F476993

General Info

Members Datasets Scaffolds Average Seq Length
715 309 1430 198

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10000508|Ga0207640_1000050816
Length 214
Sequence MEPVREISGKAYPFGRKNVDTDVIIPAHWLKTITREGLGKGAFETVRKEPGNVFEDPAYAGAPIIVAGDNFGCGSSREHAAWALLDMGVKAVIAPSYSDIFSGNAFKNGILAVVLPQEAIDRLMEVARTDPIHIDLEAQTVTTPFQDRFPFEIDPFRKHCLLNGLDEVGLTLARGDAIAGYEAKARASLPFLARGVPAAAASERRTKGRTQGRD

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
238 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
239 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
240 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
241 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
244 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
245 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
246 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
264 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
265 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
270 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
271 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
276 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
277 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
282 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
286 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
287 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
292 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
293 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
294 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
295 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
296 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
297 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
298 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
299 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
300 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
301 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
302 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
303 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
304 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
305 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
306 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
307 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
308 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
309 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.42
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.43
Nodule 0.14
Rhizoplane 5.31
Rhizosphere 70.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_10000508 3300025981 Bacteria 23527
2 SwRhRL2b_contig_1292634 2162886007 Bacteria 2441
3 SwRhRL2b_contig_2522198 2162886007 Bacteria 2682
4 SwRhRL2b_contig_2959322 2162886007 Bacteria 1600
5 SwRhRL2b_contig_3703961 2162886007 Bacteria 12985
6 SwRhRL2b_contig_453878 2162886007 Bacteria 5693
7 JGI24736J21556_1000613 3300001904 Bacteria 6542
8 JGI24741J21665_1000366 3300001915 Bacteria 13487
9 JGI24740J21852_10005104 3300001979 Bacteria 5575
10 JGI24739J22299_10005319 3300001989 Bacteria 4903
11 JGI24735J21928_10004932 3300002067 Bacteria 4449
12 JGI24738J21930_10001740 3300002075 Bacteria 5944
13 JGI24751J29686_10025372 3300002459 Bacteria 1230
14 rootH1_10064790 3300003316 Bacteria 3711
15 rootL2_10052919 3300003322 Bacteria 3842
16 Ga0065704_10000451 3300005289 Bacteria 33782
17 Ga0065704_10001612 3300005289 Bacteria 10250
18 Ga0065704_10070364 3300005289 Bacteria 29548
19 Ga0065704_10168680 3300005289 Bacteria 1305
20 Ga0065704_10228265 3300005289 Bacteria 1037
21 Ga0065707_10122578 3300005295 Bacteria 2085
22 Ga0070658_10001814 3300005327 Bacteria 17966
23 Ga0070658_10004690 3300005327 Bacteria 11113
24 Ga0070658_10058237 3300005327 Bacteria 3144
25 Ga0070658_10068992 3300005327 Bacteria 2891
26 Ga0070658_10088083 3300005327 Bacteria 2556
27 Ga0070658_10104461 3300005327 Bacteria 2344
28 Ga0070658_10174659 3300005327 Bacteria 1806
29 Ga0070683_100080914 3300005329 Bacteria 3040
30 Ga0070670_100002377 3300005331 Bacteria 15504
31 Ga0070670_100241386 3300005331 Bacteria 1573
32 Ga0070670_100352254 3300005331 Bacteria 1293
33 Ga0070666_10005044 3300005335 Bacteria 8076
34 Ga0070666_10031513 3300005335 Bacteria 3499
35 Ga0070666_10033483 3300005335 Bacteria 3400
36 Ga0070666_10077356 3300005335 Bacteria 2271
37 Ga0070666_10122419 3300005335 Bacteria 1804
38 Ga0070680_100269627 3300005336 Bacteria 1441
39 Ga0070680_100270503 3300005336 Bacteria 1439
40 Ga0070660_100009577 3300005339 Bacteria 6822
41 Ga0070660_100078162 3300005339 Bacteria 2594
42 Ga0070660_100339548 3300005339 Bacteria 1236
43 Ga0070689_100168652 3300005340 Bacteria 1773
44 Ga0070661_100012214 3300005344 Bacteria 6005
45 Ga0070661_100133526 3300005344 Bacteria 1866
46 Ga0070668_100000026 3300005347 Bacteria 92584
47 Ga0070668_100000047 3300005347 Bacteria 76386
48 Ga0070668_100016413 3300005347 Bacteria 5536
49 Ga0070668_100057586 3300005347 Bacteria 3004
50 Ga0070668_100062353 3300005347 Bacteria 2888
51 Ga0070668_100074324 3300005347 Bacteria 2651
52 Ga0070669_100000270 3300005353 Bacteria 42327
53 Ga0070669_100001263 3300005353 Bacteria 18356
54 Ga0070669_100160432 3300005353 Bacteria 1747
55 Ga0070669_100583648 3300005353 Bacteria 935
56 Ga0070671_100000116 3300005355 Bacteria 51559
57 Ga0070671_100000470 3300005355 Bacteria 28105
58 Ga0070671_100047816 3300005355 Bacteria 3556
59 Ga0070671_100099591 3300005355 Bacteria 2438
60 Ga0070659_100052995 3300005366 Bacteria 3192
61 Ga0070667_100000019 3300005367 Bacteria 224710
62 Ga0070667_100000030 3300005367 Bacteria 178327
63 Ga0070667_100000968 3300005367 Bacteria 26399
64 Ga0070667_100001907 3300005367 Bacteria 18505
65 Ga0070667_100018063 3300005367 Bacteria 5846
66 Ga0070667_100109280 3300005367 Bacteria 2396
67 Ga0070663_100002941 3300005455 Bacteria 9696
68 Ga0070663_100189566 3300005455 Bacteria 1599
69 Ga0070662_100002038 3300005457 Bacteria 12374
70 Ga0070662_100011994 3300005457 Bacteria 5734
71 Ga0070662_100051197 3300005457 Bacteria 2981
72 Ga0070681_10049910 3300005458 Bacteria 4176
73 Ga0070681_11163648 3300005458 Bacteria 693
74 Ga0070679_100011467 3300005530 Bacteria 8446
75 Ga0070679_100053739 3300005530 Bacteria 4009
76 Ga0070679_100165965 3300005530 Bacteria 2181
77 Ga0070679_100352225 3300005530 Bacteria 1420
78 Ga0070684_100098100 3300005535 Bacteria 2614
79 Ga0070684_100438914 3300005535 Bacteria 1206
80 Ga0068853_100001009 3300005539 Bacteria 19829
81 Ga0068853_100099224 3300005539 Bacteria 2573
82 Ga0068853_100387868 3300005539 Bacteria 1305
83 Ga0070665_100001031 3300005548 Bacteria 34955
84 Ga0070665_100015813 3300005548 Bacteria 7578
85 Ga0070665_100020215 3300005548 Bacteria 6685
86 Ga0068855_100000608 3300005563 Bacteria 43919
87 Ga0068855_100007299 3300005563 Bacteria 13385
88 Ga0068855_100011899 3300005563 Bacteria 10520
