F476993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 309 | 1430 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300025981|Ga0207640_10000508|Ga0207640_1000050816 |
| Length | 214 |
| Sequence | MEPVREISGKAYPFGRKNVDTDVIIPAHWLKTITREGLGKGAFETVRKEPGNVFEDPAYAGAPIIVAGDNFGCGSSREHAAWALLDMGVKAVIAPSYSDIFSGNAFKNGILAVVLPQEAIDRLMEVARTDPIHIDLEAQTVTTPFQDRFPFEIDPFRKHCLLNGLDEVGLTLARGDAIAGYEAKARASLPFLARGVPAAAASERRTKGRTQGRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 121 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 134 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 141 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 148 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 151 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 159 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 160 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 161 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 162 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 163 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 164 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 165 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 172 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 214 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 218 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 219 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 220 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 221 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 222 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 239 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 245 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 246 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 250 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 255 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 261 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 263 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 264 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 265 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 268 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 269 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 270 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 272 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 273 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 276 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 280 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 281 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 282 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 285 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 286 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 287 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 288 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 289 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 292 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 293 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 294 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 295 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 296 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 297 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 298 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 299 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 300 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 301 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 302 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 303 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 304 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 305 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 306 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 307 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 308 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 309 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0.42 |
| Isolates | 2.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.43 |
| Nodule | 0.14 |
| Rhizoplane | 5.31 |
| Rhizosphere | 70.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207640_10000508 | 3300025981 | Bacteria | 23527 |
| 2 | SwRhRL2b_contig_1292634 | 2162886007 | Bacteria | 2441 |
| 3 | SwRhRL2b_contig_2522198 | 2162886007 | Bacteria | 2682 |
| 4 | SwRhRL2b_contig_2959322 | 2162886007 | Bacteria | 1600 |
| 5 | SwRhRL2b_contig_3703961 | 2162886007 | Bacteria | 12985 |
| 6 | SwRhRL2b_contig_453878 | 2162886007 | Bacteria | 5693 |
| 7 | JGI24736J21556_1000613 | 3300001904 | Bacteria | 6542 |
| 8 | JGI24741J21665_1000366 | 3300001915 | Bacteria | 13487 |
| 9 | JGI24740J21852_10005104 | 3300001979 | Bacteria | 5575 |
| 10 | JGI24739J22299_10005319 | 3300001989 | Bacteria | 4903 |
| 11 | JGI24735J21928_10004932 | 3300002067 | Bacteria | 4449 |
| 12 | JGI24738J21930_10001740 | 3300002075 | Bacteria | 5944 |
| 13 | JGI24751J29686_10025372 | 3300002459 | Bacteria | 1230 |
| 14 | rootH1_10064790 | 3300003316 | Bacteria | 3711 |
| 15 | rootL2_10052919 | 3300003322 | Bacteria | 3842 |
| 16 | Ga0065704_10000451 | 3300005289 | Bacteria | 33782 |
| 17 | Ga0065704_10001612 | 3300005289 | Bacteria | 10250 |
| 18 | Ga0065704_10070364 | 3300005289 | Bacteria | 29548 |
| 19 | Ga0065704_10168680 | 3300005289 | Bacteria | 1305 |
| 20 | Ga0065704_10228265 | 3300005289 | Bacteria | 1037 |
| 21 | Ga0065707_10122578 | 3300005295 | Bacteria | 2085 |
| 22 | Ga0070658_10001814 | 3300005327 | Bacteria | 17966 |
| 23 | Ga0070658_10004690 | 3300005327 | Bacteria | 11113 |
| 24 | Ga0070658_10058237 | 3300005327 | Bacteria | 3144 |
| 25 | Ga0070658_10068992 | 3300005327 | Bacteria | 2891 |
| 26 | Ga0070658_10088083 | 3300005327 | Bacteria | 2556 |
| 27 | Ga0070658_10104461 | 3300005327 | Bacteria | 2344 |
| 28 | Ga0070658_10174659 | 3300005327 | Bacteria | 1806 |
| 29 | Ga0070683_100080914 | 3300005329 | Bacteria | 3040 |
| 30 | Ga0070670_100002377 | 3300005331 | Bacteria | 15504 |
| 31 | Ga0070670_100241386 | 3300005331 | Bacteria | 1573 |
| 32 | Ga0070670_100352254 | 3300005331 | Bacteria | 1293 |
| 33 | Ga0070666_10005044 | 3300005335 | Bacteria | 8076 |
| 34 | Ga0070666_10031513 | 3300005335 | Bacteria | 3499 |
| 35 | Ga0070666_10033483 | 3300005335 | Bacteria | 3400 |
| 36 | Ga0070666_10077356 | 3300005335 | Bacteria | 2271 |
| 37 | Ga0070666_10122419 | 3300005335 | Bacteria | 1804 |
| 38 | Ga0070680_100269627 | 3300005336 | Bacteria | 1441 |
| 39 | Ga0070680_100270503 | 3300005336 | Bacteria | 1439 |
| 40 | Ga0070660_100009577 | 3300005339 | Bacteria | 6822 |
| 41 | Ga0070660_100078162 | 3300005339 | Bacteria | 2594 |
| 42 | Ga0070660_100339548 | 3300005339 | Bacteria | 1236 |
| 43 | Ga0070689_100168652 | 3300005340 | Bacteria | 1773 |
| 44 | Ga0070661_100012214 | 3300005344 | Bacteria | 6005 |
| 45 | Ga0070661_100133526 | 3300005344 | Bacteria | 1866 |
| 46 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 47 | Ga0070668_100000047 | 3300005347 | Bacteria | 76386 |
| 48 | Ga0070668_100016413 | 3300005347 | Bacteria | 5536 |
| 49 | Ga0070668_100057586 | 3300005347 | Bacteria | 3004 |
| 50 | Ga0070668_100062353 | 3300005347 | Bacteria | 2888 |
| 51 | Ga0070668_100074324 | 3300005347 | Bacteria | 2651 |
| 52 | Ga0070669_100000270 | 3300005353 | Bacteria | 42327 |
| 53 | Ga0070669_100001263 | 3300005353 | Bacteria | 18356 |
| 54 | Ga0070669_100160432 | 3300005353 | Bacteria | 1747 |
| 55 | Ga0070669_100583648 | 3300005353 | Bacteria | 935 |
| 56 | Ga0070671_100000116 | 3300005355 | Bacteria | 51559 |
| 57 | Ga0070671_100000470 | 3300005355 | Bacteria | 28105 |
| 58 | Ga0070671_100047816 | 3300005355 | Bacteria | 3556 |
| 59 | Ga0070671_100099591 | 3300005355 | Bacteria | 2438 |
| 60 | Ga0070659_100052995 | 3300005366 | Bacteria | 3192 |
| 61 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 62 | Ga0070667_100000030 | 3300005367 | Bacteria | 178327 |
| 63 | Ga0070667_100000968 | 3300005367 | Bacteria | 26399 |
| 64 | Ga0070667_100001907 | 3300005367 | Bacteria | 18505 |
| 65 | Ga0070667_100018063 | 3300005367 | Bacteria | 5846 |
| 66 | Ga0070667_100109280 | 3300005367 | Bacteria | 2396 |
| 67 | Ga0070663_100002941 | 3300005455 | Bacteria | 9696 |
| 68 | Ga0070663_100189566 | 3300005455 | Bacteria | 1599 |
| 69 | Ga0070662_100002038 | 3300005457 | Bacteria | 12374 |
| 70 | Ga0070662_100011994 | 3300005457 | Bacteria | 5734 |
| 71 | Ga0070662_100051197 | 3300005457 | Bacteria | 2981 |
| 72 | Ga0070681_10049910 | 3300005458 | Bacteria | 4176 |
| 73 | Ga0070681_11163648 | 3300005458 | Bacteria | 693 |
| 74 | Ga0070679_100011467 | 3300005530 | Bacteria | 8446 |
| 75 | Ga0070679_100053739 | 3300005530 | Bacteria | 4009 |
| 76 | Ga0070679_100165965 | 3300005530 | Bacteria | 2181 |
| 77 | Ga0070679_100352225 | 3300005530 | Bacteria | 1420 |
| 78 | Ga0070684_100098100 | 3300005535 | Bacteria | 2614 |
| 79 | Ga0070684_100438914 | 3300005535 | Bacteria | 1206 |
| 80 | Ga0068853_100001009 | 3300005539 | Bacteria | 19829 |
| 81 | Ga0068853_100099224 | 3300005539 | Bacteria | 2573 |
