693_10101830 3300025915 Bacteria 2252
329 Ga0207660_10001321 3300025917 Bacteria 16577
330 Ga0207660_10008950 3300025917 Bacteria 6477
331 Ga0207660_10031717 3300025917 Bacteria 3643
332 Ga0207662_10000112 3300025918 Bacteria 38862
333 Ga0207657_10000432 3300025919 Bacteria 44554
334 Ga0207657_10000801 3300025919 Bacteria 33295
335 Ga0207657_10009593 3300025919 Bacteria 9716
336 Ga0207657_10088550 3300025919 Bacteria 2587
337 Ga0207649_10002267 3300025920 Bacteria 10834
338 Ga0207649_10138583 3300025920 Bacteria 1661
339 Ga0207649_10169938 3300025920 Bacteria 1518
340 Ga0207652_10001132 3300025921 Bacteria 24000
341 Ga0207652_10014913 3300025921 Bacteria 6301
342 Ga0207652_10029999 3300025921 Bacteria 4552
343 Ga0207652_10054362 3300025921 Bacteria 3442
344 Ga0207652_10072821 3300025921 Bacteria 2988
345 Ga0207681_10001243 3300025923 Bacteria 16430
346 Ga0207681_10016713 3300025923 Bacteria 4597
347 Ga0207694_10000733 3300025924 Bacteria 29483
348 Ga0207694_10003366 3300025924 Bacteria 12732
349 Ga0207694_10035694 3300025924 Bacteria 3814
350 Ga0207694_10041668 3300025924 Bacteria 3539
351 Ga0207694_10144034 3300025924 Bacteria 1917
352 Ga0207694_10158582 3300025924 Bacteria 1826
353 Ga0207650_10038845 3300025925 Bacteria 3478
354 Ga0207650_10050493 3300025925 Bacteria 3076
355 Ga0207659_10030850 3300025926 Bacteria 3665
356 Ga0207659_10083691 3300025926 Bacteria 2365
357 Ga0207687_10012569 3300025927 Bacteria 5530
358 Ga0207687_10164084 3300025927 Bacteria 1708
359 Ga0207700_10101039 3300025928 Bacteria 2300
360 Ga0207664_10000056 3300025929 Bacteria 125763
361 Ga0207664_10027443 3300025929 Bacteria 4315
362 Ga0207664_10058856 3300025929 Bacteria 3058
363 Ga0207644_10060048 3300025931 Bacteria 2751
364 Ga0207644_10187942 3300025931 Bacteria 1623
365 Ga0207690_10001271 3300025932 Bacteria 15954
366 Ga0207690_10010257 3300025932 Bacteria 5564
367 Ga0207690_10013552 3300025932 Bacteria 4900
368 Ga0207690_10034784 3300025932 Bacteria 3249
369 Ga0207706_10006467 3300025933 Bacteria 10880
370 Ga0207706_10055575 3300025933 Bacteria 3490
371 Ga0207706_10090999 3300025933 Bacteria 2682
372 Ga0207706_10215706 3300025933 Bacteria 1681
373 Ga0207686_10003086 3300025934 Bacteria 8973
374 Ga0207709_10003484 3300025935 Bacteria 9336
375 Ga0207709_10006880 3300025935 Bacteria 6367
376 Ga0207670_10005633 3300025936 Bacteria 6887
377 Ga0207670_10012276 3300025936 Bacteria 5005
378 Ga0207704_10002482 3300025938 Bacteria 8315
379 Ga0207704_10022349 3300025938 Bacteria 3388
380 Ga0207704_10126093 3300025938 Bacteria 1763
381 Ga0207691_10002785 3300025940 Bacteria 17044
382 Ga0207691_10010708 3300025940 Bacteria 8804
383 Ga0207691_10094133 3300025940 Bacteria 2681
384 Ga0207691_10098222 3300025940 Bacteria 2616
385 Ga0207689_10002184 3300025942 Bacteria 18348
386 Ga0207689_10008435 3300025942 Bacteria 8975
387 Ga0207661_10049586 3300025944 Bacteria 3342
388 Ga0207679_10007012 3300025945 Bacteria 7143
389 Ga0207667_10008959 3300025949 Bacteria 11838
390 Ga0207667_10041717 3300025949 Bacteria 4879
391 Ga0207667_10131369 3300025949 Bacteria 2579
392 Ga0207667_10137158 3300025949 Bacteria 2519
393 Ga0207651_10002395 3300025960 Bacteria 8962
394 Ga0207651_10081931 3300025960 Bacteria 2328
395 Ga0207712_10002072 3300025961 Bacteria 13168
396 Ga0207712_10004411 3300025961 Bacteria 8889
397 Ga0207712_10021076 3300025961 Bacteria 4275
398 Ga0207712_10129932 3300025961 Bacteria 1918
399 Ga0207668_10103504 3300025972 Bacteria 2120
400 Ga0207640_10015463 3300025981 Bacteria 4418
401 Ga0207658_10000111 3300025986 Bacteria 89180
402 Ga0207658_10022299 3300025986 Bacteria 4408
403 Ga0207677_10010268 3300026023 Bacteria 5295
404 Ga0207677_10079380 3300026023 Bacteria 2347
405 Ga0207703_10009416 3300026035 Bacteria 7673
406 Ga0207703_10009557 3300026035 Bacteria 7614
407 Ga0207703_10024405 3300026035 Bacteria 4758
408 Ga0207703_10248058 3300026035 Bacteria 1603
409 Ga0207639_10000129 3300026041 Bacteria 55422
410 Ga0207639_10005207 3300026041 Bacteria 8771
411 Ga0207639_10040679 3300026041 Bacteria 3471
412 Ga0207678_10000802 3300026067 Bacteria 28836
413 Ga0207708_10000324 3300026075 Bacteria 37852
414 Ga0207708_10050243 3300026075 Bacteria 3175
415 Ga0207708_10140064 3300026075 Bacteria 1897
416 Ga0207702_10006092 3300026078 Bacteria 10452
417 Ga0207702_10051973 3300026078 Bacteria 3465
418 Ga0207702_10109363 3300026078 Bacteria 2454
419 Ga0207641_10114377 3300026088 Bacteria 2398
420 Ga0207648_10000205 3300026089 Bacteria 62995
421 Ga0207648_10000680 3300026089 Bacteria 38152
422 Ga0207648_10015021 3300026089 Bacteria 7132
423 Ga0207648_10015986 3300026089 Bacteria 6877
424 Ga0207676_10018749 3300026095 Bacteria 5037
425 Ga0207676_10235807 3300026095 Bacteria 1638
426 Ga0207674_10005372 3300026116 Bacteria 15240
427 Ga0207674_10020189 3300026116 Bacteria 7204
428 Ga0207674_10105915 3300026116 Bacteria 2790
429 Ga0207674_10164413 3300026116 Bacteria 2173
430 Ga0207674_10312041 3300026116 Bacteria 1522
431 Ga0207675_100000353 3300026118 Bacteria 43874
432 Ga0207675_100001096 3300026118 Bacteria 26828
433 Ga0207675_100039099 3300026118 Bacteria 4428
434 Ga0207675_100294094 3300026118 Bacteria 1580
435 Ga0207698_10001110 3300026142 Bacteria 15683
436 Ga0207698_10016726 3300026142 Bacteria 4955
437 Ga0207698_10023093 3300026142 Bacteria 4340
438 Ga0207698_10031550 3300026142 Bacteria 3826
439 Ga0209588_1023653 3300027671 Bacteria 1938
440 Ga0207428_10005769 3300027907 Bacteria 11493
441 Ga0207428_10058516 3300027907 Bacteria 3058
442 Ga0268266_10000006 3300028379 Bacteria 1410021
443 Ga0268266_10011560 3300028379 Bacteria 7664
444 Ga0268266_10192885 3300028379 Bacteria 1861
445 Ga0268265_10001008 3300028380 Bacteria 25465
446 Ga0268265_10001090 3300028380 Bacteria 24159
447 Ga0268265_10007957 3300028380 Bacteria 7157
448 Ga0268265_10016086 3300028380 Bacteria 5133
449 Ga0268264_10002873 3300028381 Bacteria 14997
450 Ga0268264_10017752 3300028381 Bacteria 5825
451 Ga0265334_10005231 3300028573 Bacteria 5683
452 Ga0265318_10003631 3300028577 Bacteria 7703
453 Ga0265338_10049560 3300028800 Bacteria 3806
454 Ga0265331_10002428 3300031250 Bacteria 12626
455 Ga0265327_10000184 3300031251 Bacteria 133023
456 Ga0265327_10003280 3300031251 Bacteria 15675
457 Ga0265316_10003412 3300031344 Bacteria 16076
458 Ga0307509_10000455 3300031507 Bacteria 69145
459 Ga0307408_100001669 3300031548 Bacteria 16353
460 Ga0307408_100090295 3300031548 Bacteria 2311
461 Ga0307508_10136020 3300031616 Bacteria 2061
462 Ga0316575_10001433 3300031665 Bacteria 7678
463 Ga0316575_10011108 3300031665 Bacteria 3325
464 Ga0316575_10029350 3300031665 Bacteria 2147
465 Ga0316575_10030846 3300031665 Bacteria 2097
466 Ga0316575_10031370 3300031665 Bacteria 2080
467 Ga0316579_10000520 3300031691 Bacteria 12608
468 Ga0316579_10001295 3300031691 Bacteria 9026
469 Ga0265314_10009958 3300031711 Bacteria 7969
470 Ga0316576_10005095 3300031727 Bacteria 7974
471 Ga0316576_10007291 3300031727 Bacteria 6948
472 Ga0316576_10009785 3300031727 Bacteria 6206
473 Ga0316578_10002338 3300031728 Bacteria 8257
474 Ga0316578_10006368 3300031728 Bacteria 5818
475 Ga0316578_10007974 3300031728 Bacteria 5353
476 Ga0316578_10015641 3300031728 Bacteria 4084
477 Ga0316578_10023749 3300031728 Bacteria 3433
478 Ga0307516_10074905 3300031730 Bacteria 3239
479 Ga0307406_10001966 3300031901 Bacteria 11229
480 Ga0307407_10098414 3300031903 Bacteria 1810
481 Ga0307407_10182721 3300031903 Bacteria 1391
482 Ga0307412_10116550 3300031911 Bacteria 1916
483 Ga0307409_100065015 3300031995 Bacteria 2868
484 Ga0307416_100040075 3300032002 Bacteria 3635
485 Ga0307416_100068623 3300032002 Bacteria 2930
486 Ga0307414_10072866 3300032004 Bacteria 2483
487 Ga0307411_10108348 3300032005 Bacteria 1982
488 Ga0316583_10000416 3300032133 Bacteria 12491
489 Ga0316585_10000238 3300032137 Bacteria 11638
490 Ga0316580_10002362 3300032139 Bacteria 5174
491 Ga0316580_10003666 3300032139 Bacteria 4391
492 Ga0373948_0001938 3300034817 Bacteria 2976
493 Ga0373928_0002412 3300035084 Bacteria 3626
494 Ga0373940_0000559 3300035088 Bacteria 5884
495 Ga0373939_0002762 3300035114 Bacteria 4114
496 Ga0373942_0002838 3300035207 Bacteria 4121
497 Ga0373962_0009194 3300035242 Bacteria 2443
498 Ga0316574_0005025 3300035398 Bacteria 7024
499 Ga0316574_0023616 3300035398 Bacteria 3673
500 Ga0316574_0053472 3300035398 Bacteria 2521
501 Ga0373931_0003641 3300035691 Bacteria 6960
502 Ga0316582_0004106 3300036647 Bacteria 7287
503 Ga0316582_0023726 3300036647 Bacteria 3659
504 Ga0316582_0066102 3300036647 Bacteria 2330
505 Ga0316584_0004423 3300036712 Bacteria 9307
506 Ga0373925_0008471 3300037068 Bacteria 7494
507 Ga0395899_0001353 3300037312 Bacteria 21108
508 Ga0395900_0002023 3300037418 Bacteria 22811
509 Ga0395900_0230317 3300037418 Bacteria 1864
510 Ga0395898_0203179 3300037466 Bacteria 1891
511 Ga0395905_0000373 3300037471 Bacteria 63927
512 Ga0316581_0000502 3300037588 Bacteria 7581
513 Ga0395901_0001656 3300038443 Bacteria 23013
514 Ga0395901_0048189 3300038443 Bacteria 4425
515 Ga0400484_36483 3300038725 Bacteria 8766
516 Ga0400490_20921 3300038726 Bacteria 35909
517 Ga0400485_13101 3300038735 Bacteria 31485
