F477002

General Info

Members Datasets Scaffolds Average Seq Length
715 406 1430 128

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0042508|Ga0436365_0042508_23747_24190
Length 147
Sequence LYALAKPSRDSFLFGDLVMSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVAAGDDCAVAESVKAASDIYAPISGEIVAVNEALGDAPEQVNSAPYGEGWIFKIKASDESEVAALLDATAYEALLEDE

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
88 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
89 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
90 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
186 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
187 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
204 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
205 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
206 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
209 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
221 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
222 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
223 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
224 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
225 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
226 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
231 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 2511231020 Pseudomonas sp. GM74 Isolate Nodule
323 2511231021 Pseudomonas sp. GM78 Isolate Nodule
324 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
325 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
326 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
327 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
328 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
329 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
330 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
331 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
332 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
333 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
334 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
335 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
336 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
337 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
338 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
339 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
340 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
341 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
342 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
343 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
344 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
345 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
346 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
347 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
348 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
349 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
350 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
351 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
352 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
353 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
354 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
355 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
356 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
357 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
358 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
359 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
360 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
361 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
362 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
363 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
364 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
365 2636415599 Klebsiella variicola DX120E Isolate Unclassified
366 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
367 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
368 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
369 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
370 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
371 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
372 2751185917 Enterobacter sp. HK169 Isolate Unclassified
373 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
374 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
375 2775507074 Klebsiella sp. D5A Isolate Unclassified
376 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
377 2821118458 Enterobacter asburiae 609 Isolate Unclassified
378 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
379 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
380 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
381 2865014394 Pantoea sp. R-71966 Isolate Unclassified
382 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
383 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
384 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
385 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
386 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
387 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
388 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
389 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
390 2937539931 Pantoea sp. LS15 Isolate Unclassified
391 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
392 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
393 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
394 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
395 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
396 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
397 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
398 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
399 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
400 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
401 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
402 8018221730 Enterobacter sp. CM29 Isolate Unclassified
403 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
404 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
405 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
406 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.57
Metatranscriptomes 1.54