| 82 | Ga0068853_100387868 | 3300005539 | Bacteria | 1305 |
| 83 | Ga0070665_100001031 | 3300005548 | Bacteria | 34955 |
| 84 | Ga0070665_100015813 | 3300005548 | Bacteria | 7578 |
| 85 | Ga0070665_100020215 | 3300005548 | Bacteria | 6685 |
| 86 | Ga0068855_100000608 | 3300005563 | Bacteria | 43919 |
| 87 | Ga0068855_100007299 | 3300005563 | Bacteria | 13385 |
| 88 | Ga0068855_100011899 | 3300005563 | Bacteria | 10520 |
| 89 | Ga0068855_100022037 | 3300005563 | Bacteria | 7637 |
| 90 | Ga0068855_100026547 | 3300005563 | Bacteria | 6929 |
| 91 | Ga0068855_100058341 | 3300005563 | Bacteria | 4521 |
| 92 | Ga0068855_100058989 | 3300005563 | Bacteria | 4492 |
| 93 | Ga0068855_100218364 | 3300005563 | Bacteria | 2139 |
| 94 | Ga0068855_100234877 | 3300005563 | Bacteria | 2051 |
| 95 | Ga0070664_100004940 | 3300005564 | Bacteria | 10682 |
| 96 | Ga0070664_100260354 | 3300005564 | Bacteria | 1561 |
| 97 | Ga0068857_100042135 | 3300005577 | Bacteria | 4049 |
| 98 | Ga0068857_100124356 | 3300005577 | Bacteria | 2324 |
| 99 | Ga0068857_100152991 | 3300005577 | Bacteria | 2091 |
| 100 | Ga0068857_100389558 | 3300005577 | Bacteria | 1295 |
| 101 | Ga0068857_100510486 | 3300005577 | Bacteria | 1129 |
| 102 | Ga0068857_101027922 | 3300005577 | Bacteria | 794 |
| 103 | Ga0068854_100000459 | 3300005578 | Bacteria | 25127 |
| 104 | Ga0068854_100117457 | 3300005578 | Bacteria | 2014 |
| 105 | Ga0068854_100190734 | 3300005578 | Bacteria | 1606 |
| 106 | Ga0068854_100365742 | 3300005578 | Bacteria | 1184 |
| 107 | Ga0068854_100687749 | 3300005578 | Bacteria | 882 |
| 108 | Ga0068856_100019636 | 3300005614 | Bacteria | 6559 |
| 109 | Ga0068856_100020542 | 3300005614 | Bacteria | 6414 |
| 110 | Ga0068856_100025980 | 3300005614 | Bacteria | 5711 |
| 111 | Ga0068856_100160015 | 3300005614 | Bacteria | 2262 |
| 112 | Ga0068856_100213559 | 3300005614 | Bacteria | 1945 |
| 113 | Ga0068852_100000231 | 3300005616 | Bacteria | 37728 |
| 114 | Ga0068852_100000860 | 3300005616 | Bacteria | 20165 |
| 115 | Ga0068852_100331083 | 3300005616 | Bacteria | 1482 |
| 116 | Ga0068859_100312446 | 3300005617 | Bacteria | 1665 |
| 117 | Ga0068859_100359239 | 3300005617 | Bacteria | 1551 |
| 118 | Ga0068864_100003823 | 3300005618 | Bacteria | 12412 |
| 119 | Ga0068861_100274228 | 3300005719 | Bacteria | 1450 |
| 120 | Ga0068863_100000093 | 3300005841 | Bacteria | 96862 |
| 121 | Ga0068863_100000106 | 3300005841 | Bacteria | 90344 |
| 122 | Ga0068863_100004037 | 3300005841 | Bacteria | 14491 |
| 123 | Ga0068863_100044294 | 3300005841 | Bacteria | 4224 |
| 124 | Ga0068858_100001247 | 3300005842 | Bacteria | 26301 |
| 125 | Ga0068858_100034454 | 3300005842 | Bacteria | 4697 |
| 126 | Ga0068858_100039777 | 3300005842 | Bacteria | 4359 |
| 127 | Ga0068858_100056520 | 3300005842 | Bacteria | 3627 |
| 128 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 129 | Ga0068860_100000386 | 3300005843 | Bacteria | 57855 |
| 130 | Ga0068860_100009605 | 3300005843 | Bacteria | 9613 |
| 131 | Ga0068860_100017800 | 3300005843 | Bacteria | 6923 |
| 132 | Ga0068860_100044110 | 3300005843 | Bacteria | 4251 |
| 133 | Ga0068860_100061361 | 3300005843 | Bacteria | 3572 |
| 134 | Ga0068860_100092375 | 3300005843 | Bacteria | 2883 |
| 135 | Ga0068862_100006085 | 3300005844 | Bacteria | 10046 |
| 136 | Ga0068862_100009807 | 3300005844 | Bacteria | 7914 |
| 137 | Ga0068862_100028254 | 3300005844 | Bacteria | 4722 |
| 138 | Ga0068862_100040223 | 3300005844 | Bacteria | 3974 |
| 139 | Ga0068862_100087044 | 3300005844 | Bacteria | 2717 |
| 140 | Ga0068862_100970178 | 3300005844 | Bacteria | 839 |
| 141 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 142 | Ga0075368_10000112 | 3300006042 | Bacteria | 21160 |
| 143 | Ga0075363_100005439 | 3300006048 | Bacteria | 5665 |
| 144 | Ga0075363_100012861 | 3300006048 | Bacteria | 4042 |
| 145 | Ga0075364_10014899 | 3300006051 | Bacteria | 4812 |
| 146 | Ga0075364_10033952 | 3300006051 | Bacteria | 3288 |
| 147 | Ga0075432_10006371 | 3300006058 | Bacteria | 4014 |
| 148 | Ga0075362_10000003 | 3300006177 | Bacteria | 171099 |
| 149 | Ga0075362_10000129 | 3300006177 | Bacteria | 20881 |
| 150 | Ga0075362_10265687 | 3300006177 | Bacteria | 846 |
| 151 | Ga0075367_10010792 | 3300006178 | Bacteria | 4812 |
| 152 | Ga0075369_10005083 | 3300006186 | Bacteria | 4906 |
| 153 | Ga0075369_10019731 | 3300006186 | Bacteria | 2755 |
| 154 | Ga0075366_10000006 | 3300006195 | Bacteria | 106522 |
| 155 | Ga0075366_10009002 | 3300006195 | Bacteria | 5569 |
| 156 | Ga0075366_10039961 | 3300006195 | Bacteria | 2773 |
| 157 | Ga0075366_10197964 | 3300006195 | Bacteria | 1221 |
| 158 | Ga0075366_10247315 | 3300006195 | Bacteria | 1088 |
| 159 | Ga0075366_10295921 | 3300006195 | Bacteria | 990 |
| 160 | Ga0075366_10308350 | 3300006195 | Bacteria | 969 |
| 161 | Ga0075370_10000008 | 3300006353 | Bacteria | 97966 |
| 162 | Ga0075370_10010420 | 3300006353 | Bacteria | 4861 |
| 163 | Ga0075370_10035362 | 3300006353 | Bacteria | 2804 |
| 164 | Ga0075370_10084534 | 3300006353 | Bacteria | 1826 |
| 165 | Ga0075370_10098533 | 3300006353 | Bacteria | 1690 |
| 166 | Ga0068871_100589168 | 3300006358 | Bacteria | 1010 |
| 167 | Ga0075436_100376067 | 3300006914 | Bacteria | 1027 |
| 168 | Ga0097620_100312443 | 3300006931 | Bacteria | 1665 |
| 169 | Ga0097620_100359245 | 3300006931 | Bacteria | 1551 |
| 170 | Ga0105251_10000231 | 3300009011 | Bacteria | 56229 |
| 171 | Ga0105251_10016214 | 3300009011 | Bacteria | 4036 |
| 172 | Ga0105251_10049746 | 3300009011 | Bacteria | 2005 |
| 173 | Ga0105240_10012161 | 3300009093 | Bacteria | 11916 |
| 174 | Ga0105240_10012850 | 3300009093 | Bacteria | 11536 |
| 175 | Ga0105240_10630314 | 3300009093 | Bacteria | 1177 |
| 176 | Ga0105240_11253654 | 3300009093 | Bacteria | 783 |
| 177 | Ga0105240_11360643 | 3300009093 | Bacteria | 747 |
| 178 | Ga0111539_10609168 | 3300009094 | Bacteria | 1272 |
| 179 | Ga0105247_10075248 | 3300009101 | Bacteria | 2118 |
| 180 | Ga0105247_10102854 | 3300009101 | Bacteria | 1828 |
| 181 | Ga0105247_10128849 | 3300009101 | Bacteria | 1647 |
| 182 | Ga0114129_11521487 | 3300009147 | Bacteria | 822 |
| 183 | Ga0105243_10449731 | 3300009148 | Bacteria | 1208 |
| 184 | Ga0105241_10038453 | 3300009174 | Bacteria | 3607 |
| 185 | Ga0105241_10084481 | 3300009174 | Bacteria | 2492 |
| 186 | Ga0105248_10013347 | 3300009177 | Bacteria | 9041 |
| 187 | Ga0105248_10106004 | 3300009177 | Bacteria | 3169 |
| 188 | Ga0105248_10158703 | 3300009177 | Bacteria | 2552 |
| 189 | Ga0105248_10206862 | 3300009177 | Bacteria | 2211 |
| 190 | Ga0105248_10255623 | 3300009177 | Bacteria | 1972 |
| 191 | Ga0105248_10608341 | 3300009177 | Bacteria | 1233 |
| 192 | Ga0105248_11472165 | 3300009177 | Bacteria | 771 |
| 193 | Ga0105237_10059493 | 3300009545 | Bacteria | 3822 |
| 194 | Ga0105238_10071650 | 3300009551 | Bacteria | 3463 |
| 195 | Ga0105238_10369475 | 3300009551 | Bacteria | 1425 |
| 196 | Ga0105238_10486038 | 3300009551 | Bacteria | 1234 |
| 197 | Ga0105249_10166648 | 3300009553 | Bacteria | 2133 |
| 198 | Ga0105249_10291555 | 3300009553 | Bacteria | 1633 |
| 199 | Ga0105249_10648172 | 3300009553 | Bacteria | 1114 |
| 200 | Ga0105246_10000657 | 3300011119 | Bacteria | 19352 |
| 201 | Ga0157326_1000423 | 3300012513 | Bacteria | 5017 |
| 202 | Ga0157373_10005891 | 3300013100 | Bacteria | 9170 |
| 203 | Ga0157373_10032124 | 3300013100 | Bacteria | 3779 |
| 204 | Ga0157373_10058315 | 3300013100 | Bacteria | 2737 |
| 205 | Ga0157371_10005585 | 3300013102 | Bacteria | 10564 |
| 206 | Ga0157371_10049399 | 3300013102 | Bacteria | 2988 |
| 207 | Ga0157371_10319288 | 3300013102 | Bacteria | 1127 |
| 208 | Ga0157370_10008601 | 3300013104 | Bacteria | 10992 |
| 209 | Ga0157370_10057965 | 3300013104 | Bacteria | 3681 |
| 210 | Ga0157370_10134122 | 3300013104 | Bacteria | 2309 |
| 211 | Ga0157369_10011267 | 3300013105 | Bacteria | 10158 |
| 212 | Ga0157378_10067728 | 3300013297 | Bacteria | 3200 |
| 213 | Ga0163162_10013864 | 3300013306 | Bacteria | 7875 |
| 214 | Ga0163162_10021491 | 3300013306 | Bacteria | 6357 |
| 215 | Ga0163162_10065959 | 3300013306 | Bacteria | 3668 |
| 216 | Ga0163162_10194674 | 3300013306 | Bacteria | 2156 |
| 217 | Ga0157372_10175214 | 3300013307 | Bacteria | 2482 |
| 218 | Ga0157372_11511544 | 3300013307 | Bacteria | 773 |
| 219 | Ga0157375_10105105 | 3300013308 | Bacteria | 2913 |
| 220 | Ga0157375_10599022 | 3300013308 | Bacteria | 1261 |
| 221 | Ga0163161_10001762 | 3300017792 | Bacteria | 15801 |
| 222 | Ga0213875_10009905 | 3300021388 | Bacteria | 4804 |
| 223 | Ga0209147_103605 | 3300025229 | Bacteria | 2915 |
| 224 | Ga0209050_1000687 | 3300025298 | Bacteria | 50814 |
| 225 | Ga0207696_1005600 | 3300025711 | Bacteria | 5186 |
| 226 | Ga0207713_1000951 | 3300025735 | Bacteria | 25905 |
| 227 | Ga0207682_10097959 | 3300025893 | Bacteria | 1279 |
| 228 | Ga0207680_10061223 | 3300025903 | Bacteria | 2295 |
| 229 | Ga0207680_10062260 | 3300025903 | Bacteria | 2279 |
| 230 | Ga0207680_10093912 | 3300025903 | Bacteria | 1914 |
| 231 | Ga0207680_10151143 | 3300025903 | Bacteria | 1548 |