518 Ga0400486_01752 3300038742 Bacteria 4209
519 Ga0400483_084870 3300039062 Bacteria 8827
520 Ga0400483_159554 3300039062 Bacteria 2209
521 Ga0400483_258475 3300039062 Bacteria 12766
522 Ga0400487_38243 3300039110 Bacteria 71080
523 Ga0400487_49882 3300039110 Bacteria 2001
524 Ga0400487_50178 3300039110 Bacteria 3428
525 Ga0451807_1628056 3300041486 Bacteria 1877
526 Ga0451833_1404377 3300041491 Bacteria 1874
527 Ga0451837_0349640 3300041494 Bacteria 1600
528 Ga0439455_0000953 3300042012 Bacteria 4513
529 Ga0439435_0015286 3300042436 Bacteria 1908
530 Ga0439444_0005968 3300042437 Bacteria 1823
531 Ga0439460_0006049 3300042461 Bacteria 2986
532 Ga0451577_0026410 3300042876 Bacteria 5260
533 Ga0466969_0000478 3300044656 Bacteria 21890
534 Ga0466972_0003141 3300044658 Bacteria 8201
535 Ga0466966_0019315 3300044684 Bacteria 4485
536 Ga0453684_0000003 3300044712 Bacteria 1481694
537 Ga0453684_0000863 3300044712 Bacteria 101954
538 Ga0453684_0015282 3300044712 Bacteria 12170
539 Ga0453684_0262442 3300044712 Bacteria 1978
540 Ga0466959_0038358 3300045049 Bacteria 3540
541 Ga0451576_0000490 3300045051 Bacteria 87626
542 Ga0451576_0032272 3300045051 Bacteria 5579
543 Ga0451576_0311961 3300045051 Bacteria 1645
544 Ga0495592_0000656 3300046454 Bacteria 24042
545 Ga0495629_0084832 3300046459 Bacteria 2210
546 Ga0495638_0000069 3300046460 Bacteria 167503
547 Ga0495651_0104114 3300046462 Bacteria 2107
548 Ga0495662_0006979 3300046476 Bacteria 5612
549 Ga0495662_0018438 3300046476 Bacteria 3378
550 Ga0495608_0002698 3300046511 Bacteria 12749
551 Ga0495628_0027333 3300046516 Bacteria 4643
552 Ga0495630_0008098 3300046517 Bacteria 7554
553 Ga0495630_0168475 3300046517 Bacteria 1668
554 Ga0495640_0003691 3300046533 Bacteria 12301
555 Ga0495586_0003235 3300046535 Bacteria 8752
556 Ga0495586_0004912 3300046535 Bacteria 7153
557 Ga0495587_0033246 3300046536 Bacteria 3114
558 Ga0495587_0044145 3300046536 Bacteria 2652
559 Ga0495645_0046901 3300046543 Bacteria 3149
560 Ga0495667_0039319 3300046559 Bacteria 3145
561 Ga0495634_0015543 3300046642 Bacteria 5464
562 Ga0495625_0003057 3300046660 Bacteria 17149
563 Ga0495635_0081089 3300046663 Bacteria 2220
564 Ga0495599_0004947 3300046678 Bacteria 7923
565 Ga0495647_0000618 3300046681 Bacteria 10481
566 Ga0495658_0018241 3300046683 Bacteria 3644
567 Ga0495613_0026267 3300046689 Bacteria 4339
568 Ga0495624_0064682 3300046690 Bacteria 2286
569 Ga0495604_0026863 3300047317 Bacteria 4581
570 Ga0495604_0156204 3300047317 Bacteria 1616
571 Ga0495636_0010874 3300047318 Bacteria 3600
572 Ga0495676_0163596 3300047321 Bacteria 1572
573 Ga0495680_0002481 3300047322 Bacteria 18867
574 Ga0495680_0065975 3300047322 Bacteria 2771
575 Ga0495686_0006564 3300047472 Bacteria 8878
576 Ga0495686_0036227 3300047472 Bacteria 3167
577 Ga0495593_0046786 3300047673 Bacteria 2304
578 Ga0496102_0093734 3300048905 Bacteria 2782
579 Ga0496103_0021637 3300048906 Bacteria 3870
580 Ga0496106_0078727 3300048909 Bacteria 2530
581 Ga0496110_0078151 3300048913 Bacteria 2946
582 Ga0496112_0002009 3300048915 Bacteria 16097
583 Ga0496115_0000040 3300048918 Bacteria 122975
584 Ga0496115_0000113 3300048918 Bacteria 74536
585 Ga0496117_0000108 3300048920 Bacteria 185583
586 Ga0496121_0027550 3300048924 Bacteria 5316
587 Ga0496121_0060801 3300048924 Bacteria 3105
588 Ga0496122_0000129 3300048925 Bacteria 173688
589 Ga0496123_0000113 3300048926 Bacteria 163689
590 Ga0496126_0000226 3300048929 Bacteria 122150
591 Ga0501031_0004545 3300049568 Bacteria 8996
592 Ga0501032_0032566 3300049569 Bacteria 3572
593 Ga0501033_0004399 3300049570 Bacteria 11287
594 Ga0501034_0020678 3300049571 Bacteria 6722
595 Ga0501034_0046831 3300049571 Bacteria 4369
596 Ga0501034_0054130 3300049571 Bacteria 4040
597 Ga0501036_0000101 3300049572 Bacteria 53813
598 Ga0501036_0060923 3300049572 Bacteria 3196
599 Ga0501037_0013300 3300049573 Bacteria 6065
600 Ga0501037_0069825 3300049573 Bacteria 2557
601 Ga0501037_0121937 3300049573 Bacteria 1874
602 Ga0501038_0001381 3300049574 Bacteria 22182
603 Ga0501038_0076015 3300049574 Bacteria 2838
604 Ga0501039_0000117 3300049575 Bacteria 54402
605 Ga0501039_0040772 3300049575 Bacteria 3583
606 Ga0501040_0063395 3300049576 Bacteria 2543
607 Ga0501041_0000040 3300049577 Bacteria 43977
608 Ga0501042_0000026 3300049578 Bacteria 48274
609 Ga0501042_0045776 3300049578 Bacteria 3119
610 Ga0501043_0003448 3300049579 Bacteria 12994
611 Ga0501043_0014067 3300049579 Bacteria 6264
612 Ga0501043_0021471 3300049579 Bacteria 5062
613 Ga0501046_0000705 3300049580 Bacteria 32282
614 Ga0501046_0016337 3300049580 Bacteria 6219
615 Ga0501047_0009204 3300049581 Bacteria 9323
616 Ga0501047_0017450 3300049581 Bacteria 6875
617 Ga0501047_0020198 3300049581 Bacteria 6395
618 Ga0501048_0000707 3300049582 Bacteria 24361
619 Ga0501048_0018723 3300049582 Bacteria 5090
620 Ga0501068_0002805 3300049584 Bacteria 9270
621 Ga0501068_0003419 3300049584 Bacteria 8543
622 Ga0501069_0009513 3300049585 Bacteria 5130
623 Ga0501070_0004718 3300049586 Bacteria 11677
624 Ga0501070_0011155 3300049586 Bacteria 7585
625 Ga0501070_0029805 3300049586 Bacteria 4572
626 Ga0501070_0034090 3300049586 Bacteria 4258
627 Ga0501070_0073191 3300049586 Bacteria 2835
628 Ga0501071_0000133 3300049587 Bacteria 30216
629 Ga0501071_0028153 3300049587 Bacteria 3958
630 Ga0501072_0000528 3300049588 Bacteria 27443
631 Ga0501072_0006732 3300049588 Bacteria 8736
632 Ga0501072_0009355 3300049588 Bacteria 7449
633 Ga0501073_0090630 3300049589 Bacteria 2125
634 Ga0501073_0155223 3300049589 Bacteria 1586
635 Ga0501074_0003355 3300049590 Bacteria 11347
636 Ga0501074_0011400 3300049590 Bacteria 6462
637 Ga0501074_0020073 3300049590 Bacteria 4856
638 Ga0501075_0000036 3300049591 Bacteria 55260
639 Ga0501075_0004331 3300049591 Bacteria 9606
640 Ga0501076_0000220 3300049592 Bacteria 34479
641 Ga0501076_0001278 3300049592 Bacteria 16771
642 Ga0501077_0000855 3300049593 Bacteria 18401
643 Ga0501079_0000807 3300049741 Bacteria 21328
644 Ga0501080_0001158 3300049742 Bacteria 21765
645 Ga0501080_0036929 3300049742 Bacteria 4561
646 Ga0501080_0225828 3300049742 Bacteria 1712
647 Ga0501081_0000074 3300049743 Bacteria 39073
648 Ga0501081_0003533 3300049743 Bacteria 9987
649 Ga0501083_0005792 3300049744 Bacteria 8750
650 Ga0501241_006518 3300049758 Bacteria 2148
651 Ga0501035_0006460 3300049822 Bacteria 11010
652 Ga0501035_0075939 3300049822 Bacteria 2972
653 Ga0501035_0122745 3300049822 Bacteria 2269
654 Ga0501044_0027394 3300049823 Bacteria 6024
655 Ga0501044_0066659 3300049823 Bacteria 3670
656 Ga0501044_0074782 3300049823 Bacteria 3441
657 Ga0501044_0080146 3300049823 Bacteria 3307
658 Ga0501045_0000438 3300049824 Bacteria 25526
659 Ga0501045_0009431 3300049824 Bacteria 6827
660 Ga0501045_0143922 3300049824 Bacteria 1773
661 Ga0501045_0163522 3300049824 Bacteria 1657
662 nmdc:mga05p37_12883_c1 3300050507 Bacteria 9999
663 nmdc:mga05p37_210277_c1 3300050507 Bacteria 2352
664 nmdc:mga05p37_5534_c1 3300050507 Bacteria 14836
665 nmdc:mga05p37_751_c1 3300050507 Bacteria 35968
666 nmdc:mga09592_127895_c1 3300050508 Bacteria 2184
667 nmdc:mga09592_20132_c1 3300050508 Bacteria 5484
668 nmdc:mga09592_2143_c1 3300050508 Bacteria 15926
669 nmdc:mga09592_2163_c1 3300050508 Bacteria 15862
670 nmdc:mga0qj67_1265_c1 3300050509 Bacteria 17724
671 nmdc:mga0qj67_38754_c1 3300050509 Bacteria 3740
672 nmdc:mga0qj67_69187_c1 3300050509 Bacteria 2815
673 nmdc:mga06r32_36183_c1 3300050510 Bacteria 4663
674 nmdc:mga06r32_5547_c1 3300050510 Bacteria 11371
675 nmdc:mga06r32_682_c1 3300050510 Bacteria 29573
676 nmdc:mga08y16_12428_c1 3300050511 Bacteria 8959
677 nmdc:mga08y16_129903_c1 3300050511 Bacteria 2621
678 nmdc:mga08y16_17066_c1 3300050511 Bacteria 7644
679 nmdc:mga08y16_174969_c1 3300050511 Bacteria 2229
680 nmdc:mga08y16_33186_c1 3300050511 Bacteria 5423
681 nmdc:mga08y16_46419_c1 3300050511 Bacteria 4548
682 nmdc:mga0n895_12691_c1 3300050512 Bacteria 7565
683 nmdc:mga0n895_142429_c1 3300050512 Bacteria 2426
684 nmdc:mga0n895_353_c1 3300050512 Bacteria 30930
685 nmdc:mga0rr50_180967_c1 3300050513 Bacteria 1723
686 nmdc:mga0rr50_3379_c1 3300050513 Bacteria 9170
687 nmdc:mga08x19_131346_c1 3300050514 Bacteria 1685
688 nmdc:mga08x19_15709_c1 3300050514 Bacteria 4606
689 nmdc:mga08x19_2759_c1 3300050514 Bacteria 10604
690 nmdc:mga08x19_31475_c1 3300050514 Bacteria 3337
691 nmdc:mga0a205_198283_c1 3300050515 Bacteria 1898
692 nmdc:mga0a205_9448_c1 3300050515 Bacteria 8916
693 Ga0500643_007178 3300053087 Bacteria 4551
694 Ga0500651_0000070 3300053093 Bacteria 67252
695 Ga0500651_0003497 3300053093 Bacteria 8584
696 Ga0500556_0000594 3300053104 Bacteria 23774
697 Ga0500597_000277 3300053120 Bacteria 10325
698 Ga0500588_0002957 3300053146 Bacteria 3535
699 Ga0500637_0016589 3300053178 Bacteria 3928
700 Ga0501084_0002058 3300054114 Bacteria 16062
701 Ga0501084_0010130 3300054114 Bacteria 7790
702 Ga0501084_0028024 3300054114 Bacteria 4707
703 Ga0501082_0000619 3300060353 Bacteria 31222
704 Ga0501082_0006786 3300060353 Bacteria 9894
705 Ga0501082_0070959 3300060353 Bacteria 2999
706 Ga0501082_0222215 3300060353 Bacteria 1643
707 Ga0530510_0000117 3300061734 Bacteria 45062
708 Ga0530510_0003517 3300061734 Bacteria 10775