89 Ga0068855_100022037 3300005563 Bacteria 7637
90 Ga0068855_100026547 3300005563 Bacteria 6929
91 Ga0068855_100058341 3300005563 Bacteria 4521
92 Ga0068855_100058989 3300005563 Bacteria 4492
93 Ga0068855_100218364 3300005563 Bacteria 2139
94 Ga0068855_100234877 3300005563 Bacteria 2051
95 Ga0070664_100004940 3300005564 Bacteria 10682
96 Ga0070664_100260354 3300005564 Bacteria 1561
97 Ga0068857_100042135 3300005577 Bacteria 4049
98 Ga0068857_100124356 3300005577 Bacteria 2324
99 Ga0068857_100152991 3300005577 Bacteria 2091
100 Ga0068857_100389558 3300005577 Bacteria 1295
101 Ga0068857_100510486 3300005577 Bacteria 1129
102 Ga0068857_101027922 3300005577 Bacteria 794
103 Ga0068854_100000459 3300005578 Bacteria 25127
104 Ga0068854_100117457 3300005578 Bacteria 2014
105 Ga0068854_100190734 3300005578 Bacteria 1606
106 Ga0068854_100365742 3300005578 Bacteria 1184
107 Ga0068854_100687749 3300005578 Bacteria 882
108 Ga0068856_100019636 3300005614 Bacteria 6559
109 Ga0068856_100020542 3300005614 Bacteria 6414
110 Ga0068856_100025980 3300005614 Bacteria 5711
111 Ga0068856_100160015 3300005614 Bacteria 2262
112 Ga0068856_100213559 3300005614 Bacteria 1945
113 Ga0068852_100000231 3300005616 Bacteria 37728
114 Ga0068852_100000860 3300005616 Bacteria 20165
115 Ga0068852_100331083 3300005616 Bacteria 1482
116 Ga0068859_100312446 3300005617 Bacteria 1665
117 Ga0068859_100359239 3300005617 Bacteria 1551
118 Ga0068864_100003823 3300005618 Bacteria 12412
119 Ga0068861_100274228 3300005719 Bacteria 1450
120 Ga0068863_100000093 3300005841 Bacteria 96862
121 Ga0068863_100000106 3300005841 Bacteria 90344
122 Ga0068863_100004037 3300005841 Bacteria 14491
123 Ga0068863_100044294 3300005841 Bacteria 4224
124 Ga0068858_100001247 3300005842 Bacteria 26301
125 Ga0068858_100034454 3300005842 Bacteria 4697
126 Ga0068858_100039777 3300005842 Bacteria 4359
127 Ga0068858_100056520 3300005842 Bacteria 3627
128 Ga0068860_100000036 3300005843 Bacteria 234917
129 Ga0068860_100000386 3300005843 Bacteria 57855
130 Ga0068860_100009605 3300005843 Bacteria 9613
131 Ga0068860_100017800 3300005843 Bacteria 6923
132 Ga0068860_100044110 3300005843 Bacteria 4251
133 Ga0068860_100061361 3300005843 Bacteria 3572
134 Ga0068860_100092375 3300005843 Bacteria 2883
135 Ga0068862_100006085 3300005844 Bacteria 10046
136 Ga0068862_100009807 3300005844 Bacteria 7914
137 Ga0068862_100028254 3300005844 Bacteria 4722
138 Ga0068862_100040223 3300005844 Bacteria 3974
139 Ga0068862_100087044 3300005844 Bacteria 2717
140 Ga0068862_100970178 3300005844 Bacteria 839
141 Ga0081455_10000255 3300005937 Bacteria 69927
142 Ga0075368_10000112 3300006042 Bacteria 21160
143 Ga0075363_100005439 3300006048 Bacteria 5665
144 Ga0075363_100012861 3300006048 Bacteria 4042
145 Ga0075364_10014899 3300006051 Bacteria 4812
146 Ga0075364_10033952 3300006051 Bacteria 3288
147 Ga0075432_10006371 3300006058 Bacteria 4014
148 Ga0075362_10000003 3300006177 Bacteria 171099
149 Ga0075362_10000129 3300006177 Bacteria 20881
150 Ga0075362_10265687 3300006177 Bacteria 846
151 Ga0075367_10010792 3300006178 Bacteria 4812
152 Ga0075369_10005083 3300006186 Bacteria 4906
153 Ga0075369_10019731 3300006186 Bacteria 2755
154 Ga0075366_10000006 3300006195 Bacteria 106522
155 Ga0075366_10009002 3300006195 Bacteria 5569
156 Ga0075366_10039961 3300006195 Bacteria 2773
157 Ga0075366_10197964 3300006195 Bacteria 1221
158 Ga0075366_10247315 3300006195 Bacteria 1088
159 Ga0075366_10295921 3300006195 Bacteria 990
160 Ga0075366_10308350 3300006195 Bacteria 969
161 Ga0075370_10000008 3300006353 Bacteria 97966
162 Ga0075370_10010420 3300006353 Bacteria 4861
163 Ga0075370_10035362 3300006353 Bacteria 2804
164 Ga0075370_10084534 3300006353 Bacteria 1826
165 Ga0075370_10098533 3300006353 Bacteria 1690
166 Ga0068871_100589168 3300006358 Bacteria 1010
167 Ga0075436_100376067 3300006914 Bacteria 1027
168 Ga0097620_100312443 3300006931 Bacteria 1665
169 Ga0097620_100359245 3300006931 Bacteria 1551
170 Ga0105251_10000231 3300009011 Bacteria 56229
171 Ga0105251_10016214 3300009011 Bacteria 4036
172 Ga0105251_10049746 3300009011 Bacteria 2005
173 Ga0105240_10012161 3300009093 Bacteria 11916
174 Ga0105240_10012850 3300009093 Bacteria 11536
175 Ga0105240_10630314 3300009093 Bacteria 1177
176 Ga0105240_11253654 3300009093 Bacteria 783
177 Ga0105240_11360643 3300009093 Bacteria 747
178 Ga0111539_10609168 3300009094 Bacteria 1272
179 Ga0105247_10075248 3300009101 Bacteria 2118
180 Ga0105247_10102854 3300009101 Bacteria 1828
181 Ga0105247_10128849 3300009101 Bacteria 1647
182 Ga0114129_11521487 3300009147 Bacteria 822
183 Ga0105243_10449731 3300009148 Bacteria 1208
184 Ga0105241_10038453 3300009174 Bacteria 3607
185 Ga0105241_10084481 3300009174 Bacteria 2492
186 Ga0105248_10013347 3300009177 Bacteria 9041
187 Ga0105248_10106004 3300009177 Bacteria 3169
188 Ga0105248_10158703 3300009177 Bacteria 2552
189 Ga0105248_10206862 3300009177 Bacteria 2211
190 Ga0105248_10255623 3300009177 Bacteria 1972
191 Ga0105248_10608341 3300009177 Bacteria 1233
192 Ga0105248_11472165 3300009177 Bacteria 771
193 Ga0105237_10059493 3300009545 Bacteria 3822
194 Ga0105238_10071650 3300009551 Bacteria 3463
195 Ga0105238_10369475 3300009551 Bacteria 1425
196 Ga0105238_10486038 3300009551 Bacteria 1234
197 Ga0105249_10166648 3300009553 Bacteria 2133
198 Ga0105249_10291555 3300009553 Bacteria 1633
199 Ga0105249_10648172 3300009553 Bacteria 1114
200 Ga0105246_10000657 3300011119 Bacteria 19352
201 Ga0157326_1000423 3300012513 Bacteria 5017
202 Ga0157373_10005891 3300013100 Bacteria 9170
203 Ga0157373_10032124 3300013100 Bacteria 3779
204 Ga0157373_10058315 3300013100 Bacteria 2737
205 Ga0157371_10005585 3300013102 Bacteria 10564
206 Ga0157371_10049399 3300013102 Bacteria 2988
207 Ga0157371_10319288 3300013102 Bacteria 1127
208 Ga0157370_10008601 3300013104 Bacteria 10992
209 Ga0157370_10057965 3300013104 Bacteria 3681
210 Ga0157370_10134122 3300013104 Bacteria 2309
211 Ga0157369_10011267 3300013105 Bacteria 10158
212 Ga0157378_10067728 3300013297 Bacteria 3200
213 Ga0163162_10013864 3300013306 Bacteria 7875
214 Ga0163162_10021491 3300013306 Bacteria 6357
215 Ga0163162_10065959 3300013306 Bacteria 3668
216 Ga0163162_10194674 3300013306 Bacteria 2156
217 Ga0157372_10175214 3300013307 Bacteria 2482
218 Ga0157372_11511544 3300013307 Bacteria 773
219 Ga0157375_10105105 3300013308 Bacteria 2913
220 Ga0157375_10599022 3300013308 Bacteria 1261
221 Ga0163161_10001762 3300017792 Bacteria 15801
222 Ga0213875_10009905 3300021388 Bacteria 4804
223 Ga0209147_103605 3300025229 Bacteria 2915
224 Ga0209050_1000687 3300025298 Bacteria 50814
225 Ga0207696_1005600 3300025711 Bacteria 5186
226 Ga0207713_1000951 3300025735 Bacteria 25905
227 Ga0207682_10097959 3300025893 Bacteria 1279
228 Ga0207680_10061223 3300025903 Bacteria 2295
229 Ga0207680_10062260 3300025903 Bacteria 2279
230 Ga0207680_10093912 3300025903 Bacteria 1914