Isolates 11.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 1.82
Nodule 1.82
Rhizoplane 10.77
Rhizosphere 75.66
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0042508 3300039437 Bacteria 41569
2 SwRhRL2b_contig_2081982 2162886007 Bacteria 2260
3 JGI24737J22298_10132570 3300001990 Archaea 736
4 JGI24737J22298_10249692 3300001990 Bacteria 524
5 rootH2_10007961 3300003320 Bacteria 15867
6 rootL2_10005174 3300003322 Bacteria 11301
7 JGI26129J50193_1009732 3300003349 Bacteria 698
8 Ga0006562J51391_1034250 3300003578 Unclassified 1646
9 Ga0065704_10096250 3300005289 Bacteria 2439
10 Ga0065704_10447131 3300005289 Bacteria 708
11 Ga0065704_10589533 3300005289 Bacteria 601
12 Ga0070676_10637699 3300005328 Bacteria 772
13 Ga0070676_10989659 3300005328 Bacteria 631
14 Ga0070683_100434434 3300005329 Bacteria 1253
15 Ga0070683_100506196 3300005329 Bacteria 1154
16 Ga0070670_100111084 3300005331 Bacteria 2362
17 Ga0070660_100178743 3300005339 Bacteria 1717
18 Ga0070660_100180346 3300005339 Bacteria 1709
19 Ga0070692_10149802 3300005345 Bacteria 1328
20 Ga0070692_10525721 3300005345 Bacteria 771
21 Ga0070668_100005924 3300005347 Bacteria 9059
22 Ga0070674_100096087 3300005356 Bacteria 2149
23 Ga0070674_101547295 3300005356 Bacteria 597
24 Ga0070688_100779640 3300005365 Bacteria 746
25 Ga0070659_100017935 3300005366 Bacteria 5333
26 Ga0070659_100213804 3300005366 Bacteria 1589
27 Ga0070659_100259143 3300005366 Bacteria 1443
28 Ga0070659_100294518 3300005366 Bacteria 1352
29 Ga0070659_100349134 3300005366 Bacteria 1241
30 Ga0070659_101024490 3300005366 Bacteria 725
31 Ga0070714_100029705 3300005435 Bacteria 4546
32 Ga0070711_100040404 3300005439 Bacteria 3146
33 Ga0070711_101406719 3300005439 Unclassified 607
34 Ga0070700_100211893 3300005441 Bacteria 1367
35 Ga0070678_100649993 3300005456 Bacteria 946
36 Ga0070662_100019920 3300005457 Bacteria 4565
37 Ga0070662_100737629 3300005457 Bacteria 835
38 Ga0070681_10679253 3300005458 Bacteria 945
39 Ga0068867_100094504 3300005459 Bacteria 2273
40 Ga0068867_100557801 3300005459 Bacteria 993
41 Ga0070706_100788510 3300005467 Bacteria 880
42 Ga0070698_100589616 3300005471 Bacteria 1052
43 Ga0070679_100535681 3300005530 Bacteria 1115
44 Ga0070684_100156192 3300005535 Bacteria 2069
45 Ga0070697_100067397 3300005536 Bacteria 2928
46 Ga0068853_102129852 3300005539 Unclassified 544
47 Ga0068853_102215244 3300005539 Bacteria 533
48 Ga0070665_100000033 3300005548 Bacteria 332530
49 Ga0070665_100155742 3300005548 Bacteria 2287
50 Ga0070665_100528192 3300005548 Bacteria 1192
51 Ga0070704_101118305 3300005549 Bacteria 716
52 Ga0070704_101716838 3300005549 Bacteria 580
53 Ga0070664_100677286 3300005564 Bacteria 960
54 Ga0068857_100000005 3300005577 Bacteria 170248
55 Ga0068857_100552569 3300005577 Bacteria 1085
56 Ga0068854_100367615 3300005578 Bacteria 1182
57 Ga0068856_100865745 3300005614 Bacteria 923
58 Ga0068856_101011039 3300005614 Bacteria 850
59 Ga0070702_100421497 3300005615 Bacteria 961
60 Ga0068852_100309410 3300005616 Bacteria 1531
61 Ga0068852_100802136 3300005616 Bacteria 956
62 Ga0068852_101740695 3300005616 Bacteria 646
63 Ga0068859_100654263 3300005617 Bacteria 1143
64 Ga0068864_100348964 3300005618 Bacteria 1396
65 Ga0068866_10058288 3300005718 Bacteria 1994
66 Ga0068866_10147682 3300005718 Bacteria 1358
67 Ga0068861_100148538 3300005719 Bacteria 1921
68 Ga0068861_100751999 3300005719 Bacteria 911
69 Ga0068861_100870025 3300005719 Bacteria 851
70 Ga0068851_10025488 3300005834 Bacteria 2901
71 Ga0068870_10068796 3300005840 Bacteria 1925
72 Ga0068870_10113589 3300005840 Bacteria 1550
73 Ga0068862_101169748 3300005844 Bacteria 767
74 Ga0068862_102067149 3300005844 Bacteria 581
75 Ga0081538_10153090 3300005981 Bacteria 1040
76 Ga0075365_10202724 3300006038 Bacteria 1390
77 Ga0075365_10534960 3300006038 Bacteria 829
78 Ga0075365_10568514 3300006038 Bacteria 802
79 Ga0075364_10008988 3300006051 Bacteria 5982
80 Ga0075364_10378596 3300006051 Bacteria 965
81 Ga0075366_10003394 3300006195 Bacteria 8397
82 Ga0097621_101487504 3300006237 Unclassified 642
83 Ga0075428_100520963 3300006844 Bacteria 1272
84 Ga0075428_100946318 3300006844 Bacteria 913
85 Ga0075431_101912686 3300006847 Bacteria 549
86 Ga0068865_100498683 3300006881 Bacteria 1015
87 Ga0097620_100654301 3300006931 Bacteria 1143
88 Ga0079104_1000046 3300006946 Bacteria 183396
89 Ga0079104_1000249 3300006946 Bacteria 72153
90 Ga0079104_1001023 3300006946 Bacteria 21533
91 Ga0079104_1001675 3300006946 Bacteria 14227
92 Ga0079104_1078148 3300006946 Bacteria 684
93 Ga0105251_10000576 3300009011 Bacteria 34073
94 Ga0105251_10006603 3300009011 Bacteria 7350
95 Ga0105251_10025485 3300009011 Bacteria 3025
96 Ga0105251_10063250 3300009011 Bacteria 1736
97 Ga0105251_10126148 3300009011 Bacteria 1162
98 Ga0105244_10000091 3300009036 Bacteria 96351
99 Ga0105244_10039783 3300009036 Bacteria 2445
100 Ga0105244_10411907 3300009036 Bacteria 622
101 Ga0105244_10586162 3300009036 Bacteria 512
102 Ga0105250_10000095 3300009092 Bacteria 78639
103 Ga0105250_10044506 3300009092 Bacteria 1780
104 Ga0105240_10044693 3300009093 Bacteria 5625
105 Ga0105240_10693579 3300009093 Bacteria 1112
106 Ga0111539_10980384 3300009094 Bacteria 983
107 Ga0111539_11394265 3300009094 Bacteria 813
108 Ga0111539_12373636 3300009094 Bacteria 615
109 Ga0105245_10228854 3300009098 Bacteria 1797
110 Ga0105245_10369589 3300009098 Bacteria 1425
111 Ga0105247_10269596 3300009101 Bacteria 1170
112 Ga0105247_10324318 3300009101 Bacteria 1075
113 Ga0105247_11110806 3300009101 Bacteria 624
114 Ga0114129_10432163 3300009147 Bacteria 1730
115 Ga0114129_11562474 3300009147 Bacteria 809
116 Ga0114129_11836492 3300009147 Bacteria 736
117 Ga0114129_11947353 3300009147 Bacteria 712
118 Ga0105243_10155174 3300009148 Bacteria 1968
119 Ga0105243_10336668 3300009148 Bacteria 1381
120 Ga0105243_11058440 3300009148 Bacteria 817
121 Ga0105243_11219786 3300009148 Bacteria 766
122 Ga0105242_10890407 3300009176 Bacteria 889
123 Ga0105242_11471207 3300009176 Bacteria 711
124 Ga0105242_13273943 3300009176 Unclassified 503
125 Ga0105248_10596542 3300009177 Bacteria 1246
126 Ga0105248_11513262 3300009177 Bacteria 760
127 Ga0105248_12053276 3300009177 Bacteria 650
128 Ga0105237_10141798 3300009545 Bacteria 2397