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10090999 Ga0207706_100909992 349
2 3300050508 nmdc:mga09592_127895_c1 nmdc:mga09592_127895_c1_996_2174 364
3 3300037466 Ga0395898_0203179 Ga0395898_0203179_679_1875 370
4 3300049586 Ga0501070_0004718 Ga0501070_0004718_10477_11667 375
5 3300041486 Ga0451807_1628056 Ga0451807_1628056_635_1843 377
6 3300009174 Ga0105241_10054550 Ga0105241_100545502 381
7 3300028573 Ga0265334_10005231 Ga0265334_100052311 386
8 3300028577 Ga0265318_10003631 Ga0265318_100036314 386
9 3300028800 Ga0265338_10049560 Ga0265338_100495602 386
10 3300060353 Ga0501082_0222215 Ga0501082_0222215_412_1632 389
11 3300050507 nmdc:mga05p37_210277_c1 nmdc:mga05p37_210277_c1_171_1505 391
12 3300013297 Ga0157378_10002315 Ga0157378_100023154 395
13 3300009094 Ga0111539_10037545 Ga0111539_100375455 398
14 3300050511 nmdc:mga08y16_12428_c1 nmdc:mga08y16_12428_c1_3126_4454 398
15 3300031903 Ga0307407_10182721 Ga0307407_101827211 401
16 3300003320 rootH2_10029880 rootH2_100298802 403
17 3300031995 Ga0307409_100065015 Ga0307409_1000650152 404
18 3300048913 Ga0496110_0078151 Ga0496110_0078151_1404_2702 404
19 3300053093 Ga0500651_0003497 Ga0500651_0003497_4268_5668 405
20 3300050515 nmdc:mga0a205_198283_c1 nmdc:mga0a205_198283_c1_380_1702 407
21 3300006358 Ga0068871_100106008 Ga0068871_1001060082 409
22 3300031250 Ga0265331_10002428 Ga0265331_100024282 409
23 3300005327 Ga0070658_10016622 Ga0070658_100166225 410
24 3300005530 Ga0070679_100029808 Ga0070679_1000298085 410
25 3300005563 Ga0068855_100213461 Ga0068855_1002134612 410
26 3300005616 Ga0068852_100008384 Ga0068852_1000083848 410
27 3300006914 Ga0075436_100046885 Ga0075436_1000468852 410
28 3300009093 Ga0105240_10030687 Ga0105240_100306876 410
29 3300009093 Ga0105240_10152333 Ga0105240_101523333 410
30 3300009174 Ga0105241_10011051 Ga0105241_100110515 410
31 3300009545 Ga0105237_10069292 Ga0105237_100692922 410
32 3300010375 Ga0105239_10055437 Ga0105239_100554373 410
33 3300011119 Ga0105246_10020958 Ga0105246_100209584 410
34 3300013104 Ga0157370_10008585 Ga0157370_100085853 410
35 3300013104 Ga0157370_10107158 Ga0157370_101071583 410
36 3300013105 Ga0157369_10005545 Ga0157369_100055455 410
37 3300013105 Ga0157369_10018714 Ga0157369_100187146 410
38 3300013105 Ga0157369_10186937 Ga0157369_101869372 410
39 3300013307 Ga0157372_10026323 Ga0157372_100263237 410
40 3300013307 Ga0157372_10062321 Ga0157372_100623213 410
41 3300013307 Ga0157372_10071886 Ga0157372_100718863 410
42 3300025913 Ga0207695_10007320 Ga0207695_100073207 410
43 3300025913 Ga0207695_10067763 Ga0207695_100677633 410
44 3300025919 Ga0207657_10088550 Ga0207657_100885502 410
45 3300025921 Ga0207652_10072821 Ga0207652_100728212 410
46 3300025929 Ga0207664_10058856 Ga0207664_100588562 410
47 3300026041 Ga0207639_10040679 Ga0207639_100406793 410
48 3300026142 Ga0207698_10031550 Ga0207698_100315502 410
49 3300050514 nmdc:mga08x19_131346_c1 nmdc:mga08x19_131346_c1_160_1476 410
50 3300031665 Ga0316575_10029350 Ga0316575_100293502 411
51 3300013307 Ga0157372_10132408 Ga0157372_101324082 412
52 3300005327 Ga0070658_10005958 Ga0070658_100059583 413
53 3300005327 Ga0070658_10031632 Ga0070658_100316324 413
54 3300005327 Ga0070658_10186300 Ga0070658_101863002 413
55 3300005339 Ga0070660_100000988 Ga0070660_1000009884 413
56 3300005434 Ga0070709_10011801 Ga0070709_100118014 413
57 3300005458 Ga0070681_10006571 Ga0070681_1000657111 413
58 3300005535 Ga0070684_100154571 Ga0070684_1001545712 413
59 3300005539 Ga0068853_100015189 Ga0068853_1000151899 413
60 3300005545 Ga0070695_100015323 Ga0070695_1000153234 413
61 3300005616 Ga0068852_100033731 Ga0068852_1000337313 413
62 3300013100 Ga0157373_10011153 Ga0157373_100111532 413
63 3300013307 Ga0157372_10002592 Ga0157372_100025922 413
64 3300013307 Ga0157372_10141180 Ga0157372_101411802 413
65 3300025906 Ga0207699_10013731 Ga0207699_100137312 413
66 3300025909 Ga0207705_10010173 Ga0207705_100101733 413
67 3300025909 Ga0207705_10036624 Ga0207705_100366242 413
68 3300025912 Ga0207707_10014780 Ga0207707_100147806 413
69 3300025919 Ga0207657_10000432 Ga0207657_1000043210 413
70 3300026142 Ga0207698_10023093 Ga0207698_100230933 413
71 3300044712 Ga0453684_0000863 Ga0453684_0000863_48167_49534 413
72 3300046536 Ga0495587_0044145 Ga0495587_0044145_1051_2373 413
73 3300047317 Ga0495604_0156204 Ga0495604_0156204_225_1556 413
74 3300049571 Ga0501034_0054130 Ga0501034_0054130_1499_2821 413
75 3300049581 Ga0501047_0017450 Ga0501047_0017450_4161_5483 413
76 3300049586 Ga0501070_0034090 Ga0501070_0034090_1508_2830 413
77 3300005328 Ga0070676_10029821 Ga0070676_100298212 414
78 3300005328 Ga0070676_10038981 Ga0070676_100389812 414
79 3300005329 Ga0070683_100166358 Ga0070683_1001663582 414
80 3300005340 Ga0070689_100117232 Ga0070689_1001172322 414
81 3300005344 Ga0070661_100076407 Ga0070661_1000764072 414
82 3300005353 Ga0070669_100015837 Ga0070669_1000158374 414
83 3300005354 Ga0070675_100141778 Ga0070675_1001417782 414
84 3300005356 Ga0070674_100010563 Ga0070674_1000105633 414
85 3300005365 Ga0070688_100065229 Ga0070688_1000652292 414
86 3300005366 Ga0070659_100203791 Ga0070659_1002037912 414
87 3300005564 Ga0070664_100056291 Ga0070664_1000562912 414
88 3300005564 Ga0070664_100094160 Ga0070664_1000941602 414
89 3300005618 Ga0068864_100173452 Ga0068864_1001734522 414
90 3300005840 Ga0068870_10009164 Ga0068870_100091643 414
91 3300005841 Ga0068863_100258857 Ga0068863_1002588572 414
92 3300025907 Ga0207645_10017101 Ga0207645_100171012 414
93 3300025907 Ga0207645_10043647 Ga0207645_100436472 414
94 3300025908 Ga0207643_10001974 Ga0207643_100019746 414
95 3300025923 Ga0207681_10016713 Ga0207681_100167133 414
96 3300025926 Ga0207659_10030850 Ga0207659_100308502 414
97 3300025926 Ga0207659_10083691 Ga0207659_100836912 414
98 3300025933 Ga0207706_10215706 Ga0207706_102157062 414
99 3300025940 Ga0207691_10010708 Ga0207691_100107085 414
100 3300025940 Ga0207691_10098222 Ga0207691_100982222 414
101 3300026088 Ga0207641_10114377 Ga0207641_101143772 414
102 3300026095 Ga0207676_10235807 Ga0207676_102358072 414
103 3300032004 Ga0307414_10072866 Ga0307414_100728661 414
104 3300042876 Ga0451577_0026410 Ga0451577_0026410_1558_2928 414
105 3300044658 Ga0466972_0003141 Ga0466972_0003141_5428_6762 414
106 3300044712 Ga0453684_0000003 Ga0453684_0000003_1207108_1208478 414
107 3300048909 Ga0496106_0078727 Ga0496106_0078727_506_1831 414
108 3300048915 Ga0496112_0002009 Ga0496112_0002009_14727_16052 414
109 3300025911 Ga0207654_10001663 Ga0207654_1000166311 415
110 3300005329 Ga0070683_100063514 Ga0070683_1000635143 416
111 3300005336 Ga0070680_100001378 Ga0070680_1000013782 416
112 3300005339 Ga0070660_100023049 Ga0070660_1000230493 416
113 3300005366 Ga0070659_100032548 Ga0070659_1000325483 416
114 3300005367 Ga0070667_100047125 Ga0070667_1000471253 416
115 3300005535 Ga0070684_100016924 Ga0070684_1000169243 416
116 3300005535 Ga0070684_100250333 Ga0070684_1002503331 416
117 3300005577 Ga0068857_100019274 Ga0068857_1000192746 416
118 3300005614 Ga0068856_100016934 Ga0068856_1000169343 416
119 3300005842 Ga0068858_100070821 Ga0068858_1000708213 416
120 3300005843 Ga0068860_100029693 Ga0068860_1000296933 416
121 3300009545 Ga0105237_10055904 Ga0105237_100559043 416
122 3300013100 Ga0157373_10022516 Ga0157373_100225164 416
123 3300014325 Ga0163163_10379391 Ga0163163_103793911 416
124 3300014968 Ga0157379_10200589 Ga0157379_102005892 416
125 3300025904 Ga0207647_10003399 Ga0207647_1000339910 416
126 3300025912 Ga0207707_10147574 Ga0207707_101475742 416
127 3300025914 Ga0207671_10197032 Ga0207671_101970321 416
128 3300025919 Ga0207657_10000801 Ga0207657_100008019 416
129 3300025920 Ga0207649_10138583 Ga0207649_101385831 416
130 3300025924 Ga0207694_10158582 Ga0207694_101585821 416
131 3300025944 Ga0207661_10049586 Ga0207661_100495863 416
132 3300025949 Ga0207667_10041717 Ga0207667_100417172 416
133 3300026116 Ga0207674_10005372 Ga0207674_1000537214 416
134 3300028381 Ga0268264_10017752 Ga0268264_100177523 416
135 3300005614 Ga0068856_100002977 Ga0068856_1000029779 417
136 3300026078 Ga0207702_10006092 Ga0207702_1000609210 417
137 3300031251 Ga0265327_10000184 Ga0265327_1000018414 417
138 3300005295 Ga0065707_10082343 Ga0065707_1008234315 419
139 3300005719 Ga0068861_100002290 Ga0068861_1000022905 419
140 3300037312 Ga0395899_0001353 Ga0395899_0001353_6286_7632 419
141 3300037418 Ga0395900_0230317 Ga0395900_0230317_169_1515 419
142 3300038443 Ga0395901_0048189 Ga0395901_0048189_1885_3231 419
143 3300046660 Ga0495625_0003057 Ga0495625_0003057_252_1646 419
144 3300048924 Ga0496121_0027550 Ga0496121_0027550_3291_4682 419
145 3300025915 Ga0207693_10101830 Ga0207693_101018302 420
146 3300046459 Ga0495629_0084832 Ga0495629_0084832_31_1395 420