231 Ga0207680_10151143 3300025903 Bacteria 1548
232 Ga0207680_10198014 3300025903 Bacteria 1367
233 Ga0207647_10019938 3300025904 Bacteria 4502
234 Ga0207647_10041942 3300025904 Bacteria 2874
235 Ga0207647_10058954 3300025904 Bacteria 2350
236 Ga0207647_10191283 3300025904 Bacteria 1186
237 Ga0207647_10445746 3300025904 Bacteria 726
238 Ga0207705_10000004 3300025909 Bacteria 705756
239 Ga0207705_10005310 3300025909 Bacteria 9638
240 Ga0207705_10032428 3300025909 Bacteria 3733
241 Ga0207705_10059755 3300025909 Bacteria 2752
242 Ga0207705_10068657 3300025909 Bacteria 2567
243 Ga0207705_10462588 3300025909 Bacteria 984
244 Ga0207707_10076073 3300025912 Bacteria 2929
245 Ga0207695_10019301 3300025913 Bacteria 7851
246 Ga0207695_10031555 3300025913 Bacteria 5808
247 Ga0207660_10352336 3300025917 Bacteria 1180
248 Ga0207660_10595192 3300025917 Bacteria 901
249 Ga0207657_10000408 3300025919 Bacteria 45400
250 Ga0207657_10048996 3300025919 Bacteria 3685
251 Ga0207657_10054446 3300025919 Bacteria 3460
252 Ga0207657_10241990 3300025919 Bacteria 1440
253 Ga0207649_10024515 3300025920 Bacteria 3507
254 Ga0207649_10115630 3300025920 Bacteria 1800
255 Ga0207649_10549250 3300025920 Bacteria 884
256 Ga0207652_10007853 3300025921 Bacteria 8565
257 Ga0207652_10063222 3300025921 Bacteria 3200
258 Ga0207652_10316211 3300025921 Bacteria 1409
259 Ga0207681_10000049 3300025923 Bacteria 120296
260 Ga0207681_10000774 3300025923 Bacteria 21043
261 Ga0207681_10002968 3300025923 Bacteria 10674
262 Ga0207681_10052128 3300025923 Bacteria 2774
263 Ga0207681_10122960 3300025923 Bacteria 1906
264 Ga0207694_10068861 3300025924 Bacteria 2764
265 Ga0207694_10254042 3300025924 Bacteria 1439
266 Ga0207650_10006404 3300025925 Bacteria 8018
267 Ga0207650_10255242 3300025925 Bacteria 1421
268 Ga0207650_10308447 3300025925 Bacteria 1294
269 Ga0207644_10000067 3300025931 Bacteria 76116
270 Ga0207644_10000191 3300025931 Bacteria 43874
271 Ga0207644_10002323 3300025931 Bacteria 12296
272 Ga0207644_10003057 3300025931 Bacteria 10769
273 Ga0207690_10021761 3300025932 Bacteria 3980
274 Ga0207690_10099368 3300025932 Bacteria 2075
275 Ga0207690_10227135 3300025932 Bacteria 1431
276 Ga0207706_10008254 3300025933 Bacteria 9609
277 Ga0207706_10285577 3300025933 Bacteria 1439
278 Ga0207709_10255433 3300025935 Bacteria 1282
279 Ga0207711_10013496 3300025941 Bacteria 6783
280 Ga0207711_10104536 3300025941 Bacteria 2510
281 Ga0207711_10482985 3300025941 Bacteria 1154
282 Ga0207711_10781261 3300025941 Bacteria 890
283 Ga0207661_10039869 3300025944 Bacteria 3689
284 Ga0207679_10004188 3300025945 Bacteria 8961
285 Ga0207679_10140360 3300025945 Bacteria 1952
286 Ga0207679_10177919 3300025945 Bacteria 1757
287 Ga0207667_10000916 3300025949 Bacteria 37599
288 Ga0207667_10003563 3300025949 Bacteria 19243
289 Ga0207667_10005019 3300025949 Bacteria 16179
290 Ga0207667_10011650 3300025949 Bacteria 10205
291 Ga0207667_10023043 3300025949 Bacteria 6862
292 Ga0207667_10070651 3300025949 Bacteria 3633
293 Ga0207667_10078696 3300025949 Bacteria 3417
294 Ga0207667_10293911 3300025949 Bacteria 1660
295 Ga0207667_10479567 3300025949 Bacteria 1263
296 Ga0207712_10200819 3300025961 Bacteria 1581
297 Ga0207712_10563243 3300025961 Bacteria 981
298 Ga0207712_10679367 3300025961 Bacteria 897
299 Ga0207668_10000066 3300025972 Bacteria 84452
300 Ga0207668_10000081 3300025972 Bacteria 72145
301 Ga0207668_10003398 3300025972 Bacteria 9332
302 Ga0207668_10011848 3300025972 Bacteria 5315
303 Ga0207640_10077559 3300025981 Bacteria 2259
304 Ga0207640_10216524 3300025981 Bacteria 1463
305 Ga0207640_10366525 3300025981 Bacteria 1163
306 Ga0207640_10462303 3300025981 Bacteria 1048
307 Ga0207640_10863151 3300025981 Bacteria 788
308 Ga0207658_10000002 3300025986 Bacteria 1364188
309 Ga0207658_10000019 3300025986 Bacteria 206335
310 Ga0207658_10000344 3300025986 Bacteria 46055
311 Ga0207658_10007159 3300025986 Bacteria 7602
312 Ga0207658_10012173 3300025986 Bacteria 5868
313 Ga0207658_10265642 3300025986 Bacteria 1464
314 Ga0207703_10004946 3300026035 Bacteria 10819
315 Ga0207703_10005351 3300026035 Bacteria 10337
316 Ga0207703_10029046 3300026035 Bacteria 4362
317 Ga0207703_10052344 3300026035 Bacteria 3315
318 Ga0207639_10000213 3300026041 Bacteria 43227
319 Ga0207639_10228780 3300026041 Bacteria 1610
320 Ga0207639_10396697 3300026041 Bacteria 1242
321 Ga0207639_10900539 3300026041 Bacteria 827
322 Ga0207678_10000857 3300026067 Bacteria 27922
323 Ga0207678_10029324 3300026067 Bacteria 4802
324 Ga0207678_10046385 3300026067 Bacteria 3757
325 Ga0207702_10019109 3300026078 Bacteria 5670
326 Ga0207702_10114050 3300026078 Bacteria 2408
327 Ga0207702_10136446 3300026078 Bacteria 2214
328 Ga0207702_10147935 3300026078 Bacteria 2134
329 Ga0207702_10162965 3300026078 Bacteria 2038
330 Ga0207702_11128766 3300026078 Bacteria 778
331 Ga0207702_11480326 3300026078 Bacteria 672
332 Ga0207641_10000029 3300026088 Bacteria 229383
333 Ga0207641_10000733 3300026088 Bacteria 35188
334 Ga0207641_10004505 3300026088 Bacteria 12048
335 Ga0207641_10014797 3300026088 Bacteria 6396
336 Ga0207641_10046323 3300026088 Bacteria 3665
337 Ga0207641_10066769 3300026088 Bacteria 3079
338 Ga0207676_10002656 3300026095 Bacteria 12704
339 Ga0207674_10015484 3300026116 Bacteria 8376
340 Ga0207674_10089864 3300026116 Bacteria 3064
341 Ga0207674_10168712 3300026116 Bacteria 2142
342 Ga0207674_10271001 3300026116 Bacteria 1645
343 Ga0207674_10280938 3300026116 Bacteria 1613
344 Ga0207674_10350347 3300026116 Bacteria 1428
345 Ga0207674_10576732 3300026116 Bacteria 1087
346 Ga0207674_11256772 3300026116 Bacteria 710
347 Ga0207674_11256977 3300026116 Bacteria 710
348 Ga0207675_100230090 3300026118 Bacteria 1788
349 Ga0207698_10000058 3300026142 Bacteria 78048
350 Ga0207698_10001537 3300026142 Bacteria 13446
351 Ga0207698_10248152 3300026142 Bacteria 1627
352 Ga0207698_10256471 3300026142 Bacteria 1604
353 Ga0209281_1017439 3300027111 Bacteria 1455
354 Ga0209971_1005246 3300027682 Bacteria 3079
355 Ga0209813_10000051 3300027866 Bacteria 47545
356 Ga0209813_10001612 3300027866 Bacteria 5084
357 Ga0209974_10006613 3300027876 Bacteria 4035
358 Ga0207428_10045887 3300027907 Bacteria 3516
359 Ga0268266_10000534 3300028379 Bacteria 53027
360 Ga0268266_10005024 3300028379 Bacteria 12491
361 Ga0268266_10012690 3300028379 Bacteria 7281
362 Ga0268266_10207401 3300028379 Bacteria 1796
363 Ga0268266_10211526 3300028379 Bacteria 1779
364 Ga0268265_10004726 3300028380 Bacteria 9397
365 Ga0268265_10017233 3300028380 Bacteria 4981
366 Ga0268265_10030798 3300028380 Bacteria 3868
367 Ga0268265_10101330 3300028380 Bacteria 2326
368 Ga0268265_10941817 3300028380 Bacteria 850
369 Ga0268264_10000001 3300028381 Bacteria 1221000
370 Ga0268264_10000040 3300028381 Bacteria 373714
371 Ga0268264_10002127 3300028381 Bacteria 17671
372 Ga0268264_10007794 3300028381 Bacteria 8916