129 Ga0105237_10300312 3300009545 Bacteria 1609
130 Ga0105238_10451230 3300009551 Bacteria 1283
131 Ga0105249_10422390 3300009553 Bacteria 1367
132 Ga0105249_11551703 3300009553 Bacteria 735
133 Ga0105239_11620257 3300010375 Unclassified 749
134 Ga0105239_12144592 3300010375 Unclassified 650
135 Ga0105239_12274270 3300010375 Bacteria 631
136 Ga0105239_13096906 3300010375 Bacteria 542
137 Ga0105246_10140776 3300011119 Bacteria 1814
138 Ga0157373_10031197 3300013100 Bacteria 3835
139 Ga0157373_10215033 3300013100 Bacteria 1356
140 Ga0157371_10749179 3300013102 Bacteria 733
141 Ga0157371_10971181 3300013102 Bacteria 647
142 Ga0157370_10002672 3300013104 Bacteria 21370
143 Ga0157370_10003046 3300013104 Bacteria 19875
144 Ga0157370_11299817 3300013104 Bacteria 655
145 Ga0157370_12048284 3300013104 Bacteria 513
146 Ga0157374_10274843 3300013296 Bacteria 1662
147 Ga0157374_11789826 3300013296 Unclassified 639
148 Ga0157378_10446043 3300013297 Bacteria 1283
149 Ga0163162_10043027 3300013306 Bacteria 4521
150 Ga0157372_10045700 3300013307 Bacteria 4859
151 Ga0157372_10532628 3300013307 Bacteria 1369
152 Ga0157372_10729583 3300013307 Bacteria 1152
153 Ga0157375_11311746 3300013308 Bacteria 851
154 Ga0157375_12523485 3300013308 Bacteria 614
155 Ga0163163_10332564 3300014325 Bacteria 1574
156 Ga0157380_10159165 3300014326 Bacteria 1961
157 Ga0157380_11637400 3300014326 Archaea 700
158 Ga0182008_10060110 3300014497 Bacteria 1874
159 Ga0157377_10126535 3300014745 Bacteria 1555
160 Ga0157377_10184610 3300014745 Bacteria 1314
161 Ga0157377_11337333 3300014745 Unclassified 562
162 Ga0157376_10001159 3300014969 Bacteria 17345
163 Ga0157376_10119524 3300014969 Bacteria 2333
164 Ga0157376_10637206 3300014969 Bacteria 1065
165 Ga0182006_1000013 3300015261 Bacteria 363224
166 Ga0182006_1003907 3300015261 Bacteria 7465
167 Ga0182007_10030055 3300015262 Bacteria 1858
168 Ga0183366_1002 3300015679 Bacteria 791639
169 Ga0183370_1002 3300015680 Bacteria 791639
170 Ga0183369_1002 3300015685 Bacteria 791621
171 Ga0183368_1005 3300015687 Bacteria 791621
172 Ga0163161_10010793 3300017792 Bacteria 6329
173 Ga0163161_10125620 3300017792 Bacteria 1931
174 Ga0163161_10430225 3300017792 Bacteria 1063
175 Ga0163161_10433543 3300017792 Bacteria 1059
176 Ga0213872_10207204 3300021361 Bacteria 838
177 Ga0213876_10000329 3300021384 Bacteria 41529
178 Ga0207426_1027655 3300025302 Bacteria 1887
179 Ga0207656_10008020 3300025321 Bacteria 3872
180 Ga0207696_1000024 3300025711 Bacteria 420123
181 Ga0207696_1000361 3300025711 Bacteria 45553
182 Ga0207655_1000044 3300025728 Bacteria 327511
183 Ga0207655_1000047 3300025728 Bacteria 302548
184 Ga0207655_1000050 3300025728 Bacteria 294923
185 Ga0207655_1000079 3300025728 Bacteria 219036
186 Ga0207655_1007857 3300025728 Bacteria 6860
187 Ga0207655_1041194 3300025728 Bacteria 1982
188 Ga0207713_1000033 3300025735 Bacteria 273751
189 Ga0207713_1000134 3300025735 Bacteria 112419
190 Ga0207713_1004277 3300025735 Bacteria 9311
191 Ga0207713_1017199 3300025735 Bacteria 3638
192 Ga0207713_1082750 3300025735 Bacteria 1149
193 Ga0207713_1087163 3300025735 Bacteria 1107
194 Ga0207682_10204939 3300025893 Bacteria 908
195 Ga0207692_11197741 3300025898 Bacteria 504
196 Ga0207642_10109118 3300025899 Bacteria 1405
197 Ga0207710_10358912 3300025900 Bacteria 743
198 Ga0207688_10046036 3300025901 Bacteria 2435
199 Ga0207688_10187403 3300025901 Bacteria 1236
200 Ga0207688_10369966 3300025901 Bacteria 885
201 Ga0207645_10388259 3300025907 Bacteria 938
202 Ga0207643_10053083 3300025908 Bacteria 2302
203 Ga0207695_10200142 3300025913 Bacteria 1912
204 Ga0207671_10357320 3300025914 Bacteria 1159
205 Ga0207660_11334596 3300025917 Bacteria 582
206 Ga0207657_10183351 3300025919 Bacteria 1691
207 Ga0207652_10633734 3300025921 Bacteria 957
208 Ga0207694_10080587 3300025924 Bacteria 2555
209 Ga0207694_11556586 3300025924 Bacteria 558
210 Ga0207650_10673351 3300025925 Bacteria 873
211 Ga0207659_10453149 3300025926 Bacteria 1081
212 Ga0207687_10245907 3300025927 Bacteria 1420
213 Ga0207690_10041333 3300025932 Bacteria 3020
214 Ga0207690_10088511 3300025932 Bacteria 2181
215 Ga0207706_10055572 3300025933 Bacteria 3490
216 Ga0207706_10088631 3300025933 Bacteria 2720
217 Ga0207706_10199910 3300025933 Bacteria 1753
218 Ga0207706_10537879 3300025933 Bacteria 1007
219 Ga0207706_10661425 3300025933 Unclassified 894
220 Ga0207706_10816548 3300025933 Bacteria 791
221 Ga0207709_10133988 3300025935 Bacteria 1693
222 Ga0207709_10152812 3300025935 Bacteria 1601
223 Ga0207669_10070251 3300025937 Bacteria 2195
224 Ga0207669_10138728 3300025937 Bacteria 1684
225 Ga0207669_10360127 3300025937 Bacteria 1127
226 Ga0207704_11106452 3300025938 Bacteria 673
227 Ga0207704_11111826 3300025938 Bacteria 672
228 Ga0207691_10468239 3300025940 Bacteria 1071
229 Ga0207691_11475306 3300025940 Bacteria 557
230 Ga0207689_11110740 3300025942 Bacteria 666
231 Ga0207661_10990869 3300025944 Bacteria 774
232 Ga0207661_11486073 3300025944 Bacteria 621
233 Ga0207679_10642409 3300025945 Bacteria 959
234 Ga0207712_10296010 3300025961 Bacteria 1326
235 Ga0207668_10221869 3300025972 Bacteria 1519
236 Ga0207668_10338908 3300025972 Bacteria 1253
237 Ga0207668_11223816 3300025972 Bacteria 675
238 Ga0207677_10268898 3300026023 Bacteria 1393
239 Ga0207677_10603165 3300026023 Bacteria 964
240 Ga0207639_10809457 3300026041 Bacteria 873
241 Ga0207639_11197370 3300026041 Bacteria 713
242 Ga0207678_10992686 3300026067 Bacteria 743
243 Ga0207708_10008968 3300026075 Bacteria 7401
244 Ga0207708_10185692 3300026075 Bacteria 1652
245 Ga0207648_10085237 3300026089 Bacteria 2756
246 Ga0207648_10826533 3300026089 Bacteria 863
247 Ga0207648_10867424 3300026089 Bacteria 842
248 Ga0207676_10258186 3300026095 Bacteria 1572
249 Ga0207676_10452977 3300026095 Bacteria 1210
250 Ga0207674_10000523 3300026116 Bacteria 50444
251 Ga0207674_10370381 3300026116 Bacteria 1385
252 Ga0207675_100068996 3300026118 Bacteria 3304
253 Ga0207683_10063390 3300026121 Bacteria 3256
254 Ga0207683_11905155 3300026121 Bacteria 543
255 Ga0207698_10513908 3300026142 Bacteria 1168
256 Ga0207698_11076101 3300026142 Bacteria 816
257 Ga0209281_1000022 3300027111 Bacteria 522913
258 Ga0209281_1000048 3300027111 Bacteria 322698
259 Ga0209281_1000056 3300027111 Bacteria 307619