147 3300046476 Ga0495662_0018438 Ga0495662_0018438_380_1744 420
148 3300046517 Ga0495630_0168475 Ga0495630_0168475_240_1604 420
149 3300046535 Ga0495586_0004912 Ga0495586_0004912_2570_3934 420
150 3300046690 Ga0495624_0064682 Ga0495624_0064682_122_1486 420
151 3300053104 Ga0500556_0000594 Ga0500556_0000594_17967_19373 421
152 3300005985 Ga0081539_10000178 Ga0081539_10000178103 422
153 3300006846 Ga0075430_100004514 Ga0075430_10000451412 422
154 3300006914 Ga0075436_100016605 Ga0075436_1000166053 422
155 3300007076 Ga0075435_100143319 Ga0075435_1001433192 422
156 3300049573 Ga0501037_0121937 Ga0501037_0121937_465_1793 422
157 3300049574 Ga0501038_0076015 Ga0501038_0076015_1101_2429 422
158 3300049575 Ga0501039_0040772 Ga0501039_0040772_1799_3127 422
159 3300049576 Ga0501040_0063395 Ga0501040_0063395_246_1574 422
160 3300049578 Ga0501042_0045776 Ga0501042_0045776_1301_2629 422
161 3300049587 Ga0501071_0028153 Ga0501071_0028153_958_2286 422
162 3300049588 Ga0501072_0006732 Ga0501072_0006732_1642_2970 422
163 3300049589 Ga0501073_0090630 Ga0501073_0090630_332_1660 422
164 3300049591 Ga0501075_0004331 Ga0501075_0004331_2944_4272 422
165 3300049592 Ga0501076_0001278 Ga0501076_0001278_10782_12110 422
166 3300049742 Ga0501080_0036929 Ga0501080_0036929_1286_2614 422
167 3300049743 Ga0501081_0003533 Ga0501081_0003533_4158_5486 422
168 3300049824 Ga0501045_0009431 Ga0501045_0009431_906_2234 422
169 3300050509 nmdc:mga0qj67_38754_c1 nmdc:mga0qj67_38754_c1_1125_2453 422
170 3300050513 nmdc:mga0rr50_180967_c1 nmdc:mga0rr50_180967_c1_190_1518 422
171 3300050514 nmdc:mga08x19_2759_c1 nmdc:mga08x19_2759_c1_5954_7282 422
172 3300054114 Ga0501084_0010130 Ga0501084_0010130_1181_2509 422
173 3300060353 Ga0501082_0006786 Ga0501082_0006786_8120_9448 422
174 3300061734 Ga0530510_0003517 Ga0530510_0003517_3047_4375 422
175 3300005354 Ga0070675_100093364 Ga0070675_1000933641 423
176 3300005536 Ga0070697_100001109 Ga0070697_10000110911 423
177 3300006871 Ga0075434_100089130 Ga0075434_1000891302 423
178 3300006914 Ga0075436_100010683 Ga0075436_1000106835 423
179 3300006914 Ga0075436_100031882 Ga0075436_1000318823 423
180 3300027671 Ga0209588_1023653 Ga0209588_10236532 423
181 3300044712 Ga0453684_0015282 Ga0453684_0015282_4572_6014 423
182 3300050512 nmdc:mga0n895_142429_c1 nmdc:mga0n895_142429_c1_370_1746 423
183 3300050514 nmdc:mga08x19_31475_c1 nmdc:mga08x19_31475_c1_1598_2974 423
184 3300005458 Ga0070681_10000615 Ga0070681_1000061523 424
185 3300005840 Ga0068870_10105310 Ga0068870_101053101 424
186 3300025921 Ga0207652_10014913 Ga0207652_100149132 424
187 3300026118 Ga0207675_100294094 Ga0207675_1002940941 424
188 3300042437 Ga0439444_0005968 Ga0439444_0005968_53_1387 424
189 3300042461 Ga0439460_0006049 Ga0439460_0006049_208_1542 424
190 3300005353 Ga0070669_100007517 Ga0070669_1000075174 425
191 3300005441 Ga0070700_100000221 Ga0070700_1000002214 425
192 3300005459 Ga0068867_100002129 Ga0068867_10000212912 425
193 3300005719 Ga0068861_100000142 Ga0068861_10000014227 425
194 3300005844 Ga0068862_100020222 Ga0068862_1000202223 425
195 3300006881 Ga0068865_100008175 Ga0068865_1000081753 425
196 3300009094 Ga0111539_10029435 Ga0111539_100294355 425
197 3300009148 Ga0105243_10004954 Ga0105243_100049547 425
198 3300009553 Ga0105249_10012640 Ga0105249_100126405 425
199 3300014326 Ga0157380_10003701 Ga0157380_100037013 425
200 3300025899 Ga0207642_10015485 Ga0207642_100154852 425
201 3300025923 Ga0207681_10001243 Ga0207681_100012438 425
202 3300025935 Ga0207709_10003484 Ga0207709_100034847 425
203 3300025938 Ga0207704_10002482 Ga0207704_100024824 425
204 3300025940 Ga0207691_10094133 Ga0207691_100941332 425
205 3300025961 Ga0207712_10021076 Ga0207712_100210765 425
206 3300026075 Ga0207708_10000324 Ga0207708_100003244 425
207 3300026089 Ga0207648_10000680 Ga0207648_1000068029 425
208 3300026116 Ga0207674_10312041 Ga0207674_103120411 425
209 3300026118 Ga0207675_100001096 Ga0207675_1000010968 425
210 3300027907 Ga0207428_10058516 Ga0207428_100585161 425
211 3300028380 Ga0268265_10001008 Ga0268265_1000100820 425
212 3300035207 Ga0373942_0002838 Ga0373942_0002838_1878_3218 425
213 3300037471 Ga0395905_0000373 Ga0395905_0000373_20717_22078 425
214 3300049568 Ga0501031_0004545 Ga0501031_0004545_7176_8513 425
215 3300049570 Ga0501033_0004399 Ga0501033_0004399_7580_8917 425
216 3300049572 Ga0501036_0000101 Ga0501036_0000101_24721_26058 425
217 3300049573 Ga0501037_0013300 Ga0501037_0013300_3918_5255 425
218 3300049574 Ga0501038_0001381 Ga0501038_0001381_10890_12227 425
219 3300049575 Ga0501039_0000117 Ga0501039_0000117_39910_41247 425
220 3300049577 Ga0501041_0000040 Ga0501041_0000040_4409_5746 425
221 3300049578 Ga0501042_0000026 Ga0501042_0000026_39536_40873 425
222 3300049579 Ga0501043_0003448 Ga0501043_0003448_2137_3474 425
223 3300049580 Ga0501046_0000705 Ga0501046_0000705_11571_12908 425
224 3300049582 Ga0501048_0000707 Ga0501048_0000707_20309_21646 425
225 3300049584 Ga0501068_0003419 Ga0501068_0003419_950_2287 425
226 3300049586 Ga0501070_0011155 Ga0501070_0011155_2503_3840 425
227 3300049587 Ga0501071_0000133 Ga0501071_0000133_16202_17539 425
228 3300049588 Ga0501072_0000528 Ga0501072_0000528_21289_22626 425
229 3300049590 Ga0501074_0011400 Ga0501074_0011400_699_2036 425
230 3300049591 Ga0501075_0000036 Ga0501075_0000036_30193_31530 425
231 3300049592 Ga0501076_0000220 Ga0501076_0000220_12502_13839 425
232 3300049593 Ga0501077_0000855 Ga0501077_0000855_4957_6294 425
233 3300049741 Ga0501079_0000807 Ga0501079_0000807_1415_2752 425
234 3300049743 Ga0501081_0000074 Ga0501081_0000074_16448_17785 425
235 3300049822 Ga0501035_0006460 Ga0501035_0006460_3259_4596 425
236 3300049823 Ga0501044_0074782 Ga0501044_0074782_1207_2544 425
237 3300049824 Ga0501045_0000438 Ga0501045_0000438_19909_21246 425
238 3300050511 nmdc:mga08y16_129903_c1 nmdc:mga08y16_129903_c1_1244_2581 425
239 3300050511 nmdc:mga08y16_33186_c1 nmdc:mga08y16_33186_c1_2106_3443 425
240 3300050511 nmdc:mga08y16_46419_c1 nmdc:mga08y16_46419_c1_873_2222 425
241 3300054114 Ga0501084_0002058 Ga0501084_0002058_7463_8800 425
242 3300060353 Ga0501082_0000619 Ga0501082_0000619_7494_8831 425
243 3300061734 Ga0530510_0000117 Ga0530510_0000117_39445_40782 425
244 3300005336 Ga0070680_100051977 Ga0070680_1000519772 426
245 3300006846 Ga0075430_100071649 Ga0075430_1000716492 426
246 3300025917 Ga0207660_10031717 Ga0207660_100317174 426
247 3300042436 Ga0439435_0015286 Ga0439435_0015286_439_1794 426
248 3300049582 Ga0501048_0018723 Ga0501048_0018723_761_2101 426
249 3300049824 Ga0501045_0143922 Ga0501045_0143922_218_1558 426
250 3300050509 nmdc:mga0qj67_69187_c1 nmdc:mga0qj67_69187_c1_1026_2366 426
251 3300005444 Ga0070694_100005866 Ga0070694_1000058664 427
252 3300005549 Ga0070704_100112476 Ga0070704_1001124762 427
253 3300031665 Ga0316575_10011108 Ga0316575_100111082 427
254 3300031691 Ga0316579_10000520 Ga0316579_100005208 427
255 3300031728 Ga0316578_10015641 Ga0316578_100156411 427
256 3300032133 Ga0316583_10000416 Ga0316583_100004164 427
257 3300036647 Ga0316582_0004106 Ga0316582_0004106_1266_2609 427
258 3300037588 Ga0316581_0000502 Ga0316581_0000502_4697_6040 427
259 3300006871 Ga0075434_100007320 Ga0075434_1000073203 429
260 3300025927 Ga0207687_10164084 Ga0207687_101640841 429
261 3300050512 nmdc:mga0n895_12691_c1 nmdc:mga0n895_12691_c1_1405_2775 429
262 3300005330 Ga0070690_100000927 Ga0070690_10000092715 430
263 3300005334 Ga0068869_100001406 Ga0068869_10000140611 430
264 3300005336 Ga0070680_100002509 Ga0070680_1000025095 430
265 3300005337 Ga0070682_100019159 Ga0070682_1000191594 430
266 3300005338 Ga0068868_100000449 Ga0068868_10000044918 430
267 3300005340 Ga0070689_100007325 Ga0070689_1000073258 430
268 3300005340 Ga0070689_100181860 Ga0070689_1001818601 430
269 3300005341 Ga0070691_10009951 Ga0070691_100099516 430
270 3300005343 Ga0070687_100000354 Ga0070687_1000003544 430
271 3300005345 Ga0070692_10005127 Ga0070692_100051274 430
272 3300005438 Ga0070701_10000241 Ga0070701_1000024113 430
273 3300005440 Ga0070705_100000525 Ga0070705_10000052515 430
274 3300005444 Ga0070694_100010329 Ga0070694_1000103294 430
275 3300005459 Ga0068867_100001122 Ga0068867_1000011227 430
276 3300005539 Ga0068853_100058181 Ga0068853_1000581814 430
277 3300005544 Ga0070686_100001169 Ga0070686_10000116915 430
278 3300005545 Ga0070695_100001228 Ga0070695_10000122815 430
279 3300005546 Ga0070696_100000073 Ga0070696_10000007310 430
280 3300005547 Ga0070693_100000174 Ga0070693_10000017415 430
281 3300005549 Ga0070704_100013328 Ga0070704_1000133284 430
282 3300005563 Ga0068855_100049919 Ga0068855_1000499196 430
283 3300005563 Ga0068855_100128558 Ga0068855_1001285582 430
284 3300005615 Ga0070702_100000064 Ga0070702_10000006421 430