| 232 | Ga0207680_10198014 | 3300025903 | Bacteria | 1367 |
| 233 | Ga0207647_10019938 | 3300025904 | Bacteria | 4502 |
| 234 | Ga0207647_10041942 | 3300025904 | Bacteria | 2874 |
| 235 | Ga0207647_10058954 | 3300025904 | Bacteria | 2350 |
| 236 | Ga0207647_10191283 | 3300025904 | Bacteria | 1186 |
| 237 | Ga0207647_10445746 | 3300025904 | Bacteria | 726 |
| 238 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 239 | Ga0207705_10005310 | 3300025909 | Bacteria | 9638 |
| 240 | Ga0207705_10032428 | 3300025909 | Bacteria | 3733 |
| 241 | Ga0207705_10059755 | 3300025909 | Bacteria | 2752 |
| 242 | Ga0207705_10068657 | 3300025909 | Bacteria | 2567 |
| 243 | Ga0207705_10462588 | 3300025909 | Bacteria | 984 |
| 244 | Ga0207707_10076073 | 3300025912 | Bacteria | 2929 |
| 245 | Ga0207695_10019301 | 3300025913 | Bacteria | 7851 |
| 246 | Ga0207695_10031555 | 3300025913 | Bacteria | 5808 |
| 247 | Ga0207660_10352336 | 3300025917 | Bacteria | 1180 |
| 248 | Ga0207660_10595192 | 3300025917 | Bacteria | 901 |
| 249 | Ga0207657_10000408 | 3300025919 | Bacteria | 45400 |
| 250 | Ga0207657_10048996 | 3300025919 | Bacteria | 3685 |
| 251 | Ga0207657_10054446 | 3300025919 | Bacteria | 3460 |
| 252 | Ga0207657_10241990 | 3300025919 | Bacteria | 1440 |
| 253 | Ga0207649_10024515 | 3300025920 | Bacteria | 3507 |
| 254 | Ga0207649_10115630 | 3300025920 | Bacteria | 1800 |
| 255 | Ga0207649_10549250 | 3300025920 | Bacteria | 884 |
| 256 | Ga0207652_10007853 | 3300025921 | Bacteria | 8565 |
| 257 | Ga0207652_10063222 | 3300025921 | Bacteria | 3200 |
| 258 | Ga0207652_10316211 | 3300025921 | Bacteria | 1409 |
| 259 | Ga0207681_10000049 | 3300025923 | Bacteria | 120296 |
| 260 | Ga0207681_10000774 | 3300025923 | Bacteria | 21043 |
| 261 | Ga0207681_10002968 | 3300025923 | Bacteria | 10674 |
| 262 | Ga0207681_10052128 | 3300025923 | Bacteria | 2774 |
| 263 | Ga0207681_10122960 | 3300025923 | Bacteria | 1906 |
| 264 | Ga0207694_10068861 | 3300025924 | Bacteria | 2764 |
| 265 | Ga0207694_10254042 | 3300025924 | Bacteria | 1439 |
| 266 | Ga0207650_10006404 | 3300025925 | Bacteria | 8018 |
| 267 | Ga0207650_10255242 | 3300025925 | Bacteria | 1421 |
| 268 | Ga0207650_10308447 | 3300025925 | Bacteria | 1294 |
| 269 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 270 | Ga0207644_10000191 | 3300025931 | Bacteria | 43874 |
| 271 | Ga0207644_10002323 | 3300025931 | Bacteria | 12296 |
| 272 | Ga0207644_10003057 | 3300025931 | Bacteria | 10769 |
| 273 | Ga0207690_10021761 | 3300025932 | Bacteria | 3980 |
| 274 | Ga0207690_10099368 | 3300025932 | Bacteria | 2075 |
| 275 | Ga0207690_10227135 | 3300025932 | Bacteria | 1431 |
| 276 | Ga0207706_10008254 | 3300025933 | Bacteria | 9609 |
| 277 | Ga0207706_10285577 | 3300025933 | Bacteria | 1439 |
| 278 | Ga0207709_10255433 | 3300025935 | Bacteria | 1282 |
| 279 | Ga0207711_10013496 | 3300025941 | Bacteria | 6783 |
| 280 | Ga0207711_10104536 | 3300025941 | Bacteria | 2510 |
| 281 | Ga0207711_10482985 | 3300025941 | Bacteria | 1154 |
| 282 | Ga0207711_10781261 | 3300025941 | Bacteria | 890 |
| 283 | Ga0207661_10039869 | 3300025944 | Bacteria | 3689 |
| 284 | Ga0207679_10004188 | 3300025945 | Bacteria | 8961 |
| 285 | Ga0207679_10140360 | 3300025945 | Bacteria | 1952 |
| 286 | Ga0207679_10177919 | 3300025945 | Bacteria | 1757 |
| 287 | Ga0207667_10000916 | 3300025949 | Bacteria | 37599 |
| 288 | Ga0207667_10003563 | 3300025949 | Bacteria | 19243 |
| 289 | Ga0207667_10005019 | 3300025949 | Bacteria | 16179 |
| 290 | Ga0207667_10011650 | 3300025949 | Bacteria | 10205 |
| 291 | Ga0207667_10023043 | 3300025949 | Bacteria | 6862 |
| 292 | Ga0207667_10070651 | 3300025949 | Bacteria | 3633 |
| 293 | Ga0207667_10078696 | 3300025949 | Bacteria | 3417 |
| 294 | Ga0207667_10293911 | 3300025949 | Bacteria | 1660 |
| 295 | Ga0207667_10479567 | 3300025949 | Bacteria | 1263 |
| 296 | Ga0207712_10200819 | 3300025961 | Bacteria | 1581 |
| 297 | Ga0207712_10563243 | 3300025961 | Bacteria | 981 |
| 298 | Ga0207712_10679367 | 3300025961 | Bacteria | 897 |
| 299 | Ga0207668_10000066 | 3300025972 | Bacteria | 84452 |
| 300 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 301 | Ga0207668_10003398 | 3300025972 | Bacteria | 9332 |
| 302 | Ga0207668_10011848 | 3300025972 | Bacteria | 5315 |
| 303 | Ga0207640_10077559 | 3300025981 | Bacteria | 2259 |
| 304 | Ga0207640_10216524 | 3300025981 | Bacteria | 1463 |
| 305 | Ga0207640_10366525 | 3300025981 | Bacteria | 1163 |
| 306 | Ga0207640_10462303 | 3300025981 | Bacteria | 1048 |
| 307 | Ga0207640_10863151 | 3300025981 | Bacteria | 788 |
| 308 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 309 | Ga0207658_10000019 | 3300025986 | Bacteria | 206335 |
| 310 | Ga0207658_10000344 | 3300025986 | Bacteria | 46055 |
| 311 | Ga0207658_10007159 | 3300025986 | Bacteria | 7602 |
| 312 | Ga0207658_10012173 | 3300025986 | Bacteria | 5868 |
| 313 | Ga0207658_10265642 | 3300025986 | Bacteria | 1464 |
| 314 | Ga0207703_10004946 | 3300026035 | Bacteria | 10819 |
| 315 | Ga0207703_10005351 | 3300026035 | Bacteria | 10337 |
| 316 | Ga0207703_10029046 | 3300026035 | Bacteria | 4362 |
| 317 | Ga0207703_10052344 | 3300026035 | Bacteria | 3315 |
| 318 | Ga0207639_10000213 | 3300026041 | Bacteria | 43227 |
| 319 | Ga0207639_10228780 | 3300026041 | Bacteria | 1610 |
| 320 | Ga0207639_10396697 | 3300026041 | Bacteria | 1242 |
| 321 | Ga0207639_10900539 | 3300026041 | Bacteria | 827 |
| 322 | Ga0207678_10000857 | 3300026067 | Bacteria | 27922 |
| 323 | Ga0207678_10029324 | 3300026067 | Bacteria | 4802 |
| 324 | Ga0207678_10046385 | 3300026067 | Bacteria | 3757 |
| 325 | Ga0207702_10019109 | 3300026078 | Bacteria | 5670 |
| 326 | Ga0207702_10114050 | 3300026078 | Bacteria | 2408 |
| 327 | Ga0207702_10136446 | 3300026078 | Bacteria | 2214 |
| 328 | Ga0207702_10147935 | 3300026078 | Bacteria | 2134 |
| 329 | Ga0207702_10162965 | 3300026078 | Bacteria | 2038 |
| 330 | Ga0207702_11128766 | 3300026078 | Bacteria | 778 |
| 331 | Ga0207702_11480326 | 3300026078 | Bacteria | 672 |
| 332 | Ga0207641_10000029 | 3300026088 | Bacteria | 229383 |
| 333 | Ga0207641_10000733 | 3300026088 | Bacteria | 35188 |
| 334 | Ga0207641_10004505 | 3300026088 | Bacteria | 12048 |
| 335 | Ga0207641_10014797 | 3300026088 | Bacteria | 6396 |
| 336 | Ga0207641_10046323 | 3300026088 | Bacteria | 3665 |
| 337 | Ga0207641_10066769 | 3300026088 | Bacteria | 3079 |
| 338 | Ga0207676_10002656 | 3300026095 | Bacteria | 12704 |
| 339 | Ga0207674_10015484 | 3300026116 | Bacteria | 8376 |
| 340 | Ga0207674_10089864 | 3300026116 | Bacteria | 3064 |
| 341 | Ga0207674_10168712 | 3300026116 | Bacteria | 2142 |
| 342 | Ga0207674_10271001 | 3300026116 | Bacteria | 1645 |
| 343 | Ga0207674_10280938 | 3300026116 | Bacteria | 1613 |
| 344 | Ga0207674_10350347 | 3300026116 | Bacteria | 1428 |
| 345 | Ga0207674_10576732 | 3300026116 | Bacteria | 1087 |
| 346 | Ga0207674_11256772 | 3300026116 | Bacteria | 710 |
| 347 | Ga0207674_11256977 | 3300026116 | Bacteria | 710 |
| 348 | Ga0207675_100230090 | 3300026118 | Bacteria | 1788 |
| 349 | Ga0207698_10000058 | 3300026142 | Bacteria | 78048 |
| 350 | Ga0207698_10001537 | 3300026142 | Bacteria | 13446 |
| 351 | Ga0207698_10248152 | 3300026142 | Bacteria | 1627 |
| 352 | Ga0207698_10256471 | 3300026142 | Bacteria | 1604 |
| 353 | Ga0209281_1017439 | 3300027111 | Bacteria | 1455 |
| 354 | Ga0209971_1005246 | 3300027682 | Bacteria | 3079 |
| 355 | Ga0209813_10000051 | 3300027866 | Bacteria | 47545 |
| 356 | Ga0209813_10001612 | 3300027866 | Bacteria | 5084 |
| 357 | Ga0209974_10006613 | 3300027876 | Bacteria | 4035 |
| 358 | Ga0207428_10045887 | 3300027907 | Bacteria | 3516 |
| 359 | Ga0268266_10000534 | 3300028379 | Bacteria | 53027 |
| 360 | Ga0268266_10005024 | 3300028379 | Bacteria | 12491 |
| 361 | Ga0268266_10012690 | 3300028379 | Bacteria | 7281 |
| 362 | Ga0268266_10207401 | 3300028379 | Bacteria | 1796 |
| 363 | Ga0268266_10211526 | 3300028379 | Bacteria | 1779 |
| 364 | Ga0268265_10004726 | 3300028380 | Bacteria | 9397 |
| 365 | Ga0268265_10017233 | 3300028380 | Bacteria | 4981 |
| 366 | Ga0268265_10030798 | 3300028380 | Bacteria | 3868 |
| 367 | Ga0268265_10101330 | 3300028380 | Bacteria | 2326 |
| 368 | Ga0268265_10941817 | 3300028380 | Bacteria | 850 |
| 369 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 370 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 371 | Ga0268264_10002127 | 3300028381 | Bacteria | 17671 |
| 372 | Ga0268264_10007794 | 3300028381 | Bacteria | 8916 |
| 373 | Ga0268264_10012577 | 3300028381 | Bacteria | 6971 |
| 374 | Ga0268264_10209613 | 3300028381 | Bacteria | 1788 |
| 375 | Ga0316177_1123653 | 3300030731 | Bacteria | 1210 |
| 376 | Ga0265331_10031572 | 3300031250 | Bacteria | 2631 |
| 377 | Ga0265327_10063076 | 3300031251 | Bacteria | 1883 |
| 378 | Ga0307408_100051500 | 3300031548 | Bacteria | 2965 |
| 379 | Ga0307408_100079920 | 3300031548 | Bacteria | 2441 |
| 380 | Ga0307508_10036453 | 3300031616 | Bacteria | 4428 |
| 381 | Ga0316579_10045560 | 3300031691 | Bacteria | 2045 |