260 Ga0209281_1000120 3300027111 Bacteria 206692
261 Ga0209281_1000243 3300027111 Bacteria 110012
262 Ga0209281_1000422 3300027111 Bacteria 63149
263 Ga0209371_1000013 3300027312 Bacteria 691516
264 Ga0209371_1000427 3300027312 Bacteria 43271
265 Ga0209371_1001124 3300027312 Bacteria 19718
266 Ga0209371_1023428 3300027312 Bacteria 1454
267 Ga0209371_1032708 3300027312 Bacteria 1116
268 Ga0209981_1013521 3300027378 Bacteria 1135
269 Ga0210000_1011901 3300027462 Bacteria 1291
270 Ga0209995_1020402 3300027471 Bacteria 1096
271 Ga0209968_1004519 3300027526 Bacteria 2088
272 Ga0209970_1035438 3300027614 Bacteria 877
273 Ga0209970_1118694 3300027614 Unclassified 511
274 Ga0210002_1052775 3300027617 Bacteria 702
275 Ga0209971_1010608 3300027682 Bacteria 2183
276 Ga0209998_10004283 3300027717 Bacteria 3039
277 Ga0209998_10092432 3300027717 Bacteria 743
278 Ga0209974_10005674 3300027876 Bacteria 4380
279 Ga0207428_10037489 3300027907 Bacteria 3944
280 Ga0207428_10411638 3300027907 Bacteria 989
281 Ga0268266_10000041 3300028379 Bacteria 322311
282 Ga0268266_10272578 3300028379 Bacteria 1571
283 Ga0268266_11374800 3300028379 Bacteria 682
284 Ga0265337_1000006 3300028556 Bacteria 99562
285 Ga0265326_10000066 3300028558 Bacteria 59893
286 Ga0265318_10109340 3300028577 Bacteria 1016
287 Ga0265322_10000001 3300028654 Bacteria 543854
288 Ga0265336_10001086 3300028666 Bacteria 13158
289 Ga0265336_10010847 3300028666 Bacteria 3110
290 Ga0265338_10059611 3300028800 Bacteria 3362
291 Ga0265324_10000090 3300029957 Bacteria 70577
292 Ga0265324_10000373 3300029957 Bacteria 32392
293 Ga0265324_10000563 3300029957 Bacteria 25385
294 Ga0265324_10007205 3300029957 Bacteria 4540
295 Ga0265324_10012755 3300029957 Bacteria 3158
296 Ga0268256_1000014 3300030500 Bacteria 691435
297 Ga0268256_1000363 3300030500 Bacteria 43271
298 Ga0268256_1021499 3300030500 Bacteria 1714
299 Ga0268256_1026531 3300030500 Bacteria 1454
300 Ga0316183_1179590 3300030742 Bacteria 619
301 Ga0265330_10002315 3300031235 Bacteria 10458
302 Ga0265332_10084963 3300031238 Bacteria 1341
303 Ga0265332_10100953 3300031238 Bacteria 1217
304 Ga0265320_10000002 3300031240 Bacteria 542875
305 Ga0265320_10014802 3300031240 Bacteria 4425
306 Ga0265325_10000153 3300031241 Bacteria 48971
307 Ga0265329_10009135 3300031242 Bacteria 3716
308 Ga0265329_10030273 3300031242 Bacteria 1764
309 Ga0265340_10406738 3300031247 Bacteria 600
310 Ga0265339_10008744 3300031249 Bacteria 6418
311 Ga0265339_10011323 3300031249 Bacteria 5499
312 Ga0265331_10002086 3300031250 Bacteria 13821
313 Ga0265331_10002830 3300031250 Bacteria 11505
314 Ga0265331_10029077 3300031250 Bacteria 2760
315 Ga0265331_10085731 3300031250 Bacteria 1459
316 Ga0265331_10092484 3300031250 Bacteria 1397
317 Ga0265331_10116328 3300031250 Bacteria 1224
318 Ga0265327_10000011 3300031251 Bacteria 543807
319 Ga0265327_10000557 3300031251 Bacteria 63857
320 Ga0265316_10053913 3300031344 Bacteria 3149
321 Ga0265316_10141965 3300031344 Bacteria 1803
322 Ga0265316_10635904 3300031344 Bacteria 755
323 Ga0307408_101130955 3300031548 Bacteria 728
324 Ga0265313_10009558 3300031595 Bacteria 6278
325 Ga0316575_10000218 3300031665 Bacteria 15311
326 Ga0316579_10079102 3300031691 Bacteria 1564
327 Ga0316579_10162879 3300031691 Unclassified 1078
328 Ga0265314_10000706 3300031711 Bacteria 40494
329 Ga0265314_10000726 3300031711 Bacteria 39827
330 Ga0265314_10009867 3300031711 Bacteria 8013
331 Ga0265314_10014960 3300031711 Bacteria 6179
332 Ga0265314_10030366 3300031711 Bacteria 4001
333 Ga0265342_10161542 3300031712 Bacteria 1238
334 Ga0265342_10605518 3300031712 Bacteria 552
335 Ga0316576_10208429 3300031727 Bacteria 1471
336 Ga0316576_10346584 3300031727 Bacteria 1105
337 Ga0316576_10936803 3300031727 Bacteria 619
338 Ga0316576_11103248 3300031727 Bacteria 563
339 Ga0316578_10006169 3300031728 Bacteria 5889
340 Ga0316578_10015116 3300031728 Bacteria 4143
341 Ga0307405_10172546 3300031731 Bacteria 1544
342 Ga0307405_12037849 3300031731 Bacteria 514
343 Ga0316577_10019864 3300031733 Bacteria 3722
344 Ga0307410_10305007 3300031852 Bacteria 1258
345 Ga0307410_11239125 3300031852 Bacteria 651
346 Ga0307406_10311375 3300031901 Bacteria 1214
347 Ga0307406_10443369 3300031901 Bacteria 1040
348 Ga0307406_10617996 3300031901 Bacteria 895
349 Ga0307409_100318026 3300031995 Bacteria 1456
350 Ga0307409_100337262 3300031995 Bacteria 1417
351 Ga0307409_100835000 3300031995 Bacteria 931
352 Ga0307409_100867404 3300031995 Bacteria 914
353 Ga0307409_101252014 3300031995 Bacteria 766
354 Ga0307409_101589845 3300031995 Bacteria 682
355 Ga0307416_100355281 3300032002 Bacteria 1485
356 Ga0307416_100590156 3300032002 Bacteria 1189
357 Ga0307416_100761242 3300032002 Bacteria 1062
358 Ga0307414_10520077 3300032004 Bacteria 1056
359 Ga0307411_10131892 3300032005 Bacteria 1828
360 Ga0307415_100017705 3300032126 Bacteria 4278
361 Ga0307415_100256525 3300032126 Bacteria 1424
362 Ga0307415_100375335 3300032126 Bacteria 1206
363 Ga0307415_101812081 3300032126 Bacteria 591
364 Ga0316585_10016316 3300032137 Bacteria 2236
365 Ga0316580_10002910 3300032139 Bacteria 4796
366 Ga0316580_10011437 3300032139 Bacteria 2694
367 Ga0316593_10005031 3300032168 Bacteria 3451
368 Ga0316593_10062511 3300032168 Bacteria 1275
369 Ga0316592_1000666 3300033524 Bacteria 5018
370 Ga0316592_1011089 3300033524 Bacteria 1827
371 Ga0316588_1000764 3300033528 Bacteria 4783
372 Ga0316588_1002158 3300033528 Unclassified 3387
373 Ga0316588_1005250 3300033528 Bacteria 2510
374 Ga0316596_1023746 3300033541 Bacteria 1572
375 Ga0316596_1039709 3300033541 Bacteria 1235
376 Ga0373923_0099501 3300035111 Bacteria 1281
377 Ga0373939_0256780 3300035114 Bacteria 682
378 Ga0373943_0016826 3300035170 Bacteria 3341
379 Ga0316574_0004273 3300035398 Bacteria 7462
380 Ga0316574_0267348 3300035398 Bacteria 1091
381 Ga0373937_0322391 3300036401 Bacteria 1462
382 Ga0373937_0472246 3300036401 Bacteria 1191
383 Ga0316582_0024850 3300036647 Bacteria 3590
384 Ga0316582_0048224 3300036647 Bacteria 2692
385 Ga0316584_0010338 3300036712 Bacteria 6517
386 Ga0316584_0025194 3300036712 Bacteria 4360
387 Ga0373925_0185656 3300037068 Bacteria 1648
388 Ga0395900_0497810 3300037418 Bacteria 1169
389 Ga0395900_1013836 3300037418 Bacteria 750
390 Ga0395898_0404186 3300037466 Bacteria 1302