373 Ga0268264_10012577 3300028381 Bacteria 6971
374 Ga0268264_10209613 3300028381 Bacteria 1788
375 Ga0316177_1123653 3300030731 Bacteria 1210
376 Ga0265331_10031572 3300031250 Bacteria 2631
377 Ga0265327_10063076 3300031251 Bacteria 1883
378 Ga0307408_100051500 3300031548 Bacteria 2965
379 Ga0307408_100079920 3300031548 Bacteria 2441
380 Ga0307508_10036453 3300031616 Bacteria 4428
381 Ga0316579_10045560 3300031691 Bacteria 2045
382 Ga0307516_10361442 3300031730 Bacteria 1116
383 Ga0307405_10055116 3300031731 Bacteria 2486
384 Ga0307405_10168342 3300031731 Bacteria 1560
385 Ga0307405_10269605 3300031731 Bacteria 1276
386 Ga0316577_10308894 3300031733 Bacteria 896
387 Ga0307413_10022613 3300031824 Bacteria 3392
388 Ga0307413_10029790 3300031824 Bacteria 3059
389 Ga0307413_10377759 3300031824 Bacteria 1103
390 Ga0307413_10550058 3300031824 Bacteria 936
391 Ga0307410_10027090 3300031852 Bacteria 3618
392 Ga0307410_10057187 3300031852 Bacteria 2655
393 Ga0307410_10123972 3300031852 Bacteria 1888
394 Ga0307410_10255916 3300031852 Bacteria 1363
395 Ga0307406_10065764 3300031901 Bacteria 2357
396 Ga0307406_10309264 3300031901 Bacteria 1217
397 Ga0307407_10018883 3300031903 Bacteria 3499
398 Ga0307412_10014022 3300031911 Bacteria 4719
399 Ga0307412_10024442 3300031911 Bacteria 3729
400 Ga0307412_10238668 3300031911 Bacteria 1404
401 Ga0307409_100303216 3300031995 Bacteria 1487
402 Ga0307409_100700197 3300031995 Bacteria 1012
403 Ga0307416_100108924 3300032002 Bacteria 2435
404 Ga0307416_100242591 3300032002 Bacteria 1747
405 Ga0307416_100667863 3300032002 Bacteria 1125
406 Ga0307414_10001522 3300032004 Bacteria 12055
407 Ga0307414_10030520 3300032004 Bacteria 3522
408 Ga0307414_10037651 3300032004 Bacteria 3241
409 Ga0307414_10039730 3300032004 Bacteria 3172
410 Ga0307414_10070490 3300032004 Bacteria 2517
411 Ga0307414_10362671 3300032004 Bacteria 1247
412 Ga0307411_10009250 3300032005 Bacteria 5166
413 Ga0307415_100158880 3300032126 Bacteria 1750
414 Ga0307415_100591328 3300032126 Bacteria 986
415 Ga0307510_10360589 3300033180 Bacteria 902
416 Ga0316574_0317313 3300035398 Bacteria 990
417 Ga0373931_0192545 3300035691 Bacteria 1214
418 Ga0316582_0025496 3300036647 Bacteria 3551
419 Ga0316584_0245187 3300036712 Bacteria 1310
420 Ga0395900_0039730 3300037418 Bacteria 4847
421 Ga0395898_0049299 3300037466 Bacteria 4126
422 Ga0395898_0058144 3300037466 Bacteria 3765
423 Ga0395905_0002718 3300037471 Bacteria 19383
424 Ga0395905_0039036 3300037471 Bacteria 4454
425 Ga0395905_0067070 3300037471 Bacteria 3361
426 Ga0395905_0784689 3300037471 Bacteria 856
427 Ga0395901_0006671 3300038443 Bacteria 11667
428 Ga0436365_1372253 3300039437 Bacteria 817
429 Ga0436361_0526202 3300039447 Bacteria 1319
430 Ga0439443_011393 3300042003 Bacteria 1302
431 Ga0439448_0001220 3300042005 Bacteria 6563
432 Ga0439455_0011720 3300042012 Bacteria 1954
433 Ga0439458_0000228 3300042157 Bacteria 13324
434 Ga0439435_0031974 3300042436 Bacteria 1434
435 Ga0466969_0070923 3300044656 Bacteria 1676
436 Ga0466972_0001262 3300044658 Bacteria 12200
437 Ga0466973_0185653 3300044659 Bacteria 1574
438 Ga0466966_0036278 3300044684 Bacteria 3184
439 Ga0466961_0009663 3300044693 Bacteria 6140
440 Ga0453684_0248635 3300044712 Bacteria 2043
441 Ga0466970_0001327 3300044765 Bacteria 11960
442 Ga0466959_0064794 3300045049 Bacteria 2652
443 Ga0466958_0055504 3300045836 Bacteria 2404
444 Ga0495627_000090 3300046453 Bacteria 109622
445 Ga0495638_0000051 3300046460 Bacteria 206003
446 Ga0495650_0000818 3300046471 Bacteria 37910
447 Ga0495650_0001027 3300046471 Bacteria 31380
448 Ga0495584_0174675 3300046491 Bacteria 1092
449 Ga0495596_0000220 3300046500 Bacteria 39671
450 Ga0495596_0004156 3300046500 Bacteria 7110
451 Ga0495583_0000498 3300046506 Bacteria 56923
452 Ga0495606_0024355 3300046507 Bacteria 4364
453 Ga0495606_0026454 3300046507 Bacteria 4136
454 Ga0495610_0000015 3300046512 Bacteria 391489
455 Ga0495610_0000136 3300046512 Bacteria 82060
456 Ga0495610_0004021 3300046512 Bacteria 11090
457 Ga0495620_0007587 3300046515 Bacteria 5880
458 Ga0495620_0092010 3300046515 Bacteria 1216
459 Ga0495632_0000006 3300046519 Bacteria 345883
460 Ga0495632_0000511 3300046519 Bacteria 36529
461 Ga0495632_0038356 3300046519 Bacteria 2426
462 Ga0495632_0073150 3300046519 Bacteria 1644
463 Ga0495637_0000784 3300046520 Bacteria 21358
464 Ga0495643_0000021 3300046522 Bacteria 293465
465 Ga0495643_0000107 3300046522 Bacteria 138292
466 Ga0495643_0011542 3300046522 Bacteria 5374
467 Ga0495643_0052554 3300046522 Bacteria 2187
468 Ga0495648_0000032 3300046524 Bacteria 205970
469 Ga0495648_0045945 3300046524 Bacteria 2712
470 Ga0495663_0000008 3300046525 Bacteria 260614
471 Ga0495654_0060569 3300046530 Bacteria 1819
472 Ga0495654_0066259 3300046530 Bacteria 1722
473 Ga0495654_0081551 3300046530 Bacteria 1516
474 Ga0495609_0131639 3300046538 Bacteria 1071
475 Ga0495621_0008361 3300046539 Bacteria 3101
476 Ga0495633_0000190 3300046558 Bacteria 79967
477 Ga0495633_0002635 3300046558 Bacteria 12531
478 Ga0495633_0024761 3300046558 Bacteria 2962
479 Ga0495633_0072661 3300046558 Bacteria 1604
480 Ga0495668_0006416 3300046616 Bacteria 7706
481 Ga0495668_0105921 3300046616 Bacteria 1538
482 Ga0495668_0152375 3300046616 Bacteria 1266
483 Ga0495625_0001717 3300046660 Bacteria 25448
484 Ga0495625_0045065 3300046660 Bacteria 3190
485 Ga0495625_0051483 3300046660 Bacteria 2952
486 Ga0495670_0058113 3300046691 Bacteria 1942
487 Ga0495671_0000017 3300046692 Bacteria 293465
488 Ga0495671_0000020 3300046692 Bacteria 268306
489 Ga0495671_0108591 3300046692 Bacteria 1355
490 Ga0495671_0312460 3300046692 Bacteria 755
491 Ga0495673_0000076 3300047469 Bacteria 205985
492 Ga0495681_0000048 3300047470 Bacteria 110216
493 Ga0495681_0008268 3300047470 Bacteria 6539
494 Ga0495681_0155602 3300047470 Bacteria 956
495 Ga0495615_0000082 3300048090 Bacteria 29015
496 Ga0495615_0013434 3300048090 Bacteria 1710
497 Ga0495626_0000214 3300048091 Bacteria 69009
498 Ga0496100_0010729 3300048903 Bacteria 5194
499 Ga0496100_0182282 3300048903 Bacteria 1519
500 Ga0496101_0016904 3300048904 Bacteria 4939
501 Ga0496101_0020976 3300048904 Bacteria 4483
502 Ga0496101_0111668 3300048904 Bacteria 2058
503 Ga0496102_0023742 3300048905 Bacteria 5449
504 Ga0496102_0025237 3300048905 Bacteria 5288
505 Ga0496102_0301177 3300048905 Bacteria 1511
506 Ga0496103_0000021 3300048906 Bacteria 229062
507 Ga0496103_0008988 3300048906 Bacteria 5921
508 Ga0496103_0009373 3300048906 Bacteria 5799
509 Ga0496104_0000128 3300048907 Bacteria 70094
510 Ga0496104_0041285 3300048907 Bacteria 4325
511 Ga0496104_0050407 3300048907 Bacteria 3928
512 Ga0496105_0000064 3300048908 Bacteria 83935
513 Ga0496105_0000870 3300048908 Bacteria 20664
514 Ga0496105_0214103 3300048908 Bacteria 1570
515 Ga0496106_0003329 3300048909 Bacteria 11976