| 382 | Ga0307516_10361442 | 3300031730 | Bacteria | 1116 |
| 383 | Ga0307405_10055116 | 3300031731 | Bacteria | 2486 |
| 384 | Ga0307405_10168342 | 3300031731 | Bacteria | 1560 |
| 385 | Ga0307405_10269605 | 3300031731 | Bacteria | 1276 |
| 386 | Ga0316577_10308894 | 3300031733 | Bacteria | 896 |
| 387 | Ga0307413_10022613 | 3300031824 | Bacteria | 3392 |
| 388 | Ga0307413_10029790 | 3300031824 | Bacteria | 3059 |
| 389 | Ga0307413_10377759 | 3300031824 | Bacteria | 1103 |
| 390 | Ga0307413_10550058 | 3300031824 | Bacteria | 936 |
| 391 | Ga0307410_10027090 | 3300031852 | Bacteria | 3618 |
| 392 | Ga0307410_10057187 | 3300031852 | Bacteria | 2655 |
| 393 | Ga0307410_10123972 | 3300031852 | Bacteria | 1888 |
| 394 | Ga0307410_10255916 | 3300031852 | Bacteria | 1363 |
| 395 | Ga0307406_10065764 | 3300031901 | Bacteria | 2357 |
| 396 | Ga0307406_10309264 | 3300031901 | Bacteria | 1217 |
| 397 | Ga0307407_10018883 | 3300031903 | Bacteria | 3499 |
| 398 | Ga0307412_10014022 | 3300031911 | Bacteria | 4719 |
| 399 | Ga0307412_10024442 | 3300031911 | Bacteria | 3729 |
| 400 | Ga0307412_10238668 | 3300031911 | Bacteria | 1404 |
| 401 | Ga0307409_100303216 | 3300031995 | Bacteria | 1487 |
| 402 | Ga0307409_100700197 | 3300031995 | Bacteria | 1012 |
| 403 | Ga0307416_100108924 | 3300032002 | Bacteria | 2435 |
| 404 | Ga0307416_100242591 | 3300032002 | Bacteria | 1747 |
| 405 | Ga0307416_100667863 | 3300032002 | Bacteria | 1125 |
| 406 | Ga0307414_10001522 | 3300032004 | Bacteria | 12055 |
| 407 | Ga0307414_10030520 | 3300032004 | Bacteria | 3522 |
| 408 | Ga0307414_10037651 | 3300032004 | Bacteria | 3241 |
| 409 | Ga0307414_10039730 | 3300032004 | Bacteria | 3172 |
| 410 | Ga0307414_10070490 | 3300032004 | Bacteria | 2517 |
| 411 | Ga0307414_10362671 | 3300032004 | Bacteria | 1247 |
| 412 | Ga0307411_10009250 | 3300032005 | Bacteria | 5166 |
| 413 | Ga0307415_100158880 | 3300032126 | Bacteria | 1750 |
| 414 | Ga0307415_100591328 | 3300032126 | Bacteria | 986 |
| 415 | Ga0307510_10360589 | 3300033180 | Bacteria | 902 |
| 416 | Ga0316574_0317313 | 3300035398 | Bacteria | 990 |
| 417 | Ga0373931_0192545 | 3300035691 | Bacteria | 1214 |
| 418 | Ga0316582_0025496 | 3300036647 | Bacteria | 3551 |
| 419 | Ga0316584_0245187 | 3300036712 | Bacteria | 1310 |
| 420 | Ga0395900_0039730 | 3300037418 | Bacteria | 4847 |
| 421 | Ga0395898_0049299 | 3300037466 | Bacteria | 4126 |
| 422 | Ga0395898_0058144 | 3300037466 | Bacteria | 3765 |
| 423 | Ga0395905_0002718 | 3300037471 | Bacteria | 19383 |
| 424 | Ga0395905_0039036 | 3300037471 | Bacteria | 4454 |
| 425 | Ga0395905_0067070 | 3300037471 | Bacteria | 3361 |
| 426 | Ga0395905_0784689 | 3300037471 | Bacteria | 856 |
| 427 | Ga0395901_0006671 | 3300038443 | Bacteria | 11667 |
| 428 | Ga0436365_1372253 | 3300039437 | Bacteria | 817 |
| 429 | Ga0436361_0526202 | 3300039447 | Bacteria | 1319 |
| 430 | Ga0439443_011393 | 3300042003 | Bacteria | 1302 |
| 431 | Ga0439448_0001220 | 3300042005 | Bacteria | 6563 |
| 432 | Ga0439455_0011720 | 3300042012 | Bacteria | 1954 |
| 433 | Ga0439458_0000228 | 3300042157 | Bacteria | 13324 |
| 434 | Ga0439435_0031974 | 3300042436 | Bacteria | 1434 |
| 435 | Ga0466969_0070923 | 3300044656 | Bacteria | 1676 |
| 436 | Ga0466972_0001262 | 3300044658 | Bacteria | 12200 |
| 437 | Ga0466973_0185653 | 3300044659 | Bacteria | 1574 |
| 438 | Ga0466966_0036278 | 3300044684 | Bacteria | 3184 |
| 439 | Ga0466961_0009663 | 3300044693 | Bacteria | 6140 |
| 440 | Ga0453684_0248635 | 3300044712 | Bacteria | 2043 |
| 441 | Ga0466970_0001327 | 3300044765 | Bacteria | 11960 |
| 442 | Ga0466959_0064794 | 3300045049 | Bacteria | 2652 |
| 443 | Ga0466958_0055504 | 3300045836 | Bacteria | 2404 |
| 444 | Ga0495627_000090 | 3300046453 | Bacteria | 109622 |
| 445 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 446 | Ga0495650_0000818 | 3300046471 | Bacteria | 37910 |
| 447 | Ga0495650_0001027 | 3300046471 | Bacteria | 31380 |
| 448 | Ga0495584_0174675 | 3300046491 | Bacteria | 1092 |
| 449 | Ga0495596_0000220 | 3300046500 | Bacteria | 39671 |
| 450 | Ga0495596_0004156 | 3300046500 | Bacteria | 7110 |
| 451 | Ga0495583_0000498 | 3300046506 | Bacteria | 56923 |
| 452 | Ga0495606_0024355 | 3300046507 | Bacteria | 4364 |
| 453 | Ga0495606_0026454 | 3300046507 | Bacteria | 4136 |
| 454 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 455 | Ga0495610_0000136 | 3300046512 | Bacteria | 82060 |
| 456 | Ga0495610_0004021 | 3300046512 | Bacteria | 11090 |
| 457 | Ga0495620_0007587 | 3300046515 | Bacteria | 5880 |
| 458 | Ga0495620_0092010 | 3300046515 | Bacteria | 1216 |
| 459 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 460 | Ga0495632_0000511 | 3300046519 | Bacteria | 36529 |
| 461 | Ga0495632_0038356 | 3300046519 | Bacteria | 2426 |
| 462 | Ga0495632_0073150 | 3300046519 | Bacteria | 1644 |
| 463 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 464 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 465 | Ga0495643_0000107 | 3300046522 | Bacteria | 138292 |
| 466 | Ga0495643_0011542 | 3300046522 | Bacteria | 5374 |
| 467 | Ga0495643_0052554 | 3300046522 | Bacteria | 2187 |
| 468 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 469 | Ga0495648_0045945 | 3300046524 | Bacteria | 2712 |
| 470 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 471 | Ga0495654_0060569 | 3300046530 | Bacteria | 1819 |
| 472 | Ga0495654_0066259 | 3300046530 | Bacteria | 1722 |
| 473 | Ga0495654_0081551 | 3300046530 | Bacteria | 1516 |
| 474 | Ga0495609_0131639 | 3300046538 | Bacteria | 1071 |
| 475 | Ga0495621_0008361 | 3300046539 | Bacteria | 3101 |
| 476 | Ga0495633_0000190 | 3300046558 | Bacteria | 79967 |
| 477 | Ga0495633_0002635 | 3300046558 | Bacteria | 12531 |
| 478 | Ga0495633_0024761 | 3300046558 | Bacteria | 2962 |
| 479 | Ga0495633_0072661 | 3300046558 | Bacteria | 1604 |
| 480 | Ga0495668_0006416 | 3300046616 | Bacteria | 7706 |
| 481 | Ga0495668_0105921 | 3300046616 | Bacteria | 1538 |
| 482 | Ga0495668_0152375 | 3300046616 | Bacteria | 1266 |
| 483 | Ga0495625_0001717 | 3300046660 | Bacteria | 25448 |
| 484 | Ga0495625_0045065 | 3300046660 | Bacteria | 3190 |
| 485 | Ga0495625_0051483 | 3300046660 | Bacteria | 2952 |
| 486 | Ga0495670_0058113 | 3300046691 | Bacteria | 1942 |
| 487 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 488 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 489 | Ga0495671_0108591 | 3300046692 | Bacteria | 1355 |
| 490 | Ga0495671_0312460 | 3300046692 | Bacteria | 755 |
| 491 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 492 | Ga0495681_0000048 | 3300047470 | Bacteria | 110216 |
| 493 | Ga0495681_0008268 | 3300047470 | Bacteria | 6539 |
| 494 | Ga0495681_0155602 | 3300047470 | Bacteria | 956 |
| 495 | Ga0495615_0000082 | 3300048090 | Bacteria | 29015 |
| 496 | Ga0495615_0013434 | 3300048090 | Bacteria | 1710 |
| 497 | Ga0495626_0000214 | 3300048091 | Bacteria | 69009 |
| 498 | Ga0496100_0010729 | 3300048903 | Bacteria | 5194 |
| 499 | Ga0496100_0182282 | 3300048903 | Bacteria | 1519 |
| 500 | Ga0496101_0016904 | 3300048904 | Bacteria | 4939 |
| 501 | Ga0496101_0020976 | 3300048904 | Bacteria | 4483 |
| 502 | Ga0496101_0111668 | 3300048904 | Bacteria | 2058 |
| 503 | Ga0496102_0023742 | 3300048905 | Bacteria | 5449 |
| 504 | Ga0496102_0025237 | 3300048905 | Bacteria | 5288 |
| 505 | Ga0496102_0301177 | 3300048905 | Bacteria | 1511 |
| 506 | Ga0496103_0000021 | 3300048906 | Bacteria | 229062 |
| 507 | Ga0496103_0008988 | 3300048906 | Bacteria | 5921 |
| 508 | Ga0496103_0009373 | 3300048906 | Bacteria | 5799 |
| 509 | Ga0496104_0000128 | 3300048907 | Bacteria | 70094 |
| 510 | Ga0496104_0041285 | 3300048907 | Bacteria | 4325 |
| 511 | Ga0496104_0050407 | 3300048907 | Bacteria | 3928 |
| 512 | Ga0496105_0000064 | 3300048908 | Bacteria | 83935 |
| 513 | Ga0496105_0000870 | 3300048908 | Bacteria | 20664 |
| 514 | Ga0496105_0214103 | 3300048908 | Bacteria | 1570 |
| 515 | Ga0496106_0003329 | 3300048909 | Bacteria | 11976 |
| 516 | Ga0496107_0025431 | 3300048910 | Bacteria | 4191 |
| 517 | Ga0496107_0045342 | 3300048910 | Bacteria | 3162 |
| 518 | Ga0496108_0000682 | 3300048911 | Bacteria | 26248 |
| 519 | Ga0496108_0094660 | 3300048911 | Bacteria | 2542 |
| 520 | Ga0496108_0156410 | 3300048911 | Bacteria | 1969 |
| 521 | Ga0496109_0116418 | 3300048912 | Bacteria | 2488 |
| 522 | Ga0496109_0148593 | 3300048912 | Bacteria | 2193 |
| 523 | Ga0496110_0124785 | 3300048913 | Bacteria | 2322 |
| 524 | Ga0496110_0140371 | 3300048913 | Bacteria | 2184 |
| 525 | Ga0496110_0840346 | 3300048913 | Bacteria | 823 |
| 526 | Ga0496111_0051408 | 3300048914 | Bacteria | 2975 |
| 527 | Ga0496111_0061685 | 3300048914 | Bacteria | 2718 |
| 528 | Ga0496111_0350411 | 3300048914 | Bacteria | 1093 |
| 529 | Ga0496112_0016599 | 3300048915 | Bacteria | 6903 |
| 530 | Ga0496112_0219258 | 3300048915 | Bacteria | 1858 |
| 531 | Ga0496113_0000044 | 3300048916 | Bacteria | 51909 |
| 532 | Ga0496113_0006116 | 3300048916 | Bacteria | 7596 |
| 533 | Ga0496113_0140747 | 3300048916 | Bacteria | 1898 |