285 3300005617 Ga0068859_100003983 Ga0068859_10000398312 430
286 3300005718 Ga0068866_10000767 Ga0068866_100007673 430
287 3300005719 Ga0068861_100007637 Ga0068861_1000076374 430
288 3300005842 Ga0068858_100007715 Ga0068858_1000077156 430
289 3300005842 Ga0068858_100194623 Ga0068858_1001946232 430
290 3300005843 Ga0068860_100005459 Ga0068860_10000545912 430
291 3300005843 Ga0068860_100190677 Ga0068860_1001906772 430
292 3300005844 Ga0068862_100002417 Ga0068862_1000024174 430
293 3300006237 Ga0097621_100001935 Ga0097621_1000019353 430
294 3300006358 Ga0068871_100002401 Ga0068871_10000240113 430
295 3300006844 Ga0075428_100003071 Ga0075428_10000307115 430
296 3300006871 Ga0075434_100084733 Ga0075434_1000847332 430
297 3300006880 Ga0075429_100002001 Ga0075429_10000200114 430
298 3300006881 Ga0068865_100000441 Ga0068865_10000044113 430
299 3300006931 Ga0097620_100003983 Ga0097620_10000398312 430
300 3300009098 Ga0105245_10003281 Ga0105245_1000328115 430
301 3300009148 Ga0105243_10003096 Ga0105243_1000309612 430
302 3300009174 Ga0105241_10011676 Ga0105241_100116764 430
303 3300009176 Ga0105242_10000524 Ga0105242_1000052420 430
304 3300009553 Ga0105249_10002650 Ga0105249_1000265014 430
305 3300025912 Ga0207707_10038182 Ga0207707_100381823 430
306 3300025917 Ga0207660_10008950 Ga0207660_100089505 430
307 3300025918 Ga0207662_10000112 Ga0207662_1000011219 430
308 3300025927 Ga0207687_10012569 Ga0207687_100125694 430
309 3300025934 Ga0207686_10003086 Ga0207686_100030864 430
310 3300025935 Ga0207709_10006880 Ga0207709_100068806 430
311 3300025936 Ga0207670_10012276 Ga0207670_100122764 430
312 3300025942 Ga0207689_10002184 Ga0207689_1000218415 430
313 3300026023 Ga0207677_10010268 Ga0207677_100102684 430
314 3300026035 Ga0207703_10009416 Ga0207703_100094167 430
315 3300026035 Ga0207703_10024405 Ga0207703_100244054 430
316 3300026089 Ga0207648_10000205 Ga0207648_1000020546 430
317 3300026118 Ga0207675_100000353 Ga0207675_10000035315 430
318 3300028380 Ga0268265_10016086 Ga0268265_100160864 430
319 3300028381 Ga0268264_10002873 Ga0268264_1000287313 430
320 3300037068 Ga0373925_0008471 Ga0373925_0008471_636_1988 430
321 3300045051 Ga0451576_0000490 Ga0451576_0000490_64394_65746 430
322 3300046681 Ga0495647_0000618 Ga0495647_0000618_8506_9858 430
323 3300047321 Ga0495676_0163596 Ga0495676_0163596_156_1508 430
324 3300049824 Ga0501045_0163522 Ga0501045_0163522_112_1497 430
325 3300050507 nmdc:mga05p37_5534_c1 nmdc:mga05p37_5534_c1_342_1694 430
326 3300050508 nmdc:mga09592_2143_c1 nmdc:mga09592_2143_c1_10403_11755 430
327 3300050511 nmdc:mga08y16_174969_c1 nmdc:mga08y16_174969_c1_65_1417 430
328 3300050512 nmdc:mga0n895_353_c1 nmdc:mga0n895_353_c1_28759_30111 430
329 3300050513 nmdc:mga0rr50_3379_c1 nmdc:mga0rr50_3379_c1_1020_2372 430
330 3300050514 nmdc:mga08x19_15709_c1 nmdc:mga08x19_15709_c1_2469_3821 430
331 3300050515 nmdc:mga0a205_9448_c1 nmdc:mga0a205_9448_c1_6660_8012 430
332 3300005435 Ga0070714_100020772 Ga0070714_1000207724 431
333 3300005435 Ga0070714_100091409 Ga0070714_1000914092 431
334 3300005439 Ga0070711_100021793 Ga0070711_1000217932 431
335 3300005546 Ga0070696_100000392 Ga0070696_10000039215 431
336 3300005615 Ga0070702_100036127 Ga0070702_1000361272 431
337 3300025928 Ga0207700_10101039 Ga0207700_101010392 431
338 3300025929 Ga0207664_10027443 Ga0207664_100274434 431
339 3300026075 Ga0207708_10140064 Ga0207708_101400642 431
340 3300034817 Ga0373948_0001938 Ga0373948_0001938_141_1499 431
341 3300035084 Ga0373928_0002412 Ga0373928_0002412_1778_3136 431
342 3300035088 Ga0373940_0000559 Ga0373940_0000559_2900_4258 431
343 3300035114 Ga0373939_0002762 Ga0373939_0002762_1110_2468 431
344 3300035242 Ga0373962_0009194 Ga0373962_0009194_674_2032 431
345 3300035691 Ga0373931_0003641 Ga0373931_0003641_1073_2431 431
346 3300045051 Ga0451576_0032272 Ga0451576_0032272_3111_4469 431
347 3300046454 Ga0495592_0000656 Ga0495592_0000656_5168_6541 431
348 3300046476 Ga0495662_0006979 Ga0495662_0006979_968_2341 431
349 3300046511 Ga0495608_0002698 Ga0495608_0002698_9197_10570 431
350 3300046516 Ga0495628_0027333 Ga0495628_0027333_2902_4275 431
351 3300046517 Ga0495630_0008098 Ga0495630_0008098_279_1652 431
352 3300046533 Ga0495640_0003691 Ga0495640_0003691_10091_11464 431
353 3300046535 Ga0495586_0003235 Ga0495586_0003235_2436_3809 431
354 3300046536 Ga0495587_0033246 Ga0495587_0033246_1076_2449 431
355 3300046543 Ga0495645_0046901 Ga0495645_0046901_164_1537 431
356 3300046559 Ga0495667_0039319 Ga0495667_0039319_934_2307 431
357 3300046642 Ga0495634_0015543 Ga0495634_0015543_2093_3466 431
358 3300046663 Ga0495635_0081089 Ga0495635_0081089_295_1668 431
359 3300046678 Ga0495599_0004947 Ga0495599_0004947_1938_3311 431
360 3300046683 Ga0495658_0018241 Ga0495658_0018241_838_2211 431
361 3300046689 Ga0495613_0026267 Ga0495613_0026267_2903_4276 431
362 3300047317 Ga0495604_0026863 Ga0495604_0026863_1746_3119 431
363 3300047318 Ga0495636_0010874 Ga0495636_0010874_706_2085 431
364 3300047322 Ga0495680_0002481 Ga0495680_0002481_14890_16263 431
365 3300047673 Ga0495593_0046786 Ga0495593_0046786_222_1595 431
366 3300005617 Ga0068859_100034196 Ga0068859_1000341962 433
367 3300006931 Ga0097620_100034197 Ga0097620_1000341975 433
368 3300035398 Ga0316574_0023616 Ga0316574_0023616_517_1905 433
369 3300009147 Ga0114129_10028984 Ga0114129_100289845 434
370 3300031730 Ga0307516_10074905 Ga0307516_100749053 434
371 3300050507 nmdc:mga05p37_12883_c1 nmdc:mga05p37_12883_c1_3855_5243 434
372 3300035398 Ga0316574_0005025 Ga0316574_0005025_3514_4902 435
373 3300046462 Ga0495651_0104114 Ga0495651_0104114_684_2075 435
374 3300044712 Ga0453684_0262442 Ga0453684_0262442_476_1891 436
375 3300005616 Ga0068852_100018925 Ga0068852_1000189254 437
376 3300005618 Ga0068864_100098390 Ga0068864_1000983902 437
377 3300048920 Ga0496117_0000108 Ga0496117_0000108_74193_75602 438
378 3300005539 Ga0068853_100156727 Ga0068853_1001567272 439
379 3300009093 Ga0105240_10164319 Ga0105240_101643192 439
380 3300009545 Ga0105237_10013282 Ga0105237_100132823 439
381 3300009551 Ga0105238_10001167 Ga0105238_1000116710 439
382 3300010375 Ga0105239_10025373 Ga0105239_100253733 439
383 3300013105 Ga0157369_10000027 Ga0157369_10000027133 439
384 3300025911 Ga0207654_10068813 Ga0207654_100688131 439
385 3300025913 Ga0207695_10003459 Ga0207695_1000345911 439
386 3300025914 Ga0207671_10000870 Ga0207671_1000087014 439
387 3300025924 Ga0207694_10000733 Ga0207694_1000073312 439
388 3300005344 Ga0070661_100107019 Ga0070661_1001070192 440
389 3300005539 Ga0068853_100016632 Ga0068853_1000166323 440
390 3300005563 Ga0068855_100030133 Ga0068855_1000301332 440
391 3300005614 Ga0068856_100191927 Ga0068856_1001919272 440
392 3300009545 Ga0105237_10019747 Ga0105237_100197475 440
393 3300009551 Ga0105238_10006217 Ga0105238_100062174 440
394 3300013105 Ga0157369_10001075 Ga0157369_1000107518 440
395 3300013307 Ga0157372_10000662 Ga0157372_1000066226 440
396 3300025913 Ga0207695_10000094 Ga0207695_1000009489 440
397 3300025914 Ga0207671_10029456 Ga0207671_100294564 440
398 3300025920 Ga0207649_10002267 Ga0207649_1000226711 440
399 3300026041 Ga0207639_10005207 Ga0207639_100052079 440
400 3300014326 Ga0157380_10010235 Ga0157380_100102353 441
401 3300005293 Ga0065715_10098672 Ga0065715_100986723 442
402 3300005295 Ga0065707_10155562 Ga0065707_101555621 442
403 3300005334 Ga0068869_100077913 Ga0068869_1000779132 442
404 3300005340 Ga0070689_100032645 Ga0070689_1000326454 442
405 3300005344 Ga0070661_100008376 Ga0070661_1000083767 442
406 3300005355 Ga0070671_100205013 Ga0070671_1002050132 442
407 3300005356 Ga0070674_100041348 Ga0070674_1000413482 442
408 3300005364 Ga0070673_100001486 Ga0070673_1000014867 442
409 3300005365 Ga0070688_100003937 Ga0070688_1000039377 442
410 3300005440 Ga0070705_100019239 Ga0070705_1000192392 442
411 3300005457 Ga0070662_100001964 Ga0070662_1000019648 442
412 3300005458 Ga0070681_10042696 Ga0070681_100426962 442
413 3300005466 Ga0070685_10087084 Ga0070685_100870841 442
414 3300005535 Ga0070684_100010615 Ga0070684_1000106156 442
415 3300005543 Ga0070672_100013257 Ga0070672_1000132575 442
416 3300005544 Ga0070686_100001796 Ga0070686_1000017964 442
417 3300005564 Ga0070664_100006476 Ga0070664_1000064767 442
418 3300005615 Ga0070702_100045490 Ga0070702_1000454902 442
419 3300005617 Ga0068859_100019099 Ga0068859_1000190992 442
420 3300005719 Ga0068861_100003787 Ga0068861_1000037877 442
421 3300005719 Ga0068861_100022685 Ga0068861_1000226852 442
422 3300005840 Ga0068870_10003836 Ga0068870_100038362 442
423 3300005841 Ga0068863_100013995 Ga0068863_1000139957 442
424 3300005844 Ga0068862_100001495 Ga0068862_10000149514 442
425 3300005844 Ga0068862_100042302 Ga0068862_1000423022 442
426 3300006844 Ga0075428_100009779 Ga0075428_1000097794 442