516 Ga0496107_0025431 3300048910 Bacteria 4191
517 Ga0496107_0045342 3300048910 Bacteria 3162
518 Ga0496108_0000682 3300048911 Bacteria 26248
519 Ga0496108_0094660 3300048911 Bacteria 2542
520 Ga0496108_0156410 3300048911 Bacteria 1969
521 Ga0496109_0116418 3300048912 Bacteria 2488
522 Ga0496109_0148593 3300048912 Bacteria 2193
523 Ga0496110_0124785 3300048913 Bacteria 2322
524 Ga0496110_0140371 3300048913 Bacteria 2184
525 Ga0496110_0840346 3300048913 Bacteria 823
526 Ga0496111_0051408 3300048914 Bacteria 2975
527 Ga0496111_0061685 3300048914 Bacteria 2718
528 Ga0496111_0350411 3300048914 Bacteria 1093
529 Ga0496112_0016599 3300048915 Bacteria 6903
530 Ga0496112_0219258 3300048915 Bacteria 1858
531 Ga0496113_0000044 3300048916 Bacteria 51909
532 Ga0496113_0006116 3300048916 Bacteria 7596
533 Ga0496113_0140747 3300048916 Bacteria 1898
534 Ga0496114_0023435 3300048917 Bacteria 5038
535 Ga0496114_0074946 3300048917 Bacteria 2849
536 Ga0496116_0000062 3300048919 Bacteria 271104
537 Ga0496116_0021417 3300048919 Bacteria 4878
538 Ga0496116_0025195 3300048919 Bacteria 4377
539 Ga0496117_0015462 3300048920 Bacteria 6505
540 Ga0496117_0055578 3300048920 Bacteria 2765
541 Ga0496117_0090067 3300048920 Bacteria 1978
542 Ga0496117_0260111 3300048920 Bacteria 941
543 Ga0496118_0004786 3300048921 Bacteria 15813
544 Ga0496118_0057773 3300048921 Bacteria 2905
545 Ga0496118_0076829 3300048921 Bacteria 2372
546 Ga0496118_0081041 3300048921 Bacteria 2281
547 Ga0496119_0000077 3300048922 Bacteria 143108
548 Ga0496119_0048407 3300048922 Bacteria 2636
549 Ga0496119_0088899 3300048922 Bacteria 1760
550 Ga0496120_0001801 3300048923 Bacteria 24031
551 Ga0496120_0028089 3300048923 Bacteria 3452
552 Ga0496120_0081703 3300048923 Bacteria 1748
553 Ga0496121_0000017 3300048924 Bacteria 546415
554 Ga0496121_0000196 3300048924 Bacteria 135812
555 Ga0496121_0003051 3300048924 Bacteria 24286
556 Ga0496121_0003197 3300048924 Bacteria 23595
557 Ga0496121_0010881 3300048924 Bacteria 10170
558 Ga0496121_0010937 3300048924 Bacteria 10135
559 Ga0496121_0115314 3300048924 Bacteria 2040
560 Ga0496121_0170721 3300048924 Bacteria 1580
561 Ga0496122_0003556 3300048925 Bacteria 20365
562 Ga0496122_0006114 3300048925 Bacteria 14015
563 Ga0496122_0006671 3300048925 Bacteria 13150
564 Ga0496122_0008730 3300048925 Bacteria 10847
565 Ga0496122_0027860 3300048925 Bacteria 4816
566 Ga0496122_0039577 3300048925 Bacteria 3758
567 Ga0496123_0000545 3300048926 Bacteria 64687
568 Ga0496123_0001103 3300048926 Bacteria 40498
569 Ga0496123_0006936 3300048926 Bacteria 10822
570 Ga0496123_0016815 3300048926 Bacteria 5914
571 Ga0496123_0037493 3300048926 Bacteria 3421
572 Ga0496124_0002439 3300048927 Bacteria 24366
573 Ga0496124_0004900 3300048927 Bacteria 15386
574 Ga0496124_0023873 3300048927 Bacteria 5571
575 Ga0496124_0033927 3300048927 Bacteria 4485
576 Ga0496124_0066946 3300048927 Bacteria 2990
577 Ga0496124_0278609 3300048927 Bacteria 1220
578 Ga0496124_0416328 3300048927 Bacteria 928
579 Ga0496125_0001135 3300048928 Bacteria 40511
580 Ga0496125_0006988 3300048928 Bacteria 12081
581 Ga0496125_0034343 3300048928 Bacteria 4472
582 Ga0496125_0040809 3300048928 Bacteria 3975
583 Ga0496125_0071024 3300048928 Bacteria 2722
584 Ga0496125_0072386 3300048928 Bacteria 2685
585 Ga0496125_0343244 3300048928 Bacteria 895
586 Ga0496126_0000175 3300048929 Bacteria 146389
587 Ga0496126_0004477 3300048929 Bacteria 16680
588 Ga0496126_0006838 3300048929 Bacteria 12646
589 Ga0496126_0027682 3300048929 Bacteria 5410
590 Ga0496126_0036199 3300048929 Bacteria 4617
591 Ga0496126_0449597 3300048929 Bacteria 1037
592 Ga0496126_0537723 3300048929 Bacteria 929
593 Ga0501306_019489 3300049127 Bacteria 936
594 Ga0501335_000615 3300049551 Bacteria 2383
595 Ga0501033_0135077 3300049570 Bacteria 1785
596 Ga0501034_0325286 3300049571 Bacteria 1470
597 Ga0501036_0256093 3300049572 Bacteria 1466
598 Ga0501037_0100364 3300049573 Bacteria 2090
599 Ga0501037_0325958 3300049573 Bacteria 1063
600 Ga0501038_0120378 3300049574 Bacteria 2166
601 Ga0501039_0088013 3300049575 Bacteria 2420
602 Ga0501039_0219519 3300049575 Bacteria 1495
603 Ga0501042_0040621 3300049578 Bacteria 3307
604 Ga0501046_0030454 3300049580 Bacteria 4380
605 Ga0501047_0000731 3300049581 Bacteria 34159
606 Ga0501047_0264008 3300049581 Bacteria 1569
607 Ga0501048_0144900 3300049582 Bacteria 1680
608 Ga0501070_0358628 3300049586 Bacteria 1183
609 Ga0501198_007724 3300049649 Bacteria 1551
610 Ga0501208_047227 3300049655 Bacteria 812
611 Ga0501223_000039 3300049663 Bacteria 45537
612 Ga0501224_017610 3300049664 Bacteria 1062
613 Ga0501246_001398 3300049676 Bacteria 1843
614 Ga0501249_000213 3300049679 Bacteria 17777
615 Ga0501225_0000010 3300049705 Bacteria 82395
616 Ga0501241_034035 3300049758 Bacteria 970
617 Ga0501264_012766 3300049761 Bacteria 827
618 Ga0501269_003897 3300049766 Bacteria 1795
619 Ga0501035_0574428 3300049822 Bacteria 921
620 Ga0501044_0001187 3300049823 Bacteria 30876
621 Ga0501044_0134255 3300049823 Bacteria 2467
622 Ga0501044_0260664 3300049823 Bacteria 1672
623 Ga0501044_0588351 3300049823 Bacteria 1007
624 Ga0501204_000430 3300049850 Bacteria 3639
625 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
626 nmdc:mga03683_236473_c1 3300050489 Bacteria 846
627 nmdc:mga03683_344_c1 3300050489 Bacteria 13557
628 nmdc:mga03n38_8067_c1 3300050490 Bacteria 3758
629 nmdc:mga00v17_132284_c1 3300050491 Bacteria 1595
630 nmdc:mga00v17_25514_c1 3300050491 Bacteria 3436
631 nmdc:mga00v17_3742_c1 3300050491 Bacteria 7856
632 nmdc:mga00v17_87602_c1 3300050491 Bacteria 1952
633 nmdc:mga0yw44_143367_c1 3300050492 Bacteria 1554
634 nmdc:mga0k408_161453_c1 3300050493 Bacteria 1335
635 nmdc:mga0k408_416031_c1 3300050493 Bacteria 799
636 nmdc:mga0k408_7432_c1 3300050493 Bacteria 5849
637 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
638 nmdc:mga0k408_92421_c1 3300050493 Bacteria 1778
639 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
640 nmdc:mga06z11_84_c1 3300050494 Bacteria 40055
641 nmdc:mga04h51_146_c1 3300050495 Bacteria 20585
642 nmdc:mga04h51_74798_c1 3300050495 Bacteria 1191
643 nmdc:mga07m45_114488_c1 3300050496 Bacteria 1555
644 nmdc:mga07m45_129095_c1 3300050496 Bacteria 1462
645 nmdc:mga07m45_20_c1 3300050496 Bacteria 126269
646 nmdc:mga07m45_282292_c1 3300050496 Bacteria 966
647 nmdc:mga07m45_377971_c1 3300050496 Bacteria 823
648 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
649 nmdc:mga07m45_963_c2 3300050496 Bacteria 2639
650 nmdc:mga05p37_1065596_c1 3300050507 Bacteria 851
651 nmdc:mga0sz30_24209_c1 3300050516 Bacteria 2476
652 nmdc:mga0sz30_46_c1 3300050516 Bacteria 44412
653 nmdc:mga0sz30_4821_c1 3300050516 Bacteria 4910
654 Ga0500643_000004 3300053087 Bacteria 857484
655 Ga0500643_006099 3300053087 Bacteria 5095
656 Ga0500643_020706 3300053087 Bacteria 2143
657 Ga0500566_0131840 3300053094 Bacteria 1336