391 Ga0316581_0065812 3300037588 Bacteria 1113
392 Ga0395901_1652744 3300038443 Bacteria 593
393 Ga0400490_40590 3300038726 Bacteria 7008
394 Ga0400488_62682 3300038741 Bacteria 2177
395 Ga0400483_220832 3300039062 Unclassified 1415
396 Ga0400487_14017 3300039110 Bacteria 10114
397 Ga0436361_0333442 3300039447 Bacteria 1496
398 Ga0436361_0883668 3300039447 Bacteria 1638
399 Ga0436361_0989063 3300039447 Bacteria 4557
400 Ga0439438_003218 3300041405 Bacteria 6678
401 Ga0439438_012978 3300041405 Bacteria 2532
402 Ga0439447_017639 3300041407 Bacteria 1941
403 Ga0439466_0000004 3300041411 Bacteria 462654
404 Ga0439465_0363704 3300041413 Bacteria 548
405 Ga0451795_0594414 3300041456 Bacteria 1103
406 Ga0451802_0235268 3300041460 Bacteria 1307
407 Ga0451807_0974327 3300041486 Bacteria 884
408 Ga0451841_0791043 3300041498 Bacteria 1534
409 Ga0451843_0406932 3300041509 Bacteria 1310
410 Ga0451853_0823009 3300041512 Bacteria 2312
411 Ga0451853_2427319 3300041512 Bacteria 7107
412 Ga0439448_0049540 3300042005 Bacteria 1373
413 Ga0439432_019605 3300042006 Bacteria 2252
414 Ga0439432_027215 3300042006 Bacteria 1868
415 Ga0439450_033216 3300042008 Bacteria 1169
416 Ga0439452_000011 3300042010 Bacteria 428451
417 Ga0439452_000344 3300042010 Bacteria 28832
418 Ga0439452_002524 3300042010 Bacteria 6730
419 Ga0439452_028288 3300042010 Bacteria 1400
420 Ga0439463_001507 3300042016 Bacteria 6145
421 Ga0450902_052006 3300042137 Bacteria 704
422 Ga0450907_000221 3300042146 Bacteria 19992
423 Ga0439458_0012813 3300042157 Bacteria 1884
424 Ga0439459_0026302 3300042438 Bacteria 1155
425 Ga0439464_0001655 3300042439 Bacteria 5323
426 Ga0439464_0010134 3300042439 Bacteria 2488
427 Ga0439460_0067812 3300042461 Bacteria 1100
428 Ga0451577_0000085 3300042876 Bacteria 211141
429 Ga0451577_0003720 3300042876 Bacteria 16669
430 Ga0451577_0089801 3300042876 Bacteria 2742
431 Ga0451577_0117305 3300042876 Bacteria 2384
432 Ga0451577_0129463 3300042876 Bacteria 2264
433 Ga0439440_0042499 3300042993 Bacteria 1112
434 Ga0466981_0000001 3300044669 Bacteria 367980
435 Ga0453683_0000047 3300044673 Bacteria 207763
436 Ga0466966_0074125 3300044684 Bacteria 2128
437 Ga0466963_0047730 3300044694 Bacteria 2827
438 Ga0466964_0169087 3300044706 Bacteria 1028
439 Ga0453684_0000273 3300044712 Bacteria 222658
440 Ga0453684_0000302 3300044712 Bacteria 207763
441 Ga0453684_0012535 3300044712 Bacteria 13956
442 Ga0453684_0173338 3300044712 Bacteria 2540
443 Ga0453684_0431915 3300044712 Bacteria 1469
444 Ga0466970_0704601 3300044765 Bacteria 589
445 Ga0466960_0054641 3300044901 Bacteria 1940
446 Ga0466960_0183222 3300044901 Bacteria 1136
447 Ga0466959_0522741 3300045049 Bacteria 801
448 Ga0451576_0000006 3300045051 Bacteria 949698
449 Ga0451576_0000116 3300045051 Bacteria 207763
450 Ga0451576_0000652 3300045051 Bacteria 71674
451 Ga0451576_0000868 3300045051 Bacteria 58132
452 Ga0451576_1271666 3300045051 Bacteria 767
453 Ga0451576_1905486 3300045051 Bacteria 613
454 Ga0466967_0170697 3300045976 Bacteria 2046
455 Ga0466967_0214795 3300045976 Bacteria 1825
456 Ga0466967_0499940 3300045976 Bacteria 1193
457 Ga0466967_1509989 3300045976 Bacteria 669
458 Ga0495603_0000258 3300046455 Bacteria 27900
459 Ga0495591_013966 3300046458 Bacteria 2910
460 Ga0495641_0274632 3300046461 Bacteria 758
461 Ga0495650_0000059 3300046471 Bacteria 296253
462 Ga0495596_0230626 3300046500 Bacteria 719
463 Ga0495643_0075647 3300046522 Bacteria 1761
464 Ga0495648_0006032 3300046524 Bacteria 9948
465 Ga0495667_0000047 3300046559 Bacteria 117718
466 Ga0495668_0645974 3300046616 Bacteria 585
467 Ga0495660_0008440 3300046810 Bacteria 6032
468 Ga0495672_0000025 3300047320 Bacteria 365425
469 Ga0495680_0003506 3300047322 Bacteria 15387
470 Ga0495679_002550 3300047446 Bacteria 9194
471 Ga0495684_0127354 3300047471 Bacteria 1915
472 Ga0496100_0046797 3300048903 Bacteria 2784
473 Ga0496100_0220279 3300048903 Bacteria 1392
474 Ga0496100_0306909 3300048903 Bacteria 1189
475 Ga0496100_1008716 3300048903 Bacteria 655
476 Ga0496101_0132458 3300048904 Bacteria 1894
477 Ga0496101_0672143 3300048904 Bacteria 818
478 Ga0496101_1058770 3300048904 Bacteria 637
479 Ga0496102_0473250 3300048905 Bacteria 1174
480 Ga0496102_0800989 3300048905 Bacteria 864
481 Ga0496103_0333341 3300048906 Bacteria 976
482 Ga0496104_0000680 3300048907 Bacteria 29268
483 Ga0496104_0811525 3300048907 Unclassified 842
484 Ga0496105_0006095 3300048908 Bacteria 9228
485 Ga0496105_0009823 3300048908 Bacteria 7498
486 Ga0496107_0313840 3300048910 Bacteria 1167
487 Ga0496108_0050129 3300048911 Bacteria 3494
488 Ga0496108_0215378 3300048911 Bacteria 1668
489 Ga0496109_0046553 3300048912 Bacteria 3940
490 Ga0496109_1859070 3300048912 Bacteria 535
491 Ga0496110_0453927 3300048913 Bacteria 1168
492 Ga0496110_0460644 3300048913 Bacteria 1159
493 Ga0496110_1058572 3300048913 Archaea 719
494 Ga0496110_1531880 3300048913 Bacteria 577
495 Ga0496110_1812624 3300048913 Bacteria 520
496 Ga0496113_0462794 3300048916 Bacteria 1019
497 Ga0496113_0559873 3300048916 Bacteria 917
498 Ga0496114_0004317 3300048917 Bacteria 10999
499 Ga0496114_0007017 3300048917 Bacteria 8886
500 Ga0496115_1344821 3300048918 Unclassified 530
501 Ga0496116_0002364 3300048919 Bacteria 19954
502 Ga0496116_0067587 3300048919 Bacteria 2281
503 Ga0496116_0105035 3300048919 Bacteria 1676
504 Ga0496117_0000168 3300048920 Bacteria 137886
505 Ga0496118_0000075 3300048921 Bacteria 196228
506 Ga0496118_0000304 3300048921 Bacteria 85277
507 Ga0496118_0000996 3300048921 Bacteria 44151
508 Ga0496119_0000281 3300048922 Bacteria 71482
509 Ga0496119_0017781 3300048922 Bacteria 5329
510 Ga0496120_0000363 3300048923 Bacteria 73708
511 Ga0496120_0013938 3300048923 Bacteria 5379
512 Ga0496120_0147265 3300048923 Bacteria 1187
513 Ga0496121_0000057 3300048924 Bacteria 294291
514 Ga0496121_0020822 3300048924 Bacteria 6462
515 Ga0496121_0669107 3300048924 Bacteria 629
516 Ga0496122_0002021 3300048925 Bacteria 30149
517 Ga0496122_0002096 3300048925 Bacteria 29548
518 Ga0496122_0043786 3300048925 Bacteria 3502
519 Ga0496122_0069982 3300048925 Bacteria 2510
520 Ga0496123_0000605 3300048926 Bacteria 60923
521 Ga0496123_0002325 3300048926 Bacteria 23867
522 Ga0496123_0031853 3300048926 Bacteria 3827