427 3300006844 Ga0075428_100111284 Ga0075428_1001112842 442
428 3300006846 Ga0075430_100006176 Ga0075430_1000061767 442
429 3300006846 Ga0075430_100049441 Ga0075430_1000494414 442
430 3300006847 Ga0075431_100000374 Ga0075431_10000037410 442
431 3300006847 Ga0075431_100032494 Ga0075431_1000324942 442
432 3300006847 Ga0075431_100076507 Ga0075431_1000765071 442
433 3300006880 Ga0075429_100002247 Ga0075429_1000022474 442
434 3300006880 Ga0075429_100006783 Ga0075429_1000067836 442
435 3300006881 Ga0068865_100090835 Ga0068865_1000908352 442
436 3300006931 Ga0097620_100019100 Ga0097620_1000191002 442
437 3300009094 Ga0111539_10009546 Ga0111539_100095464 442
438 3300009147 Ga0114129_10018142 Ga0114129_100181426 442
439 3300009177 Ga0105248_10001365 Ga0105248_100013656 442
440 3300009545 Ga0105237_10078248 Ga0105237_100782482 442
441 3300009553 Ga0105249_10016277 Ga0105249_100162775 442
442 3300010375 Ga0105239_10012223 Ga0105239_100122233 442
443 3300013297 Ga0157378_10150433 Ga0157378_101504332 442
444 3300014325 Ga0163163_10001624 Ga0163163_100016247 442
445 3300014745 Ga0157377_10001418 Ga0157377_100014187 442
446 3300025912 Ga0207707_10052405 Ga0207707_100524052 442
447 3300025920 Ga0207649_10169938 Ga0207649_101699381 442
448 3300025925 Ga0207650_10050493 Ga0207650_100504932 442
449 3300025931 Ga0207644_10060048 Ga0207644_100600482 442
450 3300025933 Ga0207706_10006467 Ga0207706_100064674 442
451 3300025936 Ga0207670_10005633 Ga0207670_100056336 442
452 3300025938 Ga0207704_10022349 Ga0207704_100223493 442
453 3300025938 Ga0207704_10126093 Ga0207704_101260932 442
454 3300025942 Ga0207689_10008435 Ga0207689_100084352 442
455 3300025945 Ga0207679_10007012 Ga0207679_100070125 442
456 3300025960 Ga0207651_10002395 Ga0207651_100023957 442
457 3300025972 Ga0207668_10103504 Ga0207668_101035042 442
458 3300026075 Ga0207708_10050243 Ga0207708_100502432 442
459 3300026089 Ga0207648_10015021 Ga0207648_100150217 442
460 3300026118 Ga0207675_100039099 Ga0207675_1000390993 442
461 3300027907 Ga0207428_10005769 Ga0207428_100057692 442
462 3300028379 Ga0268266_10011560 Ga0268266_100115605 442
463 3300028380 Ga0268265_10001090 Ga0268265_100010907 442
464 3300028380 Ga0268265_10007957 Ga0268265_100079572 442
465 3300031344 Ga0265316_10003412 Ga0265316_1000341215 442
466 3300031507 Ga0307509_10000455 Ga0307509_1000045551 442
467 3300031711 Ga0265314_10009958 Ga0265314_100099584 442
468 3300031727 Ga0316576_10005095 Ga0316576_100050953 442
469 3300031728 Ga0316578_10006368 Ga0316578_100063684 442
470 3300031911 Ga0307412_10116550 Ga0307412_101165502 442
471 3300032002 Ga0307416_100040075 Ga0307416_1000400752 442
472 3300032002 Ga0307416_100068623 Ga0307416_1000686232 442
473 3300032005 Ga0307411_10108348 Ga0307411_101083481 442
474 3300036712 Ga0316584_0004423 Ga0316584_0004423_7304_8710 442
475 3300045051 Ga0451576_0311961 Ga0451576_0311961_159_1544 442
476 3300047472 Ga0495686_0036227 Ga0495686_0036227_1692_3077 442
477 3300050507 nmdc:mga05p37_751_c1 nmdc:mga05p37_751_c1_13535_14920 442
478 3300050508 nmdc:mga09592_20132_c1 nmdc:mga09592_20132_c1_1596_2981 442
479 3300050508 nmdc:mga09592_2163_c1 nmdc:mga09592_2163_c1_10924_12309 442
480 3300050509 nmdc:mga0qj67_1265_c1 nmdc:mga0qj67_1265_c1_3109_4494 442
481 3300050510 nmdc:mga06r32_36183_c1 nmdc:mga06r32_36183_c1_2401_3786 442
482 3300050510 nmdc:mga06r32_5547_c1 nmdc:mga06r32_5547_c1_3227_4612 442
483 3300050510 nmdc:mga06r32_682_c1 nmdc:mga06r32_682_c1_17973_19358 442
484 3300050511 nmdc:mga08y16_17066_c1 nmdc:mga08y16_17066_c1_5646_7031 442
485 3300053178 Ga0500637_0016589 Ga0500637_0016589_2333_3718 442
486 3300003320 rootH2_10072900 rootH2_100729003 443
487 3300003323 rootH1_10006213 rootH1_1000621317 443
488 3300003323 rootH1_10012258 rootH1_1001225821 443
489 3300005295 Ga0065707_10000479 Ga0065707_100004797 443
490 3300005335 Ga0070666_10003471 Ga0070666_1000347110 443
491 3300005530 Ga0070679_100018677 Ga0070679_1000186774 443
492 3300005616 Ga0068852_100001074 Ga0068852_1000010744 443
493 3300005841 Ga0068863_100000945 Ga0068863_10000094531 443
494 3300009092 Ga0105250_10000036 Ga0105250_100000362 443
495 3300009551 Ga0105238_10014238 Ga0105238_100142382 443
496 3300013308 Ga0157375_10366856 Ga0157375_103668562 443
497 3300014325 Ga0163163_10000117 Ga0163163_100001179 443
498 3300014325 Ga0163163_10000796 Ga0163163_1000079621 443
499 3300014968 Ga0157379_10002463 Ga0157379_1000246310 443
500 3300014968 Ga0157379_10018237 Ga0157379_100182372 443
501 3300025711 Ga0207696_1001712 Ga0207696_10017122 443
502 3300025921 Ga0207652_10029999 Ga0207652_100299992 443
503 3300025924 Ga0207694_10041668 Ga0207694_100416682 443
504 3300025931 Ga0207644_10187942 Ga0207644_101879422 443
505 3300026035 Ga0207703_10248058 Ga0207703_102480581 443
506 3300026095 Ga0207676_10018749 Ga0207676_100187494 443
507 3300026142 Ga0207698_10001110 Ga0207698_100011104 443
508 3300031251 Ga0265327_10003280 Ga0265327_100032803 443
509 3300031548 Ga0307408_100001669 Ga0307408_1000016692 443
510 3300031548 Ga0307408_100090295 Ga0307408_1000902952 443
511 3300031616 Ga0307508_10136020 Ga0307508_101360202 443
512 3300031665 Ga0316575_10031370 Ga0316575_100313702 443
513 3300031727 Ga0316576_10009785 Ga0316576_100097852 443
514 3300031728 Ga0316578_10007974 Ga0316578_100079742 443
515 3300031901 Ga0307406_10001966 Ga0307406_100019662 443
516 3300031903 Ga0307407_10098414 Ga0307407_100984142 443
517 3300039110 Ga0400487_38243 Ga0400487_38243_38840_40228 443
518 3300039110 Ga0400487_50178 Ga0400487_50178_1491_2879 443
519 3300041491 Ga0451833_1404377 Ga0451833_1404377_259_1647 443
520 3300048905 Ga0496102_0093734 Ga0496102_0093734_803_2197 443
521 3300048906 Ga0496103_0021637 Ga0496103_0021637_1561_2955 443
522 3300049758 Ga0501241_006518 Ga0501241_006518_578_1975 443
523 3300053146 Ga0500588_0002957 Ga0500588_0002957_1072_2460 443
524 iso_pu_bacteria 2738541276 2738715070 443
525 3300013297 Ga0157378_10000016 Ga0157378_1000001658 444
526 3300031665 Ga0316575_10030846 Ga0316575_100308462 444
527 3300031727 Ga0316576_10007291 Ga0316576_100072912 444
528 3300031728 Ga0316578_10002338 Ga0316578_100023388 444
529 3300032139 Ga0316580_10003666 Ga0316580_100036664 444
530 3300036647 Ga0316582_0066102 Ga0316582_0066102_204_1604 444
531 3300038725 Ga0400484_36483 Ga0400484_36483_228_1619 444
532 3300038726 Ga0400490_20921 Ga0400490_20921_3752_5143 444
533 3300038735 Ga0400485_13101 Ga0400485_13101_17453_18844 444
534 3300038742 Ga0400486_01752 Ga0400486_01752_1256_2647 444
535 3300039062 Ga0400483_084870 Ga0400483_084870_6521_7912 444
536 3300039062 Ga0400483_159554 Ga0400483_159554_491_1915 444
537 3300039062 Ga0400483_258475 Ga0400483_258475_3047_4438 444
538 3300039110 Ga0400487_49882 Ga0400487_49882_89_1480 444
539 3300047322 Ga0495680_0065975 Ga0495680_0065975_863_2269 444
540 3300049571 Ga0501034_0046831 Ga0501034_0046831_1091_2488 444
541 3300049579 Ga0501043_0021471 Ga0501043_0021471_784_2181 444
542 3300049580 Ga0501046_0016337 Ga0501046_0016337_1877_3274 444
543 3300049581 Ga0501047_0009204 Ga0501047_0009204_4634_6031 444
544 3300049581 Ga0501047_0020198 Ga0501047_0020198_580_1977 444
545 3300049586 Ga0501070_0029805 Ga0501070_0029805_167_1564 444
546 3300049589 Ga0501073_0155223 Ga0501073_0155223_136_1533 444
547 3300049590 Ga0501074_0020073 Ga0501074_0020073_173_1570 444
548 3300049742 Ga0501080_0001158 Ga0501080_0001158_10250_11647 444
549 3300049742 Ga0501080_0225828 Ga0501080_0225828_205_1602 444
550 3300049823 Ga0501044_0066659 Ga0501044_0066659_2097_3494 444
551 3300060353 Ga0501082_0070959 Ga0501082_0070959_609_2006 444
552 iso_pu_bacteria 2739367700 2739731419 445
553 3300005466 Ga0070685_10007098 Ga0070685_100070983 446
554 3300009093 Ga0105240_10001034 Ga0105240_1000103412 446
555 3300010375 Ga0105239_10336360 Ga0105239_103363601 446
556 3300025913 Ga0207695_10000007 Ga0207695_10000007470 446
557 3300025924 Ga0207694_10144034 Ga0207694_101440342 446
558 3300035398 Ga0316574_0053472 Ga0316574_0053472_263_1660 446
559 iso_pu_bacteria 2537561836 2538834483 446
560 iso_pu_bacteria 2643221562 2643830011 446
561 iso_pu_bacteria 2643221577 2643894584 446
562 iso_pu_bacteria 2643221685 2644476739 446
563 iso_pu_bacteria 2939611941 2939612054 446
564 3300005577 Ga0068857_100142325 Ga0068857_1001423252 447
565 3300010375 Ga0105239_10011975 Ga0105239_100119753 447
566 3300026116 Ga0207674_10164413 Ga0207674_101644132 447
567 3300013296 Ga0157374_10014468 Ga0157374_100144686 448
568 3300025261 Ga0209233_1002561 Ga0209233_10025613 448
569 3300026023 Ga0207677_10079380 Ga0207677_100793802 448
570 3300028379 Ga0268266_10192885 Ga0268266_101928852 448
571 3300031665 Ga0316575_10001433 Ga0316575_100014335 448