658 Ga0500641_0073101 3300053096 Bacteria 1446
659 Ga0500556_0000222 3300053104 Bacteria 45971
660 Ga0500557_059563 3300053105 Bacteria 1239
661 Ga0500592_001156 3300053116 Bacteria 4293
662 Ga0500595_101841 3300053119 Bacteria 822
663 Ga0500607_000055 3300053121 Bacteria 78780
664 Ga0500607_000844 3300053121 Bacteria 29501
665 Ga0500608_000087 3300053122 Bacteria 37903
666 Ga0500608_007769 3300053122 Bacteria 4458
667 Ga0500614_090803 3300053123 Bacteria 867
668 Ga0500618_010477 3300053125 Bacteria 2487
669 Ga0500642_0000011 3300053130 Bacteria 215963
670 Ga0500559_0003805 3300053136 Bacteria 7307
671 Ga0500559_0008073 3300053136 Bacteria 4632
672 Ga0500564_000168 3300053138 Bacteria 17386
673 Ga0500568_0046730 3300053139 Bacteria 1717
674 Ga0500573_0229092 3300053140 Bacteria 970
675 Ga0500577_0070252 3300053142 Bacteria 1372
676 Ga0500590_000131 3300053148 Bacteria 20923
677 Ga0500590_065735 3300053148 Bacteria 1812
678 Ga0500604_0081425 3300053151 Bacteria 1046
679 Ga0500616_0006078 3300053153 Bacteria 8008
680 Ga0500622_0001994 3300053156 Bacteria 15306
681 Ga0500622_0025695 3300053156 Bacteria 3111
682 Ga0500624_000106 3300053157 Bacteria 40037
683 Ga0500630_098590 3300053159 Bacteria 1336
684 Ga0500636_0005955 3300053177 Bacteria 6988
685 Ga0500637_0017519 3300053178 Bacteria 3836
686 Ga0500567_000445 3300053723 Bacteria 13930
687 Ga0500570_004079 3300053724 Bacteria 7637
688 Ga0500625_000009 3300053729 Bacteria 159296
689 Ga0500645_000417 3300053730 Bacteria 29425
690 Ga0500645_004197 3300053730 Bacteria 5605
691 Ga0500645_006930 3300053730 Bacteria 3999
692 Ga0500645_017913 3300053730 Bacteria 2217
693 Ga0500645_056045 3300053730 Bacteria 1144
694 Ga0500645_062632 3300053730 Bacteria 1074
695 Ga0587090_002320 3300059510 Bacteria 2079
696 Ga0501082_0612062 3300060353 Bacteria 953
697 2511130327 2510917021 Bacteria 5705459
698 2643950202 2643221588 Bacteria 3692460
699 2644036773 2643221605 Bacteria 4772303
700 2738709788 2738541275 Bacteria 4830863
701 2738848213 2738541301 Bacteria 4834102
702 2738863942 2738541304 Bacteria 4833665
703 2739296460 2738543022 Bacteria 4835059
704 2739358138 2738543033 Bacteria 4833336
705 2739649378 2739367664 Bacteria 4114334
706 2740027851 2739367865 Bacteria 4114482
707 2778125109 2775507255 Bacteria 3945731
708 2819552827 2818991438 Bacteria 5793701
709 2896186914 2896184354 Bacteria 3258548
710 2896254677 2896253425 Bacteria 3418029
711 2919141737 2919138771 Bacteria 5281312
712 2928101345 2928100450 Bacteria 4837635
713 2928960244 2928959182 Bacteria 4725774
714 3000866463 3000865235 Bacteria 3106258
715 8054303050 8054302542 Bacteria 5698134
716 Ga0207640_10000508
717 SwRhRL2b_contig_1292634
718 SwRhRL2b_contig_2522198
719 SwRhRL2b_contig_2959322
720 SwRhRL2b_contig_3703961
721 SwRhRL2b_contig_453878
722 JGI24736J21556_1000613
723 JGI24741J21665_1000366
724 JGI24740J21852_10005104
725 JGI24739J22299_10005319
726 JGI24735J21928_10004932
727 JGI24738J21930_10001740
728 JGI24751J29686_10025372
729 rootH1_10064790
730 rootL2_10052919
731 Ga0065704_10000451
732 Ga0065704_10001612
733 Ga0065704_10070364
734 Ga0065704_10168680
735 Ga0065704_10228265
736 Ga0065707_10122578
737 Ga0070658_10001814
738 Ga0070658_10004690
739 Ga0070658_10058237
740 Ga0070658_10068992
741 Ga0070658_10088083
742 Ga0070658_10104461
743 Ga0070658_10174659
744 Ga0070683_100080914
745 Ga0070670_100002377
746 Ga0070670_100241386
747 Ga0070670_100352254
748 Ga0070666_10005044
749 Ga0070666_10031513
750 Ga0070666_10033483
751 Ga0070666_10077356
752 Ga0070666_10122419
753 Ga0070680_100269627
754 Ga0070680_100270503
755 Ga0070660_100009577
756 Ga0070660_100078162
757 Ga0070660_100339548
758 Ga0070689_100168652
759 Ga0070661_100012214
760 Ga0070661_100133526
761 Ga0070668_100000026
762 Ga0070668_100000047
763 Ga0070668_100016413
764 Ga0070668_100057586
765 Ga0070668_100062353
766 Ga0070668_100074324
767 Ga0070669_100000270
768 Ga0070669_100001263
769 Ga0070669_100160432
770 Ga0070669_100583648
771 Ga0070671_100000116
772 Ga0070671_100000470
773 Ga0070671_100047816
774 Ga0070671_100099591
775 Ga0070659_100052995
776 Ga0070667_100000019
777 Ga0070667_100000030
778 Ga0070667_100000968
779 Ga0070667_100001907
780 Ga0070667_100018063
781 Ga0070667_100109280
782 Ga0070663_100002941
783 Ga0070663_100189566
784 Ga0070662_100002038
785 Ga0070662_100011994
786 Ga0070662_100051197
787 Ga0070681_10049910
788 Ga0070681_11163648
789 Ga0070679_100011467
790 Ga0070679_100053739
791 Ga0070679_100165965
792 Ga0070679_100352225
793 Ga0070684_100098100
794 Ga0070684_100438914
795 Ga0068853_100001009
796 Ga0068853_100099224
797 Ga0068853_100387868
798 Ga0070665_100001031
799 Ga0070665_100015813
800 Ga0070665_100020215
801 Ga0068855_100000608
802 Ga0068855_100007299
803 Ga0068855_100011899
804 Ga0068855_100022037
805 Ga0068855_100026547
806 Ga0068855_100058341
807 Ga0068855_100058989
808 Ga0068855_100218364
809 Ga0068855_100234877
810 Ga0070664_100004940
811 Ga0070664_100260354
812 Ga0068857_100042135
813 Ga0068857_100124356
814 Ga0068857_100152991
815 Ga0068857_100389558
816 Ga0068857_100510486
817 Ga0068857_101027922
818 Ga0068854_100000459
819 Ga0068854_100117457
820 Ga0068854_100190734
821 Ga0068854_100365742
822 Ga0068854_100687749
823 Ga0068856_100019636
824 Ga0068856_100020542
825 Ga0068856_100025980
826 Ga0068856_100160015
827 Ga0068856_100213559
828 Ga0068852_100000231
829 Ga0068852_100000860
830 Ga0068852_100331083
831 Ga0068859_100312446
832 Ga0068859_100359239
833 Ga0068864_100003823
834 Ga0068861_100274228
835 Ga0068863_100000093
836 Ga0068863_100000106
837 Ga0068863_100004037
838 Ga0068863_100044294
839 Ga0068858_100001247
840 Ga0068858_100034454
841 Ga0068858_100039777
842 Ga0068858_100056520
843 Ga0068860_100000036
844 Ga0068860_100000386
845 Ga0068860_100009605
846 Ga0068860_100017800
847 Ga0068860_100044110
848 Ga0068860_100061361
849 Ga0068860_100092375
850 Ga0068862_100006085
851 Ga0068862_100009807
852 Ga0068862_100028254
853 Ga0068862_100040223
854 Ga0068862_100087044
855 Ga0068862_100970178
856 Ga0081455_10000255
857 Ga0075368_10000112
858 Ga0075363_100005439
859 Ga0075363_100012861
860 Ga0075364_10014899
861 Ga0075364_10033952
862 Ga0075432_10006371
863 Ga0075362_10000003
864 Ga0075362_10000129
865 Ga0075362_10265687
866 Ga0075367_10010792
867 Ga0075369_10005083
868 Ga0075369_10019731
869 Ga0075366_10000006
870 Ga0075366_10009002
871 Ga0075366_10039961
872 Ga0075366_10197964
873 Ga0075366_10247315
874 Ga0075366_10295921
875 Ga0075366_10308350
876 Ga0075370_10000008
877 Ga0075370_10010420
878 Ga0075370_10035362
879 Ga0075370_10084534
880 Ga0075370_10098533
881 Ga0068871_100589168
882 Ga0075436_100376067
883 Ga0097620_100312443
884 Ga0097620_100359245
885 Ga0105251_10000231
886 Ga0105251_10016214
887 Ga0105251_10049746
888 Ga0105240_10012161
889 Ga0105240_10012850
890 Ga0105240_10630314
891 Ga0105240_11253654
892 Ga0105240_11360643