| 534 | Ga0496114_0023435 | 3300048917 | Bacteria | 5038 |
| 535 | Ga0496114_0074946 | 3300048917 | Bacteria | 2849 |
| 536 | Ga0496116_0000062 | 3300048919 | Bacteria | 271104 |
| 537 | Ga0496116_0021417 | 3300048919 | Bacteria | 4878 |
| 538 | Ga0496116_0025195 | 3300048919 | Bacteria | 4377 |
| 539 | Ga0496117_0015462 | 3300048920 | Bacteria | 6505 |
| 540 | Ga0496117_0055578 | 3300048920 | Bacteria | 2765 |
| 541 | Ga0496117_0090067 | 3300048920 | Bacteria | 1978 |
| 542 | Ga0496117_0260111 | 3300048920 | Bacteria | 941 |
| 543 | Ga0496118_0004786 | 3300048921 | Bacteria | 15813 |
| 544 | Ga0496118_0057773 | 3300048921 | Bacteria | 2905 |
| 545 | Ga0496118_0076829 | 3300048921 | Bacteria | 2372 |
| 546 | Ga0496118_0081041 | 3300048921 | Bacteria | 2281 |
| 547 | Ga0496119_0000077 | 3300048922 | Bacteria | 143108 |
| 548 | Ga0496119_0048407 | 3300048922 | Bacteria | 2636 |
| 549 | Ga0496119_0088899 | 3300048922 | Bacteria | 1760 |
| 550 | Ga0496120_0001801 | 3300048923 | Bacteria | 24031 |
| 551 | Ga0496120_0028089 | 3300048923 | Bacteria | 3452 |
| 552 | Ga0496120_0081703 | 3300048923 | Bacteria | 1748 |
| 553 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 554 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 555 | Ga0496121_0003051 | 3300048924 | Bacteria | 24286 |
| 556 | Ga0496121_0003197 | 3300048924 | Bacteria | 23595 |
| 557 | Ga0496121_0010881 | 3300048924 | Bacteria | 10170 |
| 558 | Ga0496121_0010937 | 3300048924 | Bacteria | 10135 |
| 559 | Ga0496121_0115314 | 3300048924 | Bacteria | 2040 |
| 560 | Ga0496121_0170721 | 3300048924 | Bacteria | 1580 |
| 561 | Ga0496122_0003556 | 3300048925 | Bacteria | 20365 |
| 562 | Ga0496122_0006114 | 3300048925 | Bacteria | 14015 |
| 563 | Ga0496122_0006671 | 3300048925 | Bacteria | 13150 |
| 564 | Ga0496122_0008730 | 3300048925 | Bacteria | 10847 |
| 565 | Ga0496122_0027860 | 3300048925 | Bacteria | 4816 |
| 566 | Ga0496122_0039577 | 3300048925 | Bacteria | 3758 |
| 567 | Ga0496123_0000545 | 3300048926 | Bacteria | 64687 |
| 568 | Ga0496123_0001103 | 3300048926 | Bacteria | 40498 |
| 569 | Ga0496123_0006936 | 3300048926 | Bacteria | 10822 |
| 570 | Ga0496123_0016815 | 3300048926 | Bacteria | 5914 |
| 571 | Ga0496123_0037493 | 3300048926 | Bacteria | 3421 |
| 572 | Ga0496124_0002439 | 3300048927 | Bacteria | 24366 |
| 573 | Ga0496124_0004900 | 3300048927 | Bacteria | 15386 |
| 574 | Ga0496124_0023873 | 3300048927 | Bacteria | 5571 |
| 575 | Ga0496124_0033927 | 3300048927 | Bacteria | 4485 |
| 576 | Ga0496124_0066946 | 3300048927 | Bacteria | 2990 |
| 577 | Ga0496124_0278609 | 3300048927 | Bacteria | 1220 |
| 578 | Ga0496124_0416328 | 3300048927 | Bacteria | 928 |
| 579 | Ga0496125_0001135 | 3300048928 | Bacteria | 40511 |
| 580 | Ga0496125_0006988 | 3300048928 | Bacteria | 12081 |
| 581 | Ga0496125_0034343 | 3300048928 | Bacteria | 4472 |
| 582 | Ga0496125_0040809 | 3300048928 | Bacteria | 3975 |
| 583 | Ga0496125_0071024 | 3300048928 | Bacteria | 2722 |
| 584 | Ga0496125_0072386 | 3300048928 | Bacteria | 2685 |
| 585 | Ga0496125_0343244 | 3300048928 | Bacteria | 895 |
| 586 | Ga0496126_0000175 | 3300048929 | Bacteria | 146389 |
| 587 | Ga0496126_0004477 | 3300048929 | Bacteria | 16680 |
| 588 | Ga0496126_0006838 | 3300048929 | Bacteria | 12646 |
| 589 | Ga0496126_0027682 | 3300048929 | Bacteria | 5410 |
| 590 | Ga0496126_0036199 | 3300048929 | Bacteria | 4617 |
| 591 | Ga0496126_0449597 | 3300048929 | Bacteria | 1037 |
| 592 | Ga0496126_0537723 | 3300048929 | Bacteria | 929 |
| 593 | Ga0501306_019489 | 3300049127 | Bacteria | 936 |
| 594 | Ga0501335_000615 | 3300049551 | Bacteria | 2383 |
| 595 | Ga0501033_0135077 | 3300049570 | Bacteria | 1785 |
| 596 | Ga0501034_0325286 | 3300049571 | Bacteria | 1470 |
| 597 | Ga0501036_0256093 | 3300049572 | Bacteria | 1466 |
| 598 | Ga0501037_0100364 | 3300049573 | Bacteria | 2090 |
| 599 | Ga0501037_0325958 | 3300049573 | Bacteria | 1063 |
| 600 | Ga0501038_0120378 | 3300049574 | Bacteria | 2166 |
| 601 | Ga0501039_0088013 | 3300049575 | Bacteria | 2420 |
| 602 | Ga0501039_0219519 | 3300049575 | Bacteria | 1495 |
| 603 | Ga0501042_0040621 | 3300049578 | Bacteria | 3307 |
| 604 | Ga0501046_0030454 | 3300049580 | Bacteria | 4380 |
| 605 | Ga0501047_0000731 | 3300049581 | Bacteria | 34159 |
| 606 | Ga0501047_0264008 | 3300049581 | Bacteria | 1569 |
| 607 | Ga0501048_0144900 | 3300049582 | Bacteria | 1680 |
| 608 | Ga0501070_0358628 | 3300049586 | Bacteria | 1183 |
| 609 | Ga0501198_007724 | 3300049649 | Bacteria | 1551 |
| 610 | Ga0501208_047227 | 3300049655 | Bacteria | 812 |
| 611 | Ga0501223_000039 | 3300049663 | Bacteria | 45537 |
| 612 | Ga0501224_017610 | 3300049664 | Bacteria | 1062 |
| 613 | Ga0501246_001398 | 3300049676 | Bacteria | 1843 |
| 614 | Ga0501249_000213 | 3300049679 | Bacteria | 17777 |
| 615 | Ga0501225_0000010 | 3300049705 | Bacteria | 82395 |
| 616 | Ga0501241_034035 | 3300049758 | Bacteria | 970 |
| 617 | Ga0501264_012766 | 3300049761 | Bacteria | 827 |
| 618 | Ga0501269_003897 | 3300049766 | Bacteria | 1795 |
| 619 | Ga0501035_0574428 | 3300049822 | Bacteria | 921 |
| 620 | Ga0501044_0001187 | 3300049823 | Bacteria | 30876 |
| 621 | Ga0501044_0134255 | 3300049823 | Bacteria | 2467 |
| 622 | Ga0501044_0260664 | 3300049823 | Bacteria | 1672 |
| 623 | Ga0501044_0588351 | 3300049823 | Bacteria | 1007 |
| 624 | Ga0501204_000430 | 3300049850 | Bacteria | 3639 |
| 625 | nmdc:mga03683_13_c1 | 3300050489 | Bacteria | 110533 |
| 626 | nmdc:mga03683_236473_c1 | 3300050489 | Bacteria | 846 |
| 627 | nmdc:mga03683_344_c1 | 3300050489 | Bacteria | 13557 |
| 628 | nmdc:mga03n38_8067_c1 | 3300050490 | Bacteria | 3758 |
| 629 | nmdc:mga00v17_132284_c1 | 3300050491 | Bacteria | 1595 |
| 630 | nmdc:mga00v17_25514_c1 | 3300050491 | Bacteria | 3436 |
| 631 | nmdc:mga00v17_3742_c1 | 3300050491 | Bacteria | 7856 |
| 632 | nmdc:mga00v17_87602_c1 | 3300050491 | Bacteria | 1952 |
| 633 | nmdc:mga0yw44_143367_c1 | 3300050492 | Bacteria | 1554 |
| 634 | nmdc:mga0k408_161453_c1 | 3300050493 | Bacteria | 1335 |
| 635 | nmdc:mga0k408_416031_c1 | 3300050493 | Bacteria | 799 |
| 636 | nmdc:mga0k408_7432_c1 | 3300050493 | Bacteria | 5849 |
| 637 | nmdc:mga0k408_8_c1 | 3300050493 | Bacteria | 161211 |
| 638 | nmdc:mga0k408_92421_c1 | 3300050493 | Bacteria | 1778 |
| 639 | nmdc:mga06z11_17_c1 | 3300050494 | Bacteria | 79602 |
| 640 | nmdc:mga06z11_84_c1 | 3300050494 | Bacteria | 40055 |
| 641 | nmdc:mga04h51_146_c1 | 3300050495 | Bacteria | 20585 |
| 642 | nmdc:mga04h51_74798_c1 | 3300050495 | Bacteria | 1191 |
| 643 | nmdc:mga07m45_114488_c1 | 3300050496 | Bacteria | 1555 |
| 644 | nmdc:mga07m45_129095_c1 | 3300050496 | Bacteria | 1462 |
| 645 | nmdc:mga07m45_20_c1 | 3300050496 | Bacteria | 126269 |
| 646 | nmdc:mga07m45_282292_c1 | 3300050496 | Bacteria | 966 |
| 647 | nmdc:mga07m45_377971_c1 | 3300050496 | Bacteria | 823 |
| 648 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 649 | nmdc:mga07m45_963_c2 | 3300050496 | Bacteria | 2639 |
| 650 | nmdc:mga05p37_1065596_c1 | 3300050507 | Bacteria | 851 |
| 651 | nmdc:mga0sz30_24209_c1 | 3300050516 | Bacteria | 2476 |
| 652 | nmdc:mga0sz30_46_c1 | 3300050516 | Bacteria | 44412 |
| 653 | nmdc:mga0sz30_4821_c1 | 3300050516 | Bacteria | 4910 |
| 654 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 655 | Ga0500643_006099 | 3300053087 | Bacteria | 5095 |
| 656 | Ga0500643_020706 | 3300053087 | Bacteria | 2143 |
| 657 | Ga0500566_0131840 | 3300053094 | Bacteria | 1336 |
| 658 | Ga0500641_0073101 | 3300053096 | Bacteria | 1446 |
| 659 | Ga0500556_0000222 | 3300053104 | Bacteria | 45971 |
| 660 | Ga0500557_059563 | 3300053105 | Bacteria | 1239 |
| 661 | Ga0500592_001156 | 3300053116 | Bacteria | 4293 |
| 662 | Ga0500595_101841 | 3300053119 | Bacteria | 822 |
| 663 | Ga0500607_000055 | 3300053121 | Bacteria | 78780 |
| 664 | Ga0500607_000844 | 3300053121 | Bacteria | 29501 |
| 665 | Ga0500608_000087 | 3300053122 | Bacteria | 37903 |
| 666 | Ga0500608_007769 | 3300053122 | Bacteria | 4458 |
| 667 | Ga0500614_090803 | 3300053123 | Bacteria | 867 |
| 668 | Ga0500618_010477 | 3300053125 | Bacteria | 2487 |
| 669 | Ga0500642_0000011 | 3300053130 | Bacteria | 215963 |
| 670 | Ga0500559_0003805 | 3300053136 | Bacteria | 7307 |
| 671 | Ga0500559_0008073 | 3300053136 | Bacteria | 4632 |
| 672 | Ga0500564_000168 | 3300053138 | Bacteria | 17386 |
| 673 | Ga0500568_0046730 | 3300053139 | Bacteria | 1717 |
| 674 | Ga0500573_0229092 | 3300053140 | Bacteria | 970 |
| 675 | Ga0500577_0070252 | 3300053142 | Bacteria | 1372 |
| 676 | Ga0500590_000131 | 3300053148 | Bacteria | 20923 |
| 677 | Ga0500590_065735 | 3300053148 | Bacteria | 1812 |
| 678 | Ga0500604_0081425 | 3300053151 | Bacteria | 1046 |
| 679 | Ga0500616_0006078 | 3300053153 | Bacteria | 8008 |
| 680 | Ga0500622_0001994 | 3300053156 | Bacteria | 15306 |
| 681 | Ga0500622_0025695 | 3300053156 | Bacteria | 3111 |
| 682 | Ga0500624_000106 | 3300053157 | Bacteria | 40037 |
| 683 | Ga0500630_098590 | 3300053159 | Bacteria | 1336 |
| 684 | Ga0500636_0005955 | 3300053177 | Bacteria | 6988 |