523 Ga0496123_0472030 3300048926 Bacteria 554
524 Ga0496124_0001851 3300048927 Bacteria 29214
525 Ga0496124_0133469 3300048927 Bacteria 1969
526 Ga0496124_0177748 3300048927 Bacteria 1641
527 Ga0496125_0000081 3300048928 Bacteria 228069
528 Ga0496125_0003562 3300048928 Bacteria 18755
529 Ga0496125_0007362 3300048928 Bacteria 11720
530 Ga0496125_0022828 3300048928 Bacteria 5797
531 Ga0496126_0001662 3300048929 Bacteria 33392
532 Ga0496126_0005302 3300048929 Bacteria 14797
533 Ga0496126_0155487 3300048929 Bacteria 1957
534 Ga0496126_0394059 3300048929 Bacteria 1124
535 Ga0496126_0408706 3300048929 Bacteria 1099
536 Ga0501031_0004039 3300049568 Bacteria 9468
537 Ga0501031_0008281 3300049568 Bacteria 6764
538 Ga0501031_0058685 3300049568 Bacteria 2508
539 Ga0501031_0110192 3300049568 Bacteria 1797
540 Ga0501032_0001373 3300049569 Bacteria 19318
541 Ga0501032_0007089 3300049569 Bacteria 8214
542 Ga0501032_0059099 3300049569 Bacteria 2573
543 Ga0501033_0000949 3300049570 Bacteria 26319
544 Ga0501033_0001864 3300049570 Bacteria 18331
545 Ga0501033_0059974 3300049570 Bacteria 2808
546 Ga0501033_0699024 3300049570 Bacteria 690
547 Ga0501034_0024559 3300049571 Bacteria 6130
548 Ga0501034_0047437 3300049571 Bacteria 4337
549 Ga0501034_0173483 3300049571 Bacteria 2123
550 Ga0501034_0541825 3300049571 Bacteria 1074
551 Ga0501036_0000382 3300049572 Bacteria 31346
552 Ga0501036_0001661 3300049572 Bacteria 17238
553 Ga0501036_0035605 3300049572 Bacteria 4211
554 Ga0501037_0000474 3300049573 Bacteria 32555
555 Ga0501037_0051116 3300049573 Bacteria 3023
556 Ga0501037_0193442 3300049573 Bacteria 1440
557 Ga0501037_0358177 3300049573 Bacteria 1005
558 Ga0501037_0711826 3300049573 Bacteria 667
559 Ga0501038_0008209 3300049574 Bacteria 9604
560 Ga0501038_0019437 3300049574 Bacteria 6122
561 Ga0501038_0023864 3300049574 Bacteria 5461
562 Ga0501038_0076883 3300049574 Bacteria 2819
563 Ga0501038_0130565 3300049574 Bacteria 2063
564 Ga0501038_0137944 3300049574 Bacteria 1997
565 Ga0501038_0336957 3300049574 Bacteria 1177
566 Ga0501039_0002238 3300049575 Bacteria 14325
567 Ga0501039_0037165 3300049575 Bacteria 3758
568 Ga0501039_0043176 3300049575 Bacteria 3483
569 Ga0501039_0044783 3300049575 Bacteria 3418
570 Ga0501040_0003365 3300049576 Bacteria 10322
571 Ga0501040_0076944 3300049576 Bacteria 2308
572 Ga0501041_1016395 3300049577 Bacteria 533
573 Ga0501042_0084446 3300049578 Bacteria 2276
574 Ga0501042_0825969 3300049578 Bacteria 675
575 Ga0501043_0007578 3300049579 Bacteria 8603
576 Ga0501043_0008971 3300049579 Bacteria 7869
577 Ga0501043_0083051 3300049579 Bacteria 2518
578 Ga0501046_0002898 3300049580 Bacteria 15906
579 Ga0501046_0011564 3300049580 Bacteria 7548
580 Ga0501046_0700086 3300049580 Bacteria 714
581 Ga0501047_0005810 3300049581 Bacteria 11613
582 Ga0501047_0108224 3300049581 Bacteria 2662
583 Ga0501048_0059590 3300049582 Bacteria 2705
584 Ga0501048_0400031 3300049582 Bacteria 982
585 Ga0501068_0002905 3300049584 Bacteria 9121
586 Ga0501068_0172686 3300049584 Bacteria 1365
587 Ga0501070_0429924 3300049586 Bacteria 1066
588 Ga0501071_0472784 3300049587 Bacteria 960
589 Ga0501071_0757423 3300049587 Bacteria 748
590 Ga0501072_0034667 3300049588 Bacteria 3956
591 Ga0501073_0642907 3300049589 Bacteria 732
592 Ga0501074_0313318 3300049590 Bacteria 1115
593 Ga0501075_0444772 3300049591 Bacteria 988
594 Ga0501076_0630063 3300049592 Bacteria 885
595 Ga0501077_0128707 3300049593 Bacteria 1605
596 Ga0501201_031051 3300049651 Bacteria 609
597 Ga0501079_0183796 3300049741 Bacteria 1632
598 Ga0501080_1065275 3300049742 Bacteria 699
599 Ga0501080_1151802 3300049742 Bacteria 668
600 Ga0501035_0001429 3300049822 Bacteria 24468
601 Ga0501035_0001968 3300049822 Bacteria 20568
602 Ga0501035_0009680 3300049822 Bacteria 8963
603 Ga0501035_0076193 3300049822 Bacteria 2966
604 Ga0501035_0651072 3300049822 Bacteria 854
605 Ga0501044_0000111 3300049823 Bacteria 100080
606 Ga0501044_0018048 3300049823 Bacteria 7567
607 Ga0501044_0025482 3300049823 Bacteria 6269
608 Ga0501044_0053451 3300049823 Bacteria 4155
609 Ga0501044_0259856 3300049823 Bacteria 1675
610 Ga0501044_0278379 3300049823 Bacteria 1607
611 Ga0501045_0003419 3300049824 Bacteria 10863
612 Ga0501045_0271813 3300049824 Bacteria 1262
613 nmdc:mga00v17_6047_c1 3300050491 Bacteria 6404
614 nmdc:mga0yw44_478990_c1 3300050492 Bacteria 844
615 nmdc:mga0yw44_651572_c1 3300050492 Bacteria 716
616 nmdc:mga0k408_4578_c1 3300050493 Bacteria 7341
617 nmdc:mga05p37_1595478_c1 3300050507 Bacteria 643
618 nmdc:mga05p37_899665_c1 3300050507 Bacteria 954
619 nmdc:mga05p37_907138_c1 3300050507 Bacteria 949
620 nmdc:mga09592_404646_c1 3300050508 Bacteria 1179
621 nmdc:mga0qj67_405998_c1 3300050509 Bacteria 1099
622 nmdc:mga0qj67_686457_c1 3300050509 Bacteria 815
623 nmdc:mga06r32_1649980_c1 3300050510 Bacteria 579
624 nmdc:mga06r32_970495_c1 3300050510 Bacteria 803
625 nmdc:mga08y16_342400_c1 3300050511 Bacteria 1537
626 nmdc:mga08y16_775092_c1 3300050511 Bacteria 954
627 Ga0500604_0143311 3300053151 Bacteria 809
628 Ga0500633_0251248 3300053160 Bacteria 657
629 Ga0501084_0324607 3300054114 Bacteria 1300
630 Ga0587067_160100 3300059640 Bacteria 572
631 2511349542 2511231020 Bacteria 6115223
632 2511359274 2511231021 Bacteria 7302637
633 2548648618 2547132416 Bacteria 4633861
634 2555258644 2554235234 Bacteria 5762085
635 2599410062 2599185169 Bacteria 5441380
636 2601523257 2600255254 Bacteria 5281859
637 2601528416 2600255255 Bacteria 5282785
638 2601615249 2600255280 Bacteria 5292309
639 2601619825 2600255281 Bacteria 5288753
640 2601643768 2600255287 Bacteria 5210468
641 2601648230 2600255288 Bacteria 5282738
642 2601653301 2600255289 Bacteria 5281907
643 2601658578 2600255290 Bacteria 5282218
644 2601663593 2600255291 Bacteria 5217298
645 2601696526 2600255298 Bacteria 5215185
646 2601701225 2600255299 Bacteria 5218662
647 2601705956 2600255300 Bacteria 5287774
648 2601711541 2600255301 Bacteria 5280532
649 2601716559 2600255302 Bacteria 5288235
650 2601721550 2600255303 Bacteria 5219315
651 2601726965 2600255304 Bacteria 5283973
652 2601731505 2600255305 Bacteria 5282329
653 2601736517 2600255306 Bacteria 5281613
654 2601740500 2600255307 Bacteria 5439064
655 2601751437 2600255309 Bacteria 5431045
656 2602018703 2600255392 Bacteria 5437392