572 3300031691 Ga0316579_10001295 Ga0316579_100012951 448
573 3300031728 Ga0316578_10023749 Ga0316578_100237492 448
574 3300032137 Ga0316585_10000238 Ga0316585_100002389 448
575 3300032139 Ga0316580_10002362 Ga0316580_100023622 448
576 3300036647 Ga0316582_0023726 Ga0316582_0023726_2043_3449 448
577 3300046460 Ga0495638_0000069 Ga0495638_0000069_71111_72508 448
578 3300048918 Ga0496115_0000113 Ga0496115_0000113_53898_55292 448
579 3300048929 Ga0496126_0000226 Ga0496126_0000226_90544_91938 448
580 3300049569 Ga0501032_0032566 Ga0501032_0032566_453_1850 448
581 3300049571 Ga0501034_0020678 Ga0501034_0020678_5165_6562 448
582 3300049572 Ga0501036_0060923 Ga0501036_0060923_502_1899 448
583 3300049573 Ga0501037_0069825 Ga0501037_0069825_1142_2539 448
584 3300049579 Ga0501043_0014067 Ga0501043_0014067_3478_4875 448
585 3300049584 Ga0501068_0002805 Ga0501068_0002805_2958_4355 448
586 3300049585 Ga0501069_0009513 Ga0501069_0009513_1350_2747 448
587 3300049586 Ga0501070_0073191 Ga0501070_0073191_522_1919 448
588 3300049588 Ga0501072_0009355 Ga0501072_0009355_2260_3657 448
589 3300049590 Ga0501074_0003355 Ga0501074_0003355_8406_9803 448
590 3300049744 Ga0501083_0005792 Ga0501083_0005792_1593_2990 448
591 3300049822 Ga0501035_0075939 Ga0501035_0075939_1395_2792 448
592 3300049823 Ga0501044_0027394 Ga0501044_0027394_2619_4016 448
593 3300054114 Ga0501084_0028024 Ga0501084_0028024_825_2222 448
594 3300002067 JGI24735J21928_10000384 JGI24735J21928_100003848 449
595 3300005364 Ga0070673_100144925 Ga0070673_1001449252 449
596 3300005367 Ga0070667_100000090 Ga0070667_10000009023 449
597 3300005539 Ga0068853_100029306 Ga0068853_1000293064 449
598 3300005543 Ga0070672_100024344 Ga0070672_1000243443 449
599 3300005563 Ga0068855_100129020 Ga0068855_1001290202 449
600 3300005614 Ga0068856_100222297 Ga0068856_1002222972 449
601 3300005841 Ga0068863_100052569 Ga0068863_1000525693 449
602 3300006237 Ga0097621_100002704 Ga0097621_10000270410 449
603 3300009177 Ga0105248_10022243 Ga0105248_100222437 449
604 3300009545 Ga0105237_10000345 Ga0105237_1000034512 449
605 3300009553 Ga0105249_10002096 Ga0105249_100020964 449
606 3300013306 Ga0163162_10013240 Ga0163162_100132409 449
607 3300013307 Ga0157372_10026717 Ga0157372_100267176 449
608 3300013308 Ga0157375_10004020 Ga0157375_1000402012 449
609 3300014325 Ga0163163_10266894 Ga0163163_102668942 449
610 3300014969 Ga0157376_10014239 Ga0157376_100142394 449
611 3300014969 Ga0157376_10071820 Ga0157376_100718202 449
612 3300025904 Ga0207647_10010135 Ga0207647_100101356 449
613 3300025940 Ga0207691_10002785 Ga0207691_100027856 449
614 3300025949 Ga0207667_10137158 Ga0207667_101371582 449
615 3300025960 Ga0207651_10081931 Ga0207651_100819312 449
616 3300025961 Ga0207712_10004411 Ga0207712_100044114 449
617 3300025961 Ga0207712_10129932 Ga0207712_101299322 449
618 3300025986 Ga0207658_10000111 Ga0207658_1000011137 449
619 3300026089 Ga0207648_10015986 Ga0207648_100159864 449
620 3300037418 Ga0395900_0002023 Ga0395900_0002023_7343_8743 449
621 3300041494 Ga0451837_0349640 Ga0451837_0349640_140_1540 449
622 3300044656 Ga0466969_0000478 Ga0466969_0000478_14632_16029 449
623 3300044684 Ga0466966_0019315 Ga0466966_0019315_2797_4194 449
624 3300045049 Ga0466959_0038358 Ga0466959_0038358_957_2354 449
625 3300047472 Ga0495686_0006564 Ga0495686_0006564_4768_6171 449
626 3300048918 Ga0496115_0000040 Ga0496115_0000040_29149_30549 449
627 3300048924 Ga0496121_0060801 Ga0496121_0060801_750_2153 449
628 3300048925 Ga0496122_0000129 Ga0496122_0000129_40915_42318 449
629 3300048926 Ga0496123_0000113 Ga0496123_0000113_161810_163213 449
630 3300049822 Ga0501035_0122745 Ga0501035_0122745_590_1990 449
631 3300049823 Ga0501044_0080146 Ga0501044_0080146_468_1868 449
632 3300053087 Ga0500643_007178 Ga0500643_007178_2549_3952 449
633 3300053093 Ga0500651_0000070 Ga0500651_0000070_22913_24337 449
634 3300053120 Ga0500597_000277 Ga0500597_000277_4630_6033 449
635 3300002737 JGI25162J39368_1002209 JGI25162J39368_10022093 450
636 3300002737 JGI25162J39368_1002625 JGI25162J39368_10026252 450
637 3300002741 JGI25157J39369_1000653 JGI25157J39369_100065314 450
638 3300003214 JGI25165J46597_1002505 JGI25165J46597_10025056 450
639 3300005331 Ga0070670_100003218 Ga0070670_10000321811 450
640 3300005335 Ga0070666_10000763 Ga0070666_1000076313 450
641 3300005336 Ga0070680_100039071 Ga0070680_1000390714 450
642 3300005337 Ga0070682_100001534 Ga0070682_1000015345 450
643 3300005339 Ga0070660_100043099 Ga0070660_1000430993 450
644 3300005339 Ga0070660_100138456 Ga0070660_1001384561 450
645 3300005345 Ga0070692_10041774 Ga0070692_100417742 450
646 3300005366 Ga0070659_100022398 Ga0070659_1000223984 450
647 3300005435 Ga0070714_100000068 Ga0070714_10000006851 450
648 3300005457 Ga0070662_100019012 Ga0070662_1000190123 450
649 3300005458 Ga0070681_10076625 Ga0070681_100766252 450
650 3300005530 Ga0070679_100046853 Ga0070679_1000468533 450
651 3300005539 Ga0068853_100002360 Ga0068853_1000023608 450
652 3300005539 Ga0068853_100037242 Ga0068853_1000372422 450
653 3300005539 Ga0068853_100073602 Ga0068853_1000736022 450
654 3300005548 Ga0070665_100001823 Ga0070665_10000182312 450
655 3300005563 Ga0068855_100007320 Ga0068855_1000073206 450
656 3300005563 Ga0068855_100018068 Ga0068855_1000180689 450
657 3300005577 Ga0068857_100045342 Ga0068857_1000453423 450
658 3300005842 Ga0068858_100007811 Ga0068858_1000078119 450
659 3300006881 Ga0068865_100072545 Ga0068865_1000725451 450
660 3300009551 Ga0105238_10002155 Ga0105238_1000215515 450
661 3300009551 Ga0105238_10012095 Ga0105238_100120954 450
662 3300009551 Ga0105238_10119898 Ga0105238_101198982 450
663 3300009553 Ga0105249_10013387 Ga0105249_100133875 450
664 3300010375 Ga0105239_10092959 Ga0105239_100929592 450
665 3300013100 Ga0157373_10006832 Ga0157373_100068326 450
666 3300013102 Ga0157371_10011744 Ga0157371_100117442 450
667 3300013104 Ga0157370_10005696 Ga0157370_1000569610 450
668 3300013104 Ga0157370_10006493 Ga0157370_100064939 450
669 3300013104 Ga0157370_10017218 Ga0157370_100172184 450
670 3300013306 Ga0163162_10000107 Ga0163162_1000010736 450
671 3300013307 Ga0157372_10005146 Ga0157372_100051469 450
672 3300013307 Ga0157372_10097654 Ga0157372_100976542 450
673 3300014969 Ga0157376_10148990 Ga0157376_101489902 450
674 3300025903 Ga0207680_10006404 Ga0207680_100064045 450
675 3300025904 Ga0207647_10000440 Ga0207647_1000044020 450
676 3300025904 Ga0207647_10005409 Ga0207647_100054099 450
677 3300025909 Ga0207705_10041241 Ga0207705_100412412 450
678 3300025912 Ga0207707_10010940 Ga0207707_100109409 450
679 3300025913 Ga0207695_10004403 Ga0207695_100044033 450
680 3300025913 Ga0207695_10006570 Ga0207695_100065702 450
681 3300025913 Ga0207695_10044722 Ga0207695_100447222 450
682 3300025919 Ga0207657_10009593 Ga0207657_100095936 450
683 3300025921 Ga0207652_10054362 Ga0207652_100543622 450
684 3300025924 Ga0207694_10003366 Ga0207694_100033668 450
685 3300025924 Ga0207694_10035694 Ga0207694_100356943 450
686 3300025925 Ga0207650_10038845 Ga0207650_100388452 450
687 3300025929 Ga0207664_10000056 Ga0207664_1000005662 450
688 3300025932 Ga0207690_10001271 Ga0207690_1000127111 450
689 3300025932 Ga0207690_10010257 Ga0207690_100102572 450
690 3300025932 Ga0207690_10013552 Ga0207690_100135522 450
691 3300025932 Ga0207690_10034784 Ga0207690_100347843 450
692 3300025933 Ga0207706_10055575 Ga0207706_100555752 450
693 3300025949 Ga0207667_10008959 Ga0207667_100089595 450
694 3300025949 Ga0207667_10131369 Ga0207667_101313692 450
695 3300025961 Ga0207712_10002072 Ga0207712_100020729 450
696 3300025981 Ga0207640_10015463 Ga0207640_100154633 450
697 3300025986 Ga0207658_10022299 Ga0207658_100222992 450
698 3300026035 Ga0207703_10009557 Ga0207703_100095577 450
699 3300026041 Ga0207639_10000129 Ga0207639_100001293 450
700 3300026067 Ga0207678_10000802 Ga0207678_1000080218 450
701 3300026078 Ga0207702_10109363 Ga0207702_101093633 450
702 3300026116 Ga0207674_10020189 Ga0207674_100201896 450
703 3300026116 Ga0207674_10105915 Ga0207674_101059152 450
704 3300026142 Ga0207698_10016726 Ga0207698_100167264 450
705 3300028379 Ga0268266_10000006 Ga0268266_10000006421 450
706 3300038443 Ga0395901_0001656 Ga0395901_0001656_1108_2511 450
707 3300042012 Ga0439455_0000953 Ga0439455_0000953_1649_3052 450
708 3300001915 JGI24741J21665_1001335 JGI24741J21665_10013356 451
709 3300005336 Ga0070680_100005660 Ga0070680_1000056609 451
710 3300005458 Ga0070681_10001087 Ga0070681_1000108721 451
711 3300005530 Ga0070679_100001221 Ga0070679_1000012212 451
712 3300025912 Ga0207707_10001306 Ga0207707_1000130621 451
713 3300025917 Ga0207660_10001321 Ga0207660_1000132116 451
714 3300025921 Ga0207652_10001132 Ga0207652_100011324 451
715 3300026078 Ga0207702_10051973 Ga0207702_100519731 451