893 Ga0111539_10609168
894 Ga0105247_10075248
895 Ga0105247_10102854
896 Ga0105247_10128849
897 Ga0114129_11521487
898 Ga0105243_10449731
899 Ga0105241_10038453
900 Ga0105241_10084481
901 Ga0105248_10013347
902 Ga0105248_10106004
903 Ga0105248_10158703
904 Ga0105248_10206862
905 Ga0105248_10255623
906 Ga0105248_10608341
907 Ga0105248_11472165
908 Ga0105237_10059493
909 Ga0105238_10071650
910 Ga0105238_10369475
911 Ga0105238_10486038
912 Ga0105249_10166648
913 Ga0105249_10291555
914 Ga0105249_10648172
915 Ga0105246_10000657
916 Ga0157326_1000423
917 Ga0157373_10005891
918 Ga0157373_10032124
919 Ga0157373_10058315
920 Ga0157371_10005585
921 Ga0157371_10049399
922 Ga0157371_10319288
923 Ga0157370_10008601
924 Ga0157370_10057965
925 Ga0157370_10134122
926 Ga0157369_10011267
927 Ga0157378_10067728
928 Ga0163162_10013864
929 Ga0163162_10021491
930 Ga0163162_10065959
931 Ga0163162_10194674
932 Ga0157372_10175214
933 Ga0157372_11511544
934 Ga0157375_10105105
935 Ga0157375_10599022
936 Ga0163161_10001762
937 Ga0213875_10009905
938 Ga0209147_103605
939 Ga0209050_1000687
940 Ga0207696_1005600
941 Ga0207713_1000951
942 Ga0207682_10097959
943 Ga0207680_10061223
944 Ga0207680_10062260
945 Ga0207680_10093912
946 Ga0207680_10151143
947 Ga0207680_10198014
948 Ga0207647_10019938
949 Ga0207647_10041942
950 Ga0207647_10058954
951 Ga0207647_10191283
952 Ga0207647_10445746
953 Ga0207705_10000004
954 Ga0207705_10005310
955 Ga0207705_10032428
956 Ga0207705_10059755
957 Ga0207705_10068657
958 Ga0207705_10462588
959 Ga0207707_10076073
960 Ga0207695_10019301
961 Ga0207695_10031555
962 Ga0207660_10352336
963 Ga0207660_10595192
964 Ga0207657_10000408
965 Ga0207657_10048996
966 Ga0207657_10054446
967 Ga0207657_10241990
968 Ga0207649_10024515
969 Ga0207649_10115630
970 Ga0207649_10549250
971 Ga0207652_10007853
972 Ga0207652_10063222
973 Ga0207652_10316211
974 Ga0207681_10000049
975 Ga0207681_10000774
976 Ga0207681_10002968
977 Ga0207681_10052128
978 Ga0207681_10122960
979 Ga0207694_10068861
980 Ga0207694_10254042
981 Ga0207650_10006404
982 Ga0207650_10255242
983 Ga0207650_10308447
984 Ga0207644_10000067
985 Ga0207644_10000191
986 Ga0207644_10002323
987 Ga0207644_10003057
988 Ga0207690_10021761
989 Ga0207690_10099368
990 Ga0207690_10227135
991 Ga0207706_10008254
992 Ga0207706_10285577
993 Ga0207709_10255433
994 Ga0207711_10013496
995 Ga0207711_10104536
996 Ga0207711_10482985
997 Ga0207711_10781261
998 Ga0207661_10039869
999 Ga0207679_10004188
1000 Ga0207679_10140360
1001 Ga0207679_10177919
1002 Ga0207667_10000916
1003 Ga0207667_10003563
1004 Ga0207667_10005019
1005 Ga0207667_10011650
1006 Ga0207667_10023043
1007 Ga0207667_10070651
1008 Ga0207667_10078696
1009 Ga0207667_10293911
1010 Ga0207667_10479567
1011 Ga0207712_10200819
1012 Ga0207712_10563243
1013 Ga0207712_10679367
1014 Ga0207668_10000066
1015 Ga0207668_10000081
1016 Ga0207668_10003398
1017 Ga0207668_10011848
1018 Ga0207640_10077559
1019 Ga0207640_10216524
1020 Ga0207640_10366525
1021 Ga0207640_10462303
1022 Ga0207640_10863151
1023 Ga0207658_10000002
1024 Ga0207658_10000019
1025 Ga0207658_10000344
1026 Ga0207658_10007159
1027 Ga0207658_10012173
1028 Ga0207658_10265642
1029 Ga0207703_10004946
1030 Ga0207703_10005351
1031 Ga0207703_10029046
1032 Ga0207703_10052344
1033 Ga0207639_10000213
1034 Ga0207639_10228780
1035 Ga0207639_10396697
1036 Ga0207639_10900539
1037 Ga0207678_10000857
1038 Ga0207678_10029324
1039 Ga0207678_10046385
1040 Ga0207702_10019109
1041 Ga0207702_10114050
1042 Ga0207702_10136446
1043 Ga0207702_10147935
1044 Ga0207702_10162965
1045 Ga0207702_11128766
1046 Ga0207702_11480326
1047 Ga0207641_10000029
1048 Ga0207641_10000733
1049 Ga0207641_10004505
1050 Ga0207641_10014797
1051 Ga0207641_10046323
1052 Ga0207641_10066769
1053 Ga0207676_10002656
1054 Ga0207674_10015484
1055 Ga0207674_10089864
1056 Ga0207674_10168712
1057 Ga0207674_10271001
1058 Ga0207674_10280938
1059 Ga0207674_10350347
1060 Ga0207674_10576732
1061 Ga0207674_11256772
1062 Ga0207674_11256977
1063 Ga0207675_100230090
1064 Ga0207698_10000058
1065 Ga0207698_10001537
1066 Ga0207698_10248152
1067 Ga0207698_10256471
1068 Ga0209281_1017439
1069 Ga0209971_1005246
1070 Ga0209813_10000051
1071 Ga0209813_10001612
1072 Ga0209974_10006613
1073 Ga0207428_10045887
1074 Ga0268266_10000534
1075 Ga0268266_10005024
1076 Ga0268266_10012690
1077 Ga0268266_10207401
1078 Ga0268266_10211526
1079 Ga0268265_10004726
1080 Ga0268265_10017233
1081 Ga0268265_10030798
1082 Ga0268265_10101330
1083 Ga0268265_10941817
1084 Ga0268264_10000001
1085 Ga0268264_10000040
1086 Ga0268264_10002127
1087 Ga0268264_10007794
1088 Ga0268264_10012577
1089 Ga0268264_10209613
1090 Ga0316177_1123653
1091 Ga0265331_10031572
1092 Ga0265327_10063076
1093 Ga0307408_100051500
1094 Ga0307408_100079920
1095 Ga0307508_10036453
1096 Ga0316579_10045560
1097 Ga0307516_10361442
1098 Ga0307405_10055116
1099 Ga0307405_10168342
1100 Ga0307405_10269605
1101 Ga0316577_10308894
1102 Ga0307413_10022613
1103 Ga0307413_10029790
1104 Ga0307413_10377759
1105 Ga0307413_10550058
1106 Ga0307410_10027090
1107 Ga0307410_10057187
1108 Ga0307410_10123972
1109 Ga0307410_10255916
1110 Ga0307406_10065764
1111 Ga0307406_10309264
1112 Ga0307407_10018883
1113 Ga0307412_10014022
1114 Ga0307412_10024442
1115 Ga0307412_10238668
1116 Ga0307409_100303216
1117 Ga0307409_100700197
1118 Ga0307416_100108924
1119 Ga0307416_100242591
1120 Ga0307416_100667863
1121 Ga0307414_10001522
1122 Ga0307414_10030520
1123 Ga0307414_10037651
1124 Ga0307414_10039730
1125 Ga0307414_10070490
1126 Ga0307414_10362671
1127 Ga0307411_10009250
1128 Ga0307415_100158880
1129 Ga0307415_100591328
1130 Ga0307510_10360589
1131 Ga0316574_0317313
1132 Ga0373931_0192545
1133 Ga0316582_0025496
1134 Ga0316584_0245187
1135 Ga0395900_0039730
1136 Ga0395898_0049299
1137 Ga0395898_0058144
1138 Ga0395905_0002718
1139 Ga0395905_0039036
1140 Ga0395905_0067070
1141 Ga0395905_0784689
1142 Ga0395901_0006671
1143 Ga0436365_1372253
1144 Ga0436361_0526202
1145 Ga0439443_011393
1146 Ga0439448_0001220
1147 Ga0439455_0011720
1148 Ga0439458_0000228
1149 Ga0439435_0031974
1150 Ga0466969_0070923
1151 Ga0466972_0001262
1152 Ga0466973_0185653
1153 Ga0466966_0036278
1154 Ga0466961_0009663
1155 Ga0453684_0248635
1156 Ga0466970_0001327
1157 Ga0466959_0064794
1158 Ga0466958_0055504
1159 Ga0495627_000090
1160 Ga0495638_0000051
1161 Ga0495650_0000818
1162 Ga0495650_0001027
1163 Ga0495584_0174675
1164 Ga0495596_0000220
1165 Ga0495596_0004156
1166 Ga0495583_0000498
1167 Ga0495606_0024355
1168 Ga0495606_0026454
1169 Ga0495610_0000015
1170 Ga0495610_0000136
1171 Ga0495610_0004021
1172 Ga0495620_0007587
1173 Ga0495620_0092010
1174 Ga0495632_0000006
1175 Ga0495632_0000511
1176 Ga0495632_0038356
1177 Ga0495632_0073150
1178 Ga0495637_0000784
1179 Ga0495643_0000021
1180 Ga0495643_0000107
1181 Ga0495643_0011542
1182 Ga0495643_0052554
1183 Ga0495648_0000032
1184 Ga0495648_0045945