657 2603644054 2602042047 Bacteria 4697674
658 2603660980 2602042052 Bacteria 5215873
659 2603666254 2602042053 Bacteria 5214361
660 2603700740 2602042066 Bacteria 4423871
661 2603704574 2602042067 Bacteria 4863713
662 2603838899 2602042103 Bacteria 5284714
663 2603843841 2602042104 Bacteria 5281639
664 2603849055 2602042105 Bacteria 5282303
665 2603854126 2602042106 Bacteria 5282744
666 2603865413 2602042109 Bacteria 5152801
667 2603872180 2602042110 Bacteria 5283285
668 2603877067 2602042111 Bacteria 5212080
669 2606049362 2603880178 Bacteria 5283018
670 2606070687 2603880184 Bacteria 5217896
671 2606147045 2603880202 Bacteria 5284684
672 2606176771 2603880211 Bacteria 5284226
673 2609911750 2609459761 Bacteria 5513740
674 2637223389 2636415599 Bacteria 5718434
675 2671104374 2667528172 Bacteria 5170840
676 2671588510 2671180115 Bacteria 5353919
677 2676408432 2675903046 Bacteria 5451247
678 2681997834 2681812866 Bacteria 4552357
679 2682007934 2681812869 Bacteria 5014465
680 2735816257 2734482258 Unclassified 2930739
681 2753857468 2751185917 Bacteria 4551186
682 2765590560 2765235842 Bacteria 4799256
683 2775540096 2775506706 Bacteria 4873073
684 2777019705 2775507074 Bacteria 5532402
685 2793404152 2791355275 Bacteria 4429597
686 2821120389 2821118458 Bacteria 4714306
687 2823376224 2823373977 Bacteria 4779415
688 2844428901 2844425489 Bacteria 4854065
689 2844530260 2844528606 Bacteria 4733806
690 2865016384 2865014394 Bacteria 4764573
691 2884087271 2884086401 Bacteria 5005459
692 2904516666 2904513164 Bacteria 5476410
693 2904551378 2904550169 Bacteria 6221258
694 2919110512 2919108558 Bacteria 5897419
695 2919497867 2919497567 Bacteria 4408621
696 2919535366 2919534386 Bacteria 4577686
697 2923636436 2923634449 Bacteria 4753480
698 2927837081 2927833300 Bacteria 4923934
699 2937541025 2937539931 Bacteria 4639830
700 2939576293 2939573065 Bacteria 4926053
701 2939610262 2939607340 Bacteria 4719256
702 2945876156 2945874760 Bacteria 5527237
703 2945951685 2945951305 Bacteria 4918162
704 2969080418 2969079654 Bacteria 5439582
705 2971821785 2971820967 Bacteria 5823634
706 2974315224 2974310843 Bacteria 4947816
707 2984562858 2984559226 Bacteria 5683096
708 2984600915 2984595703 Bacteria 5682994
709 2990197159 2990196909 Bacteria 4054280
710 3000377768 3000376612 Bacteria 4705565
711 8018225418 8018221730 Bacteria 4616064
712 8018406086 8018405270 Bacteria 4978981
713 8055089826 8055087960 Bacteria 4784273
714 8055097214 8055092621 Bacteria 4873875
715 8055098068 8055097453 Bacteria 4865496
716 Ga0436365_0042508
717 SwRhRL2b_contig_2081982
718 JGI24737J22298_10132570
719 JGI24737J22298_10249692
720 rootH2_10007961
721 rootL2_10005174
722 JGI26129J50193_1009732
723 Ga0006562J51391_1034250
724 Ga0065704_10096250
725 Ga0065704_10447131
726 Ga0065704_10589533
727 Ga0070676_10637699
728 Ga0070676_10989659
729 Ga0070683_100434434
730 Ga0070683_100506196
731 Ga0070670_100111084
732 Ga0070660_100178743
733 Ga0070660_100180346
734 Ga0070692_10149802
735 Ga0070692_10525721
736 Ga0070668_100005924
737 Ga0070674_100096087
738 Ga0070674_101547295
739 Ga0070688_100779640
740 Ga0070659_100017935
741 Ga0070659_100213804
742 Ga0070659_100259143
743 Ga0070659_100294518
744 Ga0070659_100349134
745 Ga0070659_101024490
746 Ga0070714_100029705
747 Ga0070711_100040404
748 Ga0070711_101406719
749 Ga0070700_100211893
750 Ga0070678_100649993
751 Ga0070662_100019920
752 Ga0070662_100737629
753 Ga0070681_10679253
754 Ga0068867_100094504
755 Ga0068867_100557801
756 Ga0070706_100788510
757 Ga0070698_100589616
758 Ga0070679_100535681
759 Ga0070684_100156192
760 Ga0070697_100067397
761 Ga0068853_102129852
762 Ga0068853_102215244
763 Ga0070665_100000033
764 Ga0070665_100155742
765 Ga0070665_100528192
766 Ga0070704_101118305
767 Ga0070704_101716838
768 Ga0070664_100677286
769 Ga0068857_100000005
770 Ga0068857_100552569
771 Ga0068854_100367615
772 Ga0068856_100865745
773 Ga0068856_101011039
774 Ga0070702_100421497
775 Ga0068852_100309410
776 Ga0068852_100802136
777 Ga0068852_101740695
778 Ga0068859_100654263
779 Ga0068864_100348964
780 Ga0068866_10058288
781 Ga0068866_10147682
782 Ga0068861_100148538
783 Ga0068861_100751999
784 Ga0068861_100870025
785 Ga0068851_10025488
786 Ga0068870_10068796
787 Ga0068870_10113589
788 Ga0068862_101169748
789 Ga0068862_102067149
790 Ga0081538_10153090
791 Ga0075365_10202724
792 Ga0075365_10534960
793 Ga0075365_10568514
794 Ga0075364_10008988
795 Ga0075364_10378596
796 Ga0075366_10003394
797 Ga0097621_101487504
798 Ga0075428_100520963
799 Ga0075428_100946318
800 Ga0075431_101912686
801 Ga0068865_100498683
802 Ga0097620_100654301
803 Ga0079104_1000046
804 Ga0079104_1000249
805 Ga0079104_1001023
806 Ga0079104_1001675
807 Ga0079104_1078148
808 Ga0105251_10000576
809 Ga0105251_10006603
810 Ga0105251_10025485
811 Ga0105251_10063250
812 Ga0105251_10126148
813 Ga0105244_10000091
814 Ga0105244_10039783
815 Ga0105244_10411907
816 Ga0105244_10586162
817 Ga0105250_10000095
818 Ga0105250_10044506
819 Ga0105240_10044693
820 Ga0105240_10693579
821 Ga0111539_10980384
822 Ga0111539_11394265
823 Ga0111539_12373636
824 Ga0105245_10228854
825 Ga0105245_10369589
826 Ga0105247_10269596
827 Ga0105247_10324318
828 Ga0105247_11110806
829 Ga0114129_10432163
830 Ga0114129_11562474
831 Ga0114129_11836492
832 Ga0114129_11947353
833 Ga0105243_10155174
834 Ga0105243_10336668
835 Ga0105243_11058440
836 Ga0105243_11219786
837 Ga0105242_10890407
838 Ga0105242_11471207
839 Ga0105242_13273943
840 Ga0105248_10596542
841 Ga0105248_11513262
842 Ga0105248_12053276
843 Ga0105237_10141798
844 Ga0105237_10300312
845 Ga0105238_10451230
846 Ga0105249_10422390
847 Ga0105249_11551703
848 Ga0105239_11620257
849 Ga0105239_12144592
850 Ga0105239_12274270
851 Ga0105239_13096906
852 Ga0105246_10140776
853 Ga0157373_10031197
854 Ga0157373_10215033
855 Ga0157371_10749179
856 Ga0157371_10971181
857 Ga0157370_10002672
858 Ga0157370_10003046
859 Ga0157370_11299817
860 Ga0157370_12048284
861 Ga0157374_10274843
862 Ga0157374_11789826
863 Ga0157378_10446043
864 Ga0163162_10043027
865 Ga0157372_10045700
866 Ga0157372_10532628
867 Ga0157372_10729583
868 Ga0157375_11311746
869 Ga0157375_12523485
870 Ga0163163_10332564
871 Ga0157380_10159165
872 Ga0157380_11637400
873 Ga0182008_10060110
874 Ga0157377_10126535