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14714

KH_dom-like

KH-domain-like of EngA bacterial GTPase enzymes, C-terminal

394

473

0.97

PF01926

MMR_HSR1

50S ribosome-binding GTPase

219

337

0.93

PF01926

MMR_HSR1

50S ribosome-binding GTPase

42

157

0.9

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

215

389

0.84

PF02421

FeoB_N

Ferrous iron transport protein B

218

383

0.81

PF02421

FeoB_N

Ferrous iron transport protein B

41

196

0.8

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

110

202

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyk-assembly2.cif.gz_B crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 0.8772 2 163
2dyk-assembly2.cif.gz_B crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 0.8717 2 163
5x4b-assembly2.cif.gz_B crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.8649 3 157
5x4b-assembly1.cif.gz_A crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.8398 3 161
1wf3-assembly1.cif.gz_A crystal structure of gtp-binding protein tt1341 from thermus thermophilus hb8 0.8301 4 163
ID Description Score Start End Superfamily
af_P0A6P5_199_372_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.896 177 346 3.40.50.300
2dykB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8772 2 163 3.40.50.300
af_P0A6P5_199_372_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.872 177 346 3.40.50.300
2dykB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8717 2 163 3.40.50.300
3r9xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8689 2 165 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A258SWP5-F1-model_v4 Ribosome biogenesis GTPase Der 0.894 1 137 GO:0005525
GO:0043022
AF-A0A7C1DRL4-F1-model_v4 GTP-binding protein 0.8922 1 158 GO:0005525
GO:0043022
AF-A0A7C1JEJ0-F1-model_v4 GTP-binding protein 0.8794 1 163 GO:0005525
GO:0043022
AF-X1JK79-F1-model_v4 Era-type G domain-containing protein 0.878 3 165 GO:0000028
GO:0005525
GO:0005829
GO:0019843
GO:0043024
AF-A0A847IIU0-F1-model_v4 GTPase Era 0.876 4 165 GO:0000028
GO:0005525
GO:0005829
GO:0019843
GO:0043024

Feature Viewer

pLDDT pTM Quality
78.39 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map