| 685 | Ga0500637_0017519 | 3300053178 | Bacteria | 3836 |
| 686 | Ga0500567_000445 | 3300053723 | Bacteria | 13930 |
| 687 | Ga0500570_004079 | 3300053724 | Bacteria | 7637 |
| 688 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 689 | Ga0500645_000417 | 3300053730 | Bacteria | 29425 |
| 690 | Ga0500645_004197 | 3300053730 | Bacteria | 5605 |
| 691 | Ga0500645_006930 | 3300053730 | Bacteria | 3999 |
| 692 | Ga0500645_017913 | 3300053730 | Bacteria | 2217 |
| 693 | Ga0500645_056045 | 3300053730 | Bacteria | 1144 |
| 694 | Ga0500645_062632 | 3300053730 | Bacteria | 1074 |
| 695 | Ga0587090_002320 | 3300059510 | Bacteria | 2079 |
| 696 | Ga0501082_0612062 | 3300060353 | Bacteria | 953 |
| 697 | 2511130327 | 2510917021 | Bacteria | 5705459 |
| 698 | 2643950202 | 2643221588 | Bacteria | 3692460 |
| 699 | 2644036773 | 2643221605 | Bacteria | 4772303 |
| 700 | 2738709788 | 2738541275 | Bacteria | 4830863 |
| 701 | 2738848213 | 2738541301 | Bacteria | 4834102 |
| 702 | 2738863942 | 2738541304 | Bacteria | 4833665 |
| 703 | 2739296460 | 2738543022 | Bacteria | 4835059 |
| 704 | 2739358138 | 2738543033 | Bacteria | 4833336 |
| 705 | 2739649378 | 2739367664 | Bacteria | 4114334 |
| 706 | 2740027851 | 2739367865 | Bacteria | 4114482 |
| 707 | 2778125109 | 2775507255 | Bacteria | 3945731 |
| 708 | 2819552827 | 2818991438 | Bacteria | 5793701 |
| 709 | 2896186914 | 2896184354 | Bacteria | 3258548 |
| 710 | 2896254677 | 2896253425 | Bacteria | 3418029 |
| 711 | 2919141737 | 2919138771 | Bacteria | 5281312 |
| 712 | 2928101345 | 2928100450 | Bacteria | 4837635 |
| 713 | 2928960244 | 2928959182 | Bacteria | 4725774 |
| 714 | 3000866463 | 3000865235 | Bacteria | 3106258 |
| 715 | 8054303050 | 8054302542 | Bacteria | 5698134 |
| 716 | Ga0207640_10000508 | |||
| 717 | SwRhRL2b_contig_1292634 | |||
| 718 | SwRhRL2b_contig_2522198 | |||
| 719 | SwRhRL2b_contig_2959322 | |||
| 720 | SwRhRL2b_contig_3703961 | |||
| 721 | SwRhRL2b_contig_453878 | |||
| 722 | JGI24736J21556_1000613 | |||
| 723 | JGI24741J21665_1000366 | |||
| 724 | JGI24740J21852_10005104 | |||
| 725 | JGI24739J22299_10005319 | |||
| 726 | JGI24735J21928_10004932 | |||
| 727 | JGI24738J21930_10001740 | |||
| 728 | JGI24751J29686_10025372 | |||
| 729 | rootH1_10064790 | |||
| 730 | rootL2_10052919 | |||
| 731 | Ga0065704_10000451 | |||
| 732 | Ga0065704_10001612 | |||
| 733 | Ga0065704_10070364 | |||
| 734 | Ga0065704_10168680 | |||
| 735 | Ga0065704_10228265 | |||
| 736 | Ga0065707_10122578 | |||
| 737 | Ga0070658_10001814 | |||
| 738 | Ga0070658_10004690 | |||
| 739 | Ga0070658_10058237 | |||
| 740 | Ga0070658_10068992 | |||
| 741 | Ga0070658_10088083 | |||
| 742 | Ga0070658_10104461 | |||
| 743 | Ga0070658_10174659 | |||
| 744 | Ga0070683_100080914 | |||
| 745 | Ga0070670_100002377 | |||
| 746 | Ga0070670_100241386 | |||
| 747 | Ga0070670_100352254 | |||
| 748 | Ga0070666_10005044 | |||
| 749 | Ga0070666_10031513 | |||
| 750 | Ga0070666_10033483 | |||
| 751 | Ga0070666_10077356 | |||
| 752 | Ga0070666_10122419 | |||
| 753 | Ga0070680_100269627 | |||
| 754 | Ga0070680_100270503 | |||
| 755 | Ga0070660_100009577 | |||
| 756 | Ga0070660_100078162 | |||
| 757 | Ga0070660_100339548 | |||
| 758 | Ga0070689_100168652 | |||
| 759 | Ga0070661_100012214 | |||
| 760 | Ga0070661_100133526 | |||
| 761 | Ga0070668_100000026 | |||
| 762 | Ga0070668_100000047 | |||
| 763 | Ga0070668_100016413 | |||
| 764 | Ga0070668_100057586 | |||
| 765 | Ga0070668_100062353 | |||
| 766 | Ga0070668_100074324 | |||
| 767 | Ga0070669_100000270 | |||
| 768 | Ga0070669_100001263 | |||
| 769 | Ga0070669_100160432 | |||
| 770 | Ga0070669_100583648 | |||
| 771 | Ga0070671_100000116 | |||
| 772 | Ga0070671_100000470 | |||
| 773 | Ga0070671_100047816 | |||
| 774 | Ga0070671_100099591 | |||
| 775 | Ga0070659_100052995 | |||
| 776 | Ga0070667_100000019 | |||
| 777 | Ga0070667_100000030 | |||
| 778 | Ga0070667_100000968 | |||
| 779 | Ga0070667_100001907 | |||
| 780 | Ga0070667_100018063 | |||
| 781 | Ga0070667_100109280 | |||
| 782 | Ga0070663_100002941 | |||
| 783 | Ga0070663_100189566 | |||
| 784 | Ga0070662_100002038 | |||
| 785 | Ga0070662_100011994 | |||
| 786 | Ga0070662_100051197 | |||
| 787 | Ga0070681_10049910 | |||
| 788 | Ga0070681_11163648 | |||
| 789 | Ga0070679_100011467 | |||
| 790 | Ga0070679_100053739 | |||
| 791 | Ga0070679_100165965 | |||
| 792 | Ga0070679_100352225 | |||
| 793 | Ga0070684_100098100 | |||
| 794 | Ga0070684_100438914 | |||
| 795 | Ga0068853_100001009 | |||
| 796 | Ga0068853_100099224 | |||
| 797 | Ga0068853_100387868 | |||
| 798 | Ga0070665_100001031 | |||
| 799 | Ga0070665_100015813 | |||
| 800 | Ga0070665_100020215 | |||
| 801 | Ga0068855_100000608 | |||
| 802 | Ga0068855_100007299 | |||
| 803 | Ga0068855_100011899 | |||
| 804 | Ga0068855_100022037 | |||
| 805 | Ga0068855_100026547 | |||
| 806 | Ga0068855_100058341 | |||
| 807 | Ga0068855_100058989 | |||
| 808 | Ga0068855_100218364 | |||
| 809 | Ga0068855_100234877 | |||
| 810 | Ga0070664_100004940 | |||
| 811 | Ga0070664_100260354 | |||
| 812 | Ga0068857_100042135 | |||
| 813 | Ga0068857_100124356 | |||
| 814 | Ga0068857_100152991 | |||
| 815 | Ga0068857_100389558 | |||
| 816 | Ga0068857_100510486 | |||
| 817 | Ga0068857_101027922 | |||
| 818 | Ga0068854_100000459 | |||
| 819 | Ga0068854_100117457 | |||
| 820 | Ga0068854_100190734 | |||
| 821 | Ga0068854_100365742 | |||
| 822 | Ga0068854_100687749 | |||
| 823 | Ga0068856_100019636 | |||
| 824 | Ga0068856_100020542 | |||
| 825 | Ga0068856_100025980 | |||
| 826 | Ga0068856_100160015 | |||
| 827 | Ga0068856_100213559 | |||
| 828 | Ga0068852_100000231 | |||
| 829 | Ga0068852_100000860 | |||
| 830 | Ga0068852_100331083 | |||
| 831 | Ga0068859_100312446 | |||
| 832 | Ga0068859_100359239 | |||
| 833 | Ga0068864_100003823 | |||
| 834 | Ga0068861_100274228 | |||
| 835 | Ga0068863_100000093 | |||
| 836 | Ga0068863_100000106 | |||
| 837 | Ga0068863_100004037 | |||
| 838 | Ga0068863_100044294 | |||
| 839 | Ga0068858_100001247 | |||
| 840 | Ga0068858_100034454 | |||
| 841 | Ga0068858_100039777 | |||
| 842 | Ga0068858_100056520 | |||
| 843 | Ga0068860_100000036 | |||
| 844 | Ga0068860_100000386 | |||
| 845 | Ga0068860_100009605 | |||
| 846 | Ga0068860_100017800 | |||
| 847 | Ga0068860_100044110 | |||
| 848 | Ga0068860_100061361 | |||
| 849 | Ga0068860_100092375 | |||
| 850 | Ga0068862_100006085 | |||
| 851 | Ga0068862_100009807 | |||
| 852 | Ga0068862_100028254 | |||
| 853 | Ga0068862_100040223 | |||
| 854 | Ga0068862_100087044 | |||
| 855 | Ga0068862_100970178 | |||
| 856 | Ga0081455_10000255 | |||
| 857 | Ga0075368_10000112 | |||
| 858 | Ga0075363_100005439 | |||
| 859 | Ga0075363_100012861 | |||
| 860 | Ga0075364_10014899 | |||
| 861 | Ga0075364_10033952 | |||
| 862 | Ga0075432_10006371 | |||
| 863 | Ga0075362_10000003 | |||
| 864 | Ga0075362_10000129 | |||
| 865 | Ga0075362_10265687 | |||
| 866 | Ga0075367_10010792 | |||
| 867 | Ga0075369_10005083 | |||
| 868 | Ga0075369_10019731 | |||
| 869 | Ga0075366_10000006 | |||
| 870 | Ga0075366_10009002 | |||
| 871 | Ga0075366_10039961 | |||
| 872 | Ga0075366_10197964 | |||
| 873 | Ga0075366_10247315 | |||
| 874 | Ga0075366_10295921 | |||
| 875 | Ga0075366_10308350 | |||
| 876 | Ga0075370_10000008 | |||
| 877 | Ga0075370_10010420 | |||
| 878 | Ga0075370_10035362 | |||
| 879 | Ga0075370_10084534 | |||
| 880 | Ga0075370_10098533 | |||
| 881 | Ga0068871_100589168 | |||
| 882 | Ga0075436_100376067 | |||
| 883 | Ga0097620_100312443 | |||
| 884 | Ga0097620_100359245 | |||
| 885 | Ga0105251_10000231 | |||
| 886 | Ga0105251_10016214 | |||
| 887 | Ga0105251_10049746 | |||
| 888 | Ga0105240_10012161 | |||
| 889 | Ga0105240_10012850 | |||
| 890 | Ga0105240_10630314 | |||
| 891 | Ga0105240_11253654 | |||
| 892 | Ga0105240_11360643 | |||
| 893 | Ga0111539_10609168 | |||
| 894 | Ga0105247_10075248 | |||
| 895 | Ga0105247_10102854 | |||
| 896 | Ga0105247_10128849 | |||
| 897 | Ga0114129_11521487 | |||
| 898 | Ga0105243_10449731 | |||
| 899 | Ga0105241_10038453 | |||
| 900 | Ga0105241_10084481 | |||
| 901 | Ga0105248_10013347 | |||
| 902 | Ga0105248_10106004 | |||
| 903 | Ga0105248_10158703 | |||
| 904 | Ga0105248_10206862 | |||
| 905 | Ga0105248_10255623 | |||
| 906 | Ga0105248_10608341 | |||
| 907 | Ga0105248_11472165 | |||
| 908 | Ga0105237_10059493 | |||
| 909 | Ga0105238_10071650 | |||
| 910 | Ga0105238_10369475 | |||
| 911 | Ga0105238_10486038 | |||
| 912 | Ga0105249_10166648 | |||
| 913 | Ga0105249_10291555 | |||
| 914 | Ga0105249_10648172 | |||
| 915 | Ga0105246_10000657 | |||
| 916 | Ga0157326_1000423 | |||
| 917 | Ga0157373_10005891 | |||
| 918 | Ga0157373_10032124 | |||
| 919 | Ga0157373_10058315 | |||
| 920 | Ga0157371_10005585 | |||
| 921 | Ga0157371_10049399 | |||
| 922 | Ga0157371_10319288 | |||
| 923 | Ga0157370_10008601 | |||
| 924 | Ga0157370_10057965 | |||
| 925 | Ga0157370_10134122 | |||
| 926 | Ga0157369_10011267 | |||
| 927 | Ga0157378_10067728 | |||
| 928 | Ga0163162_10013864 | |||
| 929 | Ga0163162_10021491 | |||
| 930 | Ga0163162_10065959 | |||