1185 Ga0495663_0000008
1186 Ga0495654_0060569
1187 Ga0495654_0066259
1188 Ga0495654_0081551
1189 Ga0495609_0131639
1190 Ga0495621_0008361
1191 Ga0495633_0000190
1192 Ga0495633_0002635
1193 Ga0495633_0024761
1194 Ga0495633_0072661
1195 Ga0495668_0006416
1196 Ga0495668_0105921
1197 Ga0495668_0152375
1198 Ga0495625_0001717
1199 Ga0495625_0045065
1200 Ga0495625_0051483
1201 Ga0495670_0058113
1202 Ga0495671_0000017
1203 Ga0495671_0000020
1204 Ga0495671_0108591
1205 Ga0495671_0312460
1206 Ga0495673_0000076
1207 Ga0495681_0000048
1208 Ga0495681_0008268
1209 Ga0495681_0155602
1210 Ga0495615_0000082
1211 Ga0495615_0013434
1212 Ga0495626_0000214
1213 Ga0496100_0010729
1214 Ga0496100_0182282
1215 Ga0496101_0016904
1216 Ga0496101_0020976
1217 Ga0496101_0111668
1218 Ga0496102_0023742
1219 Ga0496102_0025237
1220 Ga0496102_0301177
1221 Ga0496103_0000021
1222 Ga0496103_0008988
1223 Ga0496103_0009373
1224 Ga0496104_0000128
1225 Ga0496104_0041285
1226 Ga0496104_0050407
1227 Ga0496105_0000064
1228 Ga0496105_0000870
1229 Ga0496105_0214103
1230 Ga0496106_0003329
1231 Ga0496107_0025431
1232 Ga0496107_0045342
1233 Ga0496108_0000682
1234 Ga0496108_0094660
1235 Ga0496108_0156410
1236 Ga0496109_0116418
1237 Ga0496109_0148593
1238 Ga0496110_0124785
1239 Ga0496110_0140371
1240 Ga0496110_0840346
1241 Ga0496111_0051408
1242 Ga0496111_0061685
1243 Ga0496111_0350411
1244 Ga0496112_0016599
1245 Ga0496112_0219258
1246 Ga0496113_0000044
1247 Ga0496113_0006116
1248 Ga0496113_0140747
1249 Ga0496114_0023435
1250 Ga0496114_0074946
1251 Ga0496116_0000062
1252 Ga0496116_0021417
1253 Ga0496116_0025195
1254 Ga0496117_0015462
1255 Ga0496117_0055578
1256 Ga0496117_0090067
1257 Ga0496117_0260111
1258 Ga0496118_0004786
1259 Ga0496118_0057773
1260 Ga0496118_0076829
1261 Ga0496118_0081041
1262 Ga0496119_0000077
1263 Ga0496119_0048407
1264 Ga0496119_0088899
1265 Ga0496120_0001801
1266 Ga0496120_0028089
1267 Ga0496120_0081703
1268 Ga0496121_0000017
1269 Ga0496121_0000196
1270 Ga0496121_0003051
1271 Ga0496121_0003197
1272 Ga0496121_0010881
1273 Ga0496121_0010937
1274 Ga0496121_0115314
1275 Ga0496121_0170721
1276 Ga0496122_0003556
1277 Ga0496122_0006114
1278 Ga0496122_0006671
1279 Ga0496122_0008730
1280 Ga0496122_0027860
1281 Ga0496122_0039577
1282 Ga0496123_0000545
1283 Ga0496123_0001103
1284 Ga0496123_0006936
1285 Ga0496123_0016815
1286 Ga0496123_0037493
1287 Ga0496124_0002439
1288 Ga0496124_0004900
1289 Ga0496124_0023873
1290 Ga0496124_0033927
1291 Ga0496124_0066946
1292 Ga0496124_0278609
1293 Ga0496124_0416328
1294 Ga0496125_0001135
1295 Ga0496125_0006988
1296 Ga0496125_0034343
1297 Ga0496125_0040809
1298 Ga0496125_0071024
1299 Ga0496125_0072386
1300 Ga0496125_0343244
1301 Ga0496126_0000175
1302 Ga0496126_0004477
1303 Ga0496126_0006838
1304 Ga0496126_0027682
1305 Ga0496126_0036199
1306 Ga0496126_0449597
1307 Ga0496126_0537723
1308 Ga0501306_019489
1309 Ga0501335_000615
1310 Ga0501033_0135077
1311 Ga0501034_0325286
1312 Ga0501036_0256093
1313 Ga0501037_0100364
1314 Ga0501037_0325958
1315 Ga0501038_0120378
1316 Ga0501039_0088013
1317 Ga0501039_0219519
1318 Ga0501042_0040621
1319 Ga0501046_0030454
1320 Ga0501047_0000731
1321 Ga0501047_0264008
1322 Ga0501048_0144900
1323 Ga0501070_0358628
1324 Ga0501198_007724
1325 Ga0501208_047227
1326 Ga0501223_000039
1327 Ga0501224_017610
1328 Ga0501246_001398
1329 Ga0501249_000213
1330 Ga0501225_0000010
1331 Ga0501241_034035
1332 Ga0501264_012766
1333 Ga0501269_003897
1334 Ga0501035_0574428
1335 Ga0501044_0001187
1336 Ga0501044_0134255
1337 Ga0501044_0260664
1338 Ga0501044_0588351
1339 Ga0501204_000430
1340 nmdc:mga03683_13_c1
1341 nmdc:mga03683_236473_c1
1342 nmdc:mga03683_344_c1
1343 nmdc:mga03n38_8067_c1
1344 nmdc:mga00v17_132284_c1
1345 nmdc:mga00v17_25514_c1
1346 nmdc:mga00v17_3742_c1
1347 nmdc:mga00v17_87602_c1
1348 nmdc:mga0yw44_143367_c1
1349 nmdc:mga0k408_161453_c1
1350 nmdc:mga0k408_416031_c1
1351 nmdc:mga0k408_7432_c1
1352 nmdc:mga0k408_8_c1
1353 nmdc:mga0k408_92421_c1
1354 nmdc:mga06z11_17_c1
1355 nmdc:mga06z11_84_c1
1356 nmdc:mga04h51_146_c1
1357 nmdc:mga04h51_74798_c1
1358 nmdc:mga07m45_114488_c1
1359 nmdc:mga07m45_129095_c1
1360 nmdc:mga07m45_20_c1
1361 nmdc:mga07m45_282292_c1
1362 nmdc:mga07m45_377971_c1
1363 nmdc:mga07m45_4_c1
1364 nmdc:mga07m45_963_c2
1365 nmdc:mga05p37_1065596_c1
1366 nmdc:mga0sz30_24209_c1
1367 nmdc:mga0sz30_46_c1
1368 nmdc:mga0sz30_4821_c1
1369 Ga0500643_000004
1370 Ga0500643_006099
1371 Ga0500643_020706
1372 Ga0500566_0131840
1373 Ga0500641_0073101
1374 Ga0500556_0000222
1375 Ga0500557_059563
1376 Ga0500592_001156
1377 Ga0500595_101841
1378 Ga0500607_000055
1379 Ga0500607_000844
1380 Ga0500608_000087
1381 Ga0500608_007769
1382 Ga0500614_090803
1383 Ga0500618_010477
1384 Ga0500642_0000011
1385 Ga0500559_0003805
1386 Ga0500559_0008073
1387 Ga0500564_000168
1388 Ga0500568_0046730
1389 Ga0500573_0229092
1390 Ga0500577_0070252
1391 Ga0500590_000131
1392 Ga0500590_065735
1393 Ga0500604_0081425
1394 Ga0500616_0006078
1395 Ga0500622_0001994
1396 Ga0500622_0025695
1397 Ga0500624_000106
1398 Ga0500630_098590
1399 Ga0500636_0005955
1400 Ga0500637_0017519
1401 Ga0500567_000445
1402 Ga0500570_004079
1403 Ga0500625_000009
1404 Ga0500645_000417
1405 Ga0500645_004197
1406 Ga0500645_006930
1407 Ga0500645_017913
1408 Ga0500645_056045
1409 Ga0500645_062632
1410 Ga0587090_002320
1411 Ga0501082_0612062
1412 2511130327
1413 2643950202
1414 2644036773
1415 2738709788
1416 2738848213
1417 2738863942
1418 2739296460
1419 2739358138
1420 2739649378
1421 2740027851
1422 2778125109
1423 2819552827
1424 2896186914
1425 2896254677
1426 2919141737
1427 2928101345
1428 2928960244
1429 3000866463
1430 8054303050

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

1

118

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9442 1 166
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.94 1 166
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9281 1 166
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9233 4 153
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9086 1 167
ID Description Score Start End Superfamily
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9519 3 169 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9442 1 166 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9281 1 166 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9267 2 166 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9028 1 167 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A4Q5SBZ3-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9829 1 169 GO:0003861
GO:0009098
GO:0009316
AF-A0A2A2K0E1-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9815 1 115 GO:0003861
GO:0009098
GO:0009316
GO:0016491
AF-A0A4Q5SBZ3-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9771 1 169 GO:0003861
GO:0009098
GO:0009316
AF-A0A3D4LX70-F1-model_v4 deleted 0.9759 1 139
AF-A0A800JRL8-F1-model_v4 deleted 0.9731 1 142

Map