| 931 | Ga0163162_10194674 | |||
| 932 | Ga0157372_10175214 | |||
| 933 | Ga0157372_11511544 | |||
| 934 | Ga0157375_10105105 | |||
| 935 | Ga0157375_10599022 | |||
| 936 | Ga0163161_10001762 | |||
| 937 | Ga0213875_10009905 | |||
| 938 | Ga0209147_103605 | |||
| 939 | Ga0209050_1000687 | |||
| 940 | Ga0207696_1005600 | |||
| 941 | Ga0207713_1000951 | |||
| 942 | Ga0207682_10097959 | |||
| 943 | Ga0207680_10061223 | |||
| 944 | Ga0207680_10062260 | |||
| 945 | Ga0207680_10093912 | |||
| 946 | Ga0207680_10151143 | |||
| 947 | Ga0207680_10198014 | |||
| 948 | Ga0207647_10019938 | |||
| 949 | Ga0207647_10041942 | |||
| 950 | Ga0207647_10058954 | |||
| 951 | Ga0207647_10191283 | |||
| 952 | Ga0207647_10445746 | |||
| 953 | Ga0207705_10000004 | |||
| 954 | Ga0207705_10005310 | |||
| 955 | Ga0207705_10032428 | |||
| 956 | Ga0207705_10059755 | |||
| 957 | Ga0207705_10068657 | |||
| 958 | Ga0207705_10462588 | |||
| 959 | Ga0207707_10076073 | |||
| 960 | Ga0207695_10019301 | |||
| 961 | Ga0207695_10031555 | |||
| 962 | Ga0207660_10352336 | |||
| 963 | Ga0207660_10595192 | |||
| 964 | Ga0207657_10000408 | |||
| 965 | Ga0207657_10048996 | |||
| 966 | Ga0207657_10054446 | |||
| 967 | Ga0207657_10241990 | |||
| 968 | Ga0207649_10024515 | |||
| 969 | Ga0207649_10115630 | |||
| 970 | Ga0207649_10549250 | |||
| 971 | Ga0207652_10007853 | |||
| 972 | Ga0207652_10063222 | |||
| 973 | Ga0207652_10316211 | |||
| 974 | Ga0207681_10000049 | |||
| 975 | Ga0207681_10000774 | |||
| 976 | Ga0207681_10002968 | |||
| 977 | Ga0207681_10052128 | |||
| 978 | Ga0207681_10122960 | |||
| 979 | Ga0207694_10068861 | |||
| 980 | Ga0207694_10254042 | |||
| 981 | Ga0207650_10006404 | |||
| 982 | Ga0207650_10255242 | |||
| 983 | Ga0207650_10308447 | |||
| 984 | Ga0207644_10000067 | |||
| 985 | Ga0207644_10000191 | |||
| 986 | Ga0207644_10002323 | |||
| 987 | Ga0207644_10003057 | |||
| 988 | Ga0207690_10021761 | |||
| 989 | Ga0207690_10099368 | |||
| 990 | Ga0207690_10227135 | |||
| 991 | Ga0207706_10008254 | |||
| 992 | Ga0207706_10285577 | |||
| 993 | Ga0207709_10255433 | |||
| 994 | Ga0207711_10013496 | |||
| 995 | Ga0207711_10104536 | |||
| 996 | Ga0207711_10482985 | |||
| 997 | Ga0207711_10781261 | |||
| 998 | Ga0207661_10039869 | |||
| 999 | Ga0207679_10004188 | |||
| 1000 | Ga0207679_10140360 | |||
| 1001 | Ga0207679_10177919 | |||
| 1002 | Ga0207667_10000916 | |||
| 1003 | Ga0207667_10003563 | |||
| 1004 | Ga0207667_10005019 | |||
| 1005 | Ga0207667_10011650 | |||
| 1006 | Ga0207667_10023043 | |||
| 1007 | Ga0207667_10070651 | |||
| 1008 | Ga0207667_10078696 | |||
| 1009 | Ga0207667_10293911 | |||
| 1010 | Ga0207667_10479567 | |||
| 1011 | Ga0207712_10200819 | |||
| 1012 | Ga0207712_10563243 | |||
| 1013 | Ga0207712_10679367 | |||
| 1014 | Ga0207668_10000066 | |||
| 1015 | Ga0207668_10000081 | |||
| 1016 | Ga0207668_10003398 | |||
| 1017 | Ga0207668_10011848 | |||
| 1018 | Ga0207640_10077559 | |||
| 1019 | Ga0207640_10216524 | |||
| 1020 | Ga0207640_10366525 | |||
| 1021 | Ga0207640_10462303 | |||
| 1022 | Ga0207640_10863151 | |||
| 1023 | Ga0207658_10000002 | |||
| 1024 | Ga0207658_10000019 | |||
| 1025 | Ga0207658_10000344 | |||
| 1026 | Ga0207658_10007159 | |||
| 1027 | Ga0207658_10012173 | |||
| 1028 | Ga0207658_10265642 | |||
| 1029 | Ga0207703_10004946 | |||
| 1030 | Ga0207703_10005351 | |||
| 1031 | Ga0207703_10029046 | |||
| 1032 | Ga0207703_10052344 | |||
| 1033 | Ga0207639_10000213 | |||
| 1034 | Ga0207639_10228780 | |||
| 1035 | Ga0207639_10396697 | |||
| 1036 | Ga0207639_10900539 | |||
| 1037 | Ga0207678_10000857 | |||
| 1038 | Ga0207678_10029324 | |||
| 1039 | Ga0207678_10046385 | |||
| 1040 | Ga0207702_10019109 | |||
| 1041 | Ga0207702_10114050 | |||
| 1042 | Ga0207702_10136446 | |||
| 1043 | Ga0207702_10147935 | |||
| 1044 | Ga0207702_10162965 | |||
| 1045 | Ga0207702_11128766 | |||
| 1046 | Ga0207702_11480326 | |||
| 1047 | Ga0207641_10000029 | |||
| 1048 | Ga0207641_10000733 | |||
| 1049 | Ga0207641_10004505 | |||
| 1050 | Ga0207641_10014797 | |||
| 1051 | Ga0207641_10046323 | |||
| 1052 | Ga0207641_10066769 | |||
| 1053 | Ga0207676_10002656 | |||
| 1054 | Ga0207674_10015484 | |||
| 1055 | Ga0207674_10089864 | |||
| 1056 | Ga0207674_10168712 | |||
| 1057 | Ga0207674_10271001 | |||
| 1058 | Ga0207674_10280938 | |||
| 1059 | Ga0207674_10350347 | |||
| 1060 | Ga0207674_10576732 | |||
| 1061 | Ga0207674_11256772 | |||
| 1062 | Ga0207674_11256977 | |||
| 1063 | Ga0207675_100230090 | |||
| 1064 | Ga0207698_10000058 | |||
| 1065 | Ga0207698_10001537 | |||
| 1066 | Ga0207698_10248152 | |||
| 1067 | Ga0207698_10256471 | |||
| 1068 | Ga0209281_1017439 | |||
| 1069 | Ga0209971_1005246 | |||
| 1070 | Ga0209813_10000051 | |||
| 1071 | Ga0209813_10001612 | |||
| 1072 | Ga0209974_10006613 | |||
| 1073 | Ga0207428_10045887 | |||
| 1074 | Ga0268266_10000534 | |||
| 1075 | Ga0268266_10005024 | |||
| 1076 | Ga0268266_10012690 | |||
| 1077 | Ga0268266_10207401 | |||
| 1078 | Ga0268266_10211526 | |||
| 1079 | Ga0268265_10004726 | |||
| 1080 | Ga0268265_10017233 | |||
| 1081 | Ga0268265_10030798 | |||
| 1082 | Ga0268265_10101330 | |||
| 1083 | Ga0268265_10941817 | |||
| 1084 | Ga0268264_10000001 | |||
| 1085 | Ga0268264_10000040 | |||
| 1086 | Ga0268264_10002127 | |||
| 1087 | Ga0268264_10007794 | |||
| 1088 | Ga0268264_10012577 | |||
| 1089 | Ga0268264_10209613 | |||
| 1090 | Ga0316177_1123653 | |||
| 1091 | Ga0265331_10031572 | |||
| 1092 | Ga0265327_10063076 | |||
| 1093 | Ga0307408_100051500 | |||
| 1094 | Ga0307408_100079920 | |||
| 1095 | Ga0307508_10036453 | |||
| 1096 | Ga0316579_10045560 | |||
| 1097 | Ga0307516_10361442 | |||
| 1098 | Ga0307405_10055116 | |||
| 1099 | Ga0307405_10168342 | |||
| 1100 | Ga0307405_10269605 | |||
| 1101 | Ga0316577_10308894 | |||
| 1102 | Ga0307413_10022613 | |||
| 1103 | Ga0307413_10029790 | |||
| 1104 | Ga0307413_10377759 | |||
| 1105 | Ga0307413_10550058 | |||
| 1106 | Ga0307410_10027090 | |||
| 1107 | Ga0307410_10057187 | |||
| 1108 | Ga0307410_10123972 | |||
| 1109 | Ga0307410_10255916 | |||
| 1110 | Ga0307406_10065764 | |||
| 1111 | Ga0307406_10309264 | |||
| 1112 | Ga0307407_10018883 | |||
| 1113 | Ga0307412_10014022 | |||
| 1114 | Ga0307412_10024442 | |||
| 1115 | Ga0307412_10238668 | |||
| 1116 | Ga0307409_100303216 | |||
| 1117 | Ga0307409_100700197 | |||
| 1118 | Ga0307416_100108924 | |||
| 1119 | Ga0307416_100242591 | |||
| 1120 | Ga0307416_100667863 | |||
| 1121 | Ga0307414_10001522 | |||
| 1122 | Ga0307414_10030520 | |||
| 1123 | Ga0307414_10037651 | |||
| 1124 | Ga0307414_10039730 | |||
| 1125 | Ga0307414_10070490 | |||
| 1126 | Ga0307414_10362671 | |||
| 1127 | Ga0307411_10009250 | |||
| 1128 | Ga0307415_100158880 | |||
| 1129 | Ga0307415_100591328 | |||
| 1130 | Ga0307510_10360589 | |||
| 1131 | Ga0316574_0317313 | |||
| 1132 | Ga0373931_0192545 | |||
| 1133 | Ga0316582_0025496 | |||
| 1134 | Ga0316584_0245187 | |||
| 1135 | Ga0395900_0039730 | |||
| 1136 | Ga0395898_0049299 | |||
| 1137 | Ga0395898_0058144 | |||
| 1138 | Ga0395905_0002718 | |||
| 1139 | Ga0395905_0039036 | |||
| 1140 | Ga0395905_0067070 | |||
| 1141 | Ga0395905_0784689 | |||
| 1142 | Ga0395901_0006671 | |||
| 1143 | Ga0436365_1372253 | |||
| 1144 | Ga0436361_0526202 | |||
| 1145 | Ga0439443_011393 | |||
| 1146 | Ga0439448_0001220 | |||
| 1147 | Ga0439455_0011720 | |||
| 1148 | Ga0439458_0000228 | |||
| 1149 | Ga0439435_0031974 | |||
| 1150 | Ga0466969_0070923 | |||
| 1151 | Ga0466972_0001262 | |||
| 1152 | Ga0466973_0185653 | |||
| 1153 | Ga0466966_0036278 | |||
| 1154 | Ga0466961_0009663 | |||
| 1155 | Ga0453684_0248635 | |||
| 1156 | Ga0466970_0001327 | |||
| 1157 | Ga0466959_0064794 | |||
| 1158 | Ga0466958_0055504 | |||
| 1159 | Ga0495627_000090 | |||
| 1160 | Ga0495638_0000051 | |||
| 1161 | Ga0495650_0000818 | |||
| 1162 | Ga0495650_0001027 | |||
| 1163 | Ga0495584_0174675 | |||
| 1164 | Ga0495596_0000220 | |||
| 1165 | Ga0495596_0004156 | |||
| 1166 | Ga0495583_0000498 | |||
| 1167 | Ga0495606_0024355 | |||
| 1168 | Ga0495606_0026454 | |||
| 1169 | Ga0495610_0000015 | |||
| 1170 | Ga0495610_0000136 | |||
| 1171 | Ga0495610_0004021 | |||
| 1172 | Ga0495620_0007587 | |||
| 1173 | Ga0495620_0092010 | |||
| 1174 | Ga0495632_0000006 | |||
| 1175 | Ga0495632_0000511 | |||
| 1176 | Ga0495632_0038356 | |||
| 1177 | Ga0495632_0073150 | |||
| 1178 | Ga0495637_0000784 | |||
| 1179 | Ga0495643_0000021 | |||
| 1180 | Ga0495643_0000107 | |||
| 1181 | Ga0495643_0011542 | |||
| 1182 | Ga0495643_0052554 | |||
| 1183 | Ga0495648_0000032 | |||
| 1184 | Ga0495648_0045945 | |||
| 1185 | Ga0495663_0000008 | |||
| 1186 | Ga0495654_0060569 | |||
| 1187 | Ga0495654_0066259 | |||
| 1188 | Ga0495654_0081551 | |||
| 1189 | Ga0495609_0131639 | |||
| 1190 | Ga0495621_0008361 | |||
| 1191 | Ga0495633_0000190 | |||
| 1192 | Ga0495633_0002635 | |||
| 1193 | Ga0495633_0024761 | |||
| 1194 | Ga0495633_0072661 | |||
| 1195 | Ga0495668_0006416 | |||
| 1196 | Ga0495668_0105921 | |||
| 1197 | Ga0495668_0152375 | |||
| 1198 | Ga0495625_0001717 | |||
| 1199 | Ga0495625_0045065 | |||
| 1200 | Ga0495625_0051483 | |||
| 1201 | Ga0495670_0058113 | |||
| 1202 | Ga0495671_0000017 | |||
| 1203 | Ga0495671_0000020 | |||
| 1204 | Ga0495671_0108591 | |||
| 1205 | Ga0495671_0312460 | |||
| 1206 | Ga0495673_0000076 | |||
| 1207 | Ga0495681_0000048 | |||
| 1208 | Ga0495681_0008268 | |||
| 1209 | Ga0495681_0155602 | |||
| 1210 | Ga0495615_0000082 | |||
| 1211 | Ga0495615_0013434 | |||
| 1212 | Ga0495626_0000214 | |||
| 1213 | Ga0496100_0010729 | |||
| 1214 | Ga0496100_0182282 | |||
| 1215 | Ga0496101_0016904 | |||
| 1216 | Ga0496101_0020976 | |||
| 1217 | Ga0496101_0111668 | |||
| 1218 | Ga0496102_0023742 | |||
| 1219 | Ga0496102_0025237 | |||
| 1220 | Ga0496102_0301177 | |||
| 1221 | Ga0496103_0000021 | |||
| 1222 | Ga0496103_0008988 | |||
| 1223 | Ga0496103_0009373 | |||
| 1224 | Ga0496104_0000128 | |||
| 1225 | Ga0496104_0041285 | |||
| 1226 | Ga0496104_0050407 | |||
| 1227 | Ga0496105_0000064 | |||
| 1228 | Ga0496105_0000870 | |||
| 1229 | Ga0496105_0214103 | |||
| 1230 | Ga0496106_0003329 | |||
| 1231 | Ga0496107_0025431 | |||
| 1232 | Ga0496107_0045342 | |||
| 1233 | Ga0496108_0000682 | |||
| 1234 | Ga0496108_0094660 | |||
| 1235 | Ga0496108_0156410 | |||
| 1236 | Ga0496109_0116418 | |||
| 1237 | Ga0496109_0148593 | |||
| 1238 | Ga0496110_0124785 | |||
| 1239 | Ga0496110_0140371 | |||
| 1240 | Ga0496110_0840346 | |||
| 1241 | Ga0496111_0051408 | |||
| 1242 | Ga0496111_0061685 | |||
| 1243 | Ga0496111_0350411 | |||
| 1244 | Ga0496112_0016599 | |||
| 1245 | Ga0496112_0219258 | |||
| 1246 | Ga0496113_0000044 | |||
| 1247 | Ga0496113_0006116 | |||
| 1248 | Ga0496113_0140747 | |||
| 1249 | Ga0496114_0023435 | |||
| 1250 | Ga0496114_0074946 | |||
| 1251 | Ga0496116_0000062 | |||
| 1252 | Ga0496116_0021417 | |||
| 1253 | Ga0496116_0025195 | |||
| 1254 | Ga0496117_0015462 | |||
| 1255 | Ga0496117_0055578 | |||
| 1256 | Ga0496117_0090067 | |||
| 1257 | Ga0496117_0260111 | |||
| 1258 | Ga0496118_0004786 | |||
| 1259 | Ga0496118_0057773 | |||
| 1260 | Ga0496118_0076829 | |||
| 1261 | Ga0496118_0081041 | |||
| 1262 | Ga0496119_0000077 | |||
| 1263 | Ga0496119_0048407 | |||
| 1264 | Ga0496119_0088899 | |||
| 1265 | Ga0496120_0001801 | |||
| 1266 | Ga0496120_0028089 | |||
| 1267 | Ga0496120_0081703 | |||
| 1268 | Ga0496121_0000017 | |||
| 1269 | Ga0496121_0000196 | |||
| 1270 | Ga0496121_0003051 | |||
| 1271 | Ga0496121_0003197 | |||
| 1272 | Ga0496121_0010881 | |||
| 1273 | Ga0496121_0010937 | |||
| 1274 | Ga0496121_0115314 | |||
| 1275 | Ga0496121_0170721 | |||
| 1276 | Ga0496122_0003556 | |||
| 1277 | Ga0496122_0006114 | |||
| 1278 | Ga0496122_0006671 | |||
| 1279 | Ga0496122_0008730 | |||
| 1280 | Ga0496122_0027860 | |||
| 1281 | Ga0496122_0039577 | |||
| 1282 | Ga0496123_0000545 | |||
| 1283 | Ga0496123_0001103 | |||
| 1284 | Ga0496123_0006936 | |||
| 1285 | Ga0496123_0016815 | |||
| 1286 | Ga0496123_0037493 | |||
| 1287 | Ga0496124_0002439 | |||
| 1288 | Ga0496124_0004900 | |||
| 1289 | Ga0496124_0023873 | |||
| 1290 | Ga0496124_0033927 | |||
| 1291 | Ga0496124_0066946 | |||
| 1292 | Ga0496124_0278609 | |||
| 1293 | Ga0496124_0416328 | |||
| 1294 | Ga0496125_0001135 | |||
| 1295 | Ga0496125_0006988 | |||
| 1296 | Ga0496125_0034343 | |||
| 1297 | Ga0496125_0040809 | |||
| 1298 | Ga0496125_0071024 | |||
| 1299 | Ga0496125_0072386 | |||
| 1300 | Ga0496125_0343244 | |||
| 1301 | Ga0496126_0000175 | |||
| 1302 | Ga0496126_0004477 | |||
| 1303 | Ga0496126_0006838 | |||
| 1304 | Ga0496126_0027682 | |||
| 1305 | Ga0496126_0036199 | |||
| 1306 | Ga0496126_0449597 | |||
| 1307 | Ga0496126_0537723 | |||
| 1308 | Ga0501306_019489 | |||
| 1309 | Ga0501335_000615 | |||
| 1310 | Ga0501033_0135077 | |||
| 1311 | Ga0501034_0325286 | |||
| 1312 | Ga0501036_0256093 | |||
| 1313 | Ga0501037_0100364 | |||
| 1314 | Ga0501037_0325958 | |||
| 1315 | Ga0501038_0120378 | |||
| 1316 | Ga0501039_0088013 | |||
| 1317 | Ga0501039_0219519 | |||
| 1318 | Ga0501042_0040621 | |||
| 1319 | Ga0501046_0030454 | |||
| 1320 | Ga0501047_0000731 | |||
| 1321 | Ga0501047_0264008 | |||
| 1322 | Ga0501048_0144900 | |||
| 1323 | Ga0501070_0358628 | |||
| 1324 | Ga0501198_007724 | |||
| 1325 | Ga0501208_047227 | |||
| 1326 | Ga0501223_000039 | |||
| 1327 | Ga0501224_017610 | |||
| 1328 | Ga0501246_001398 | |||
| 1329 | Ga0501249_000213 | |||
| 1330 | Ga0501225_0000010 | |||
| 1331 | Ga0501241_034035 | |||
| 1332 | Ga0501264_012766 | |||
| 1333 | Ga0501269_003897 | |||
| 1334 | Ga0501035_0574428 | |||
| 1335 | Ga0501044_0001187 | |||
| 1336 | Ga0501044_0134255 | |||
| 1337 | Ga0501044_0260664 | |||
| 1338 | Ga0501044_0588351 | |||
| 1339 | Ga0501204_000430 | |||
| 1340 | nmdc:mga03683_13_c1 | |||
| 1341 | nmdc:mga03683_236473_c1 | |||
| 1342 | nmdc:mga03683_344_c1 | |||
| 1343 | nmdc:mga03n38_8067_c1 | |||
| 1344 | nmdc:mga00v17_132284_c1 | |||
| 1345 | nmdc:mga00v17_25514_c1 | |||
| 1346 | nmdc:mga00v17_3742_c1 | |||
| 1347 | nmdc:mga00v17_87602_c1 | |||
| 1348 | nmdc:mga0yw44_143367_c1 | |||
| 1349 | nmdc:mga0k408_161453_c1 | |||
| 1350 | nmdc:mga0k408_416031_c1 | |||
| 1351 | nmdc:mga0k408_7432_c1 | |||
| 1352 | nmdc:mga0k408_8_c1 | |||
| 1353 | nmdc:mga0k408_92421_c1 | |||
| 1354 | nmdc:mga06z11_17_c1 | |||
| 1355 | nmdc:mga06z11_84_c1 | |||
| 1356 | nmdc:mga04h51_146_c1 | |||
| 1357 | nmdc:mga04h51_74798_c1 | |||
| 1358 | nmdc:mga07m45_114488_c1 | |||
| 1359 | nmdc:mga07m45_129095_c1 | |||
| 1360 | nmdc:mga07m45_20_c1 | |||
| 1361 | nmdc:mga07m45_282292_c1 | |||
| 1362 | nmdc:mga07m45_377971_c1 | |||
| 1363 | nmdc:mga07m45_4_c1 | |||
| 1364 | nmdc:mga07m45_963_c2 | |||
| 1365 | nmdc:mga05p37_1065596_c1 | |||
| 1366 | nmdc:mga0sz30_24209_c1 | |||
| 1367 | nmdc:mga0sz30_46_c1 | |||
| 1368 | nmdc:mga0sz30_4821_c1 | |||
| 1369 | Ga0500643_000004 | |||
| 1370 | Ga0500643_006099 | |||
| 1371 | Ga0500643_020706 | |||
| 1372 | Ga0500566_0131840 | |||
| 1373 | Ga0500641_0073101 | |||
| 1374 | Ga0500556_0000222 | |||
| 1375 | Ga0500557_059563 | |||
| 1376 | Ga0500592_001156 | |||
| 1377 | Ga0500595_101841 | |||
| 1378 | Ga0500607_000055 | |||
| 1379 | Ga0500607_000844 | |||
| 1380 | Ga0500608_000087 | |||
| 1381 | Ga0500608_007769 | |||
| 1382 | Ga0500614_090803 | |||
| 1383 | Ga0500618_010477 | |||
| 1384 | Ga0500642_0000011 | |||
| 1385 | Ga0500559_0003805 | |||
| 1386 | Ga0500559_0008073 | |||
| 1387 | Ga0500564_000168 | |||
| 1388 | Ga0500568_0046730 | |||
| 1389 | Ga0500573_0229092 | |||
| 1390 | Ga0500577_0070252 | |||
| 1391 | Ga0500590_000131 | |||
| 1392 | Ga0500590_065735 | |||
| 1393 | Ga0500604_0081425 | |||
| 1394 | Ga0500616_0006078 | |||
| 1395 | Ga0500622_0001994 | |||
| 1396 | Ga0500622_0025695 | |||
| 1397 | Ga0500624_000106 | |||
| 1398 | Ga0500630_098590 | |||
| 1399 | Ga0500636_0005955 | |||
| 1400 | Ga0500637_0017519 | |||
| 1401 | Ga0500567_000445 | |||
| 1402 | Ga0500570_004079 | |||
| 1403 | Ga0500625_000009 | |||
| 1404 | Ga0500645_000417 | |||
| 1405 | Ga0500645_004197 | |||
| 1406 | Ga0500645_006930 | |||
| 1407 | Ga0500645_017913 | |||
| 1408 | Ga0500645_056045 | |||
| 1409 | Ga0500645_062632 | |||
| 1410 | Ga0587090_002320 | |||
| 1411 | Ga0501082_0612062 | |||
| 1412 | 2511130327 | |||
| 1413 | 2643950202 | |||
| 1414 | 2644036773 | |||
| 1415 | 2738709788 | |||
| 1416 | 2738848213 | |||
| 1417 | 2738863942 | |||
| 1418 | 2739296460 | |||
| 1419 | 2739358138 | |||
| 1420 | 2739649378 | |||
| 1421 | 2740027851 | |||
| 1422 | 2778125109 | |||
| 1423 | 2819552827 | |||
| 1424 | 2896186914 | |||
| 1425 | 2896254677 | |||
| 1426 | 2919141737 | |||
| 1427 | 2928101345 | |||
| 1428 | 2928960244 | |||
| 1429 | 3000866463 | |||
| 1430 | 8054303050 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9442 | 1 | 166 |
| 2hcu-assembly1.cif.gz_A | crystal structure of smu.1381 (or leud) from streptococcus mutans | 0.94 | 1 | 166 |
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9281 | 1 | 166 |
| 3h5e-assembly2.cif.gz_B | leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9233 | 4 | 153 |
| 3q3w-assembly1.cif.gz_A | isopropylmalate isomerase small subunit from campylobacter jejuni. | 0.9086 | 1 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14289_535_712_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9519 | 3 | 169 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9442 | 1 | 166 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9281 | 1 | 166 | 3.20.19.10 |
| af_Q2FWK0_1_171_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9267 | 2 | 166 | 3.20.19.10 |
| 3q3wA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9028 | 1 | 167 | 3.20.19.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5SBZ3-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9829 | 1 | 169 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A2A2K0E1-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9815 | 1 | 115 |
GO:0003861
GO:0009098 GO:0009316 GO:0016491 |
| AF-A0A4Q5SBZ3-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9771 | 1 | 169 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A3D4LX70-F1-model_v4 | deleted | 0.9759 | 1 | 139 |
|
| AF-A0A800JRL8-F1-model_v4 | deleted | 0.9731 | 1 | 142 |
|