875 Ga0157377_10184610
876 Ga0157377_11337333
877 Ga0157376_10001159
878 Ga0157376_10119524
879 Ga0157376_10637206
880 Ga0182006_1000013
881 Ga0182006_1003907
882 Ga0182007_10030055
883 Ga0183366_1002
884 Ga0183370_1002
885 Ga0183369_1002
886 Ga0183368_1005
887 Ga0163161_10010793
888 Ga0163161_10125620
889 Ga0163161_10430225
890 Ga0163161_10433543
891 Ga0213872_10207204
892 Ga0213876_10000329
893 Ga0207426_1027655
894 Ga0207656_10008020
895 Ga0207696_1000024
896 Ga0207696_1000361
897 Ga0207655_1000044
898 Ga0207655_1000047
899 Ga0207655_1000050
900 Ga0207655_1000079
901 Ga0207655_1007857
902 Ga0207655_1041194
903 Ga0207713_1000033
904 Ga0207713_1000134
905 Ga0207713_1004277
906 Ga0207713_1017199
907 Ga0207713_1082750
908 Ga0207713_1087163
909 Ga0207682_10204939
910 Ga0207692_11197741
911 Ga0207642_10109118
912 Ga0207710_10358912
913 Ga0207688_10046036
914 Ga0207688_10187403
915 Ga0207688_10369966
916 Ga0207645_10388259
917 Ga0207643_10053083
918 Ga0207695_10200142
919 Ga0207671_10357320
920 Ga0207660_11334596
921 Ga0207657_10183351
922 Ga0207652_10633734
923 Ga0207694_10080587
924 Ga0207694_11556586
925 Ga0207650_10673351
926 Ga0207659_10453149
927 Ga0207687_10245907
928 Ga0207690_10041333
929 Ga0207690_10088511
930 Ga0207706_10055572
931 Ga0207706_10088631
932 Ga0207706_10199910
933 Ga0207706_10537879
934 Ga0207706_10661425
935 Ga0207706_10816548
936 Ga0207709_10133988
937 Ga0207709_10152812
938 Ga0207669_10070251
939 Ga0207669_10138728
940 Ga0207669_10360127
941 Ga0207704_11106452
942 Ga0207704_11111826
943 Ga0207691_10468239
944 Ga0207691_11475306
945 Ga0207689_11110740
946 Ga0207661_10990869
947 Ga0207661_11486073
948 Ga0207679_10642409
949 Ga0207712_10296010
950 Ga0207668_10221869
951 Ga0207668_10338908
952 Ga0207668_11223816
953 Ga0207677_10268898
954 Ga0207677_10603165
955 Ga0207639_10809457
956 Ga0207639_11197370
957 Ga0207678_10992686
958 Ga0207708_10008968
959 Ga0207708_10185692
960 Ga0207648_10085237
961 Ga0207648_10826533
962 Ga0207648_10867424
963 Ga0207676_10258186
964 Ga0207676_10452977
965 Ga0207674_10000523
966 Ga0207674_10370381
967 Ga0207675_100068996
968 Ga0207683_10063390
969 Ga0207683_11905155
970 Ga0207698_10513908
971 Ga0207698_11076101
972 Ga0209281_1000022
973 Ga0209281_1000048
974 Ga0209281_1000056
975 Ga0209281_1000120
976 Ga0209281_1000243
977 Ga0209281_1000422
978 Ga0209371_1000013
979 Ga0209371_1000427
980 Ga0209371_1001124
981 Ga0209371_1023428
982 Ga0209371_1032708
983 Ga0209981_1013521
984 Ga0210000_1011901
985 Ga0209995_1020402
986 Ga0209968_1004519
987 Ga0209970_1035438
988 Ga0209970_1118694
989 Ga0210002_1052775
990 Ga0209971_1010608
991 Ga0209998_10004283
992 Ga0209998_10092432
993 Ga0209974_10005674
994 Ga0207428_10037489
995 Ga0207428_10411638
996 Ga0268266_10000041
997 Ga0268266_10272578
998 Ga0268266_11374800
999 Ga0265337_1000006
1000 Ga0265326_10000066
1001 Ga0265318_10109340
1002 Ga0265322_10000001
1003 Ga0265336_10001086
1004 Ga0265336_10010847
1005 Ga0265338_10059611
1006 Ga0265324_10000090
1007 Ga0265324_10000373
1008 Ga0265324_10000563
1009 Ga0265324_10007205
1010 Ga0265324_10012755
1011 Ga0268256_1000014
1012 Ga0268256_1000363
1013 Ga0268256_1021499
1014 Ga0268256_1026531
1015 Ga0316183_1179590
1016 Ga0265330_10002315
1017 Ga0265332_10084963
1018 Ga0265332_10100953
1019 Ga0265320_10000002
1020 Ga0265320_10014802
1021 Ga0265325_10000153
1022 Ga0265329_10009135
1023 Ga0265329_10030273
1024 Ga0265340_10406738
1025 Ga0265339_10008744
1026 Ga0265339_10011323
1027 Ga0265331_10002086
1028 Ga0265331_10002830
1029 Ga0265331_10029077
1030 Ga0265331_10085731
1031 Ga0265331_10092484
1032 Ga0265331_10116328
1033 Ga0265327_10000011
1034 Ga0265327_10000557
1035 Ga0265316_10053913
1036 Ga0265316_10141965
1037 Ga0265316_10635904
1038 Ga0307408_101130955
1039 Ga0265313_10009558
1040 Ga0316575_10000218
1041 Ga0316579_10079102
1042 Ga0316579_10162879
1043 Ga0265314_10000706
1044 Ga0265314_10000726
1045 Ga0265314_10009867
1046 Ga0265314_10014960
1047 Ga0265314_10030366
1048 Ga0265342_10161542
1049 Ga0265342_10605518
1050 Ga0316576_10208429
1051 Ga0316576_10346584
1052 Ga0316576_10936803
1053 Ga0316576_11103248
1054 Ga0316578_10006169
1055 Ga0316578_10015116
1056 Ga0307405_10172546
1057 Ga0307405_12037849
1058 Ga0316577_10019864
1059 Ga0307410_10305007
1060 Ga0307410_11239125
1061 Ga0307406_10311375
1062 Ga0307406_10443369
1063 Ga0307406_10617996
1064 Ga0307409_100318026
1065 Ga0307409_100337262
1066 Ga0307409_100835000
1067 Ga0307409_100867404
1068 Ga0307409_101252014
1069 Ga0307409_101589845
1070 Ga0307416_100355281
1071 Ga0307416_100590156
1072 Ga0307416_100761242
1073 Ga0307414_10520077
1074 Ga0307411_10131892
1075 Ga0307415_100017705
1076 Ga0307415_100256525
1077 Ga0307415_100375335
1078 Ga0307415_101812081
1079 Ga0316585_10016316
1080 Ga0316580_10002910
1081 Ga0316580_10011437
1082 Ga0316593_10005031
1083 Ga0316593_10062511
1084 Ga0316592_1000666
1085 Ga0316592_1011089
1086 Ga0316588_1000764
1087 Ga0316588_1002158
1088 Ga0316588_1005250
1089 Ga0316596_1023746
1090 Ga0316596_1039709
1091 Ga0373923_0099501
1092 Ga0373939_0256780
1093 Ga0373943_0016826
1094 Ga0316574_0004273
1095 Ga0316574_0267348
1096 Ga0373937_0322391
1097 Ga0373937_0472246
1098 Ga0316582_0024850
1099 Ga0316582_0048224
1100 Ga0316584_0010338
1101 Ga0316584_0025194
1102 Ga0373925_0185656
1103 Ga0395900_0497810
1104 Ga0395900_1013836
1105 Ga0395898_0404186
1106 Ga0316581_0065812
1107 Ga0395901_1652744
1108 Ga0400490_40590
1109 Ga0400488_62682
1110 Ga0400483_220832
1111 Ga0400487_14017
1112 Ga0436361_0333442
1113 Ga0436361_0883668
1114 Ga0436361_0989063
1115 Ga0439438_003218
1116 Ga0439438_012978
1117 Ga0439447_017639
1118 Ga0439466_0000004
1119 Ga0439465_0363704
1120 Ga0451795_0594414
1121 Ga0451802_0235268
1122 Ga0451807_0974327
1123 Ga0451841_0791043
1124 Ga0451843_0406932
1125 Ga0451853_0823009
1126 Ga0451853_2427319
1127 Ga0439448_0049540
1128 Ga0439432_019605
1129 Ga0439432_027215
1130 Ga0439450_033216
1131 Ga0439452_000011
1132 Ga0439452_000344
1133 Ga0439452_002524
1134 Ga0439452_028288
1135 Ga0439463_001507
1136 Ga0450902_052006
1137 Ga0450907_000221
1138 Ga0439458_0012813
1139 Ga0439459_0026302
1140 Ga0439464_0001655
1141 Ga0439464_0010134
1142 Ga0439460_0067812
1143 Ga0451577_0000085
1144 Ga0451577_0003720
1145 Ga0451577_0089801
1146 Ga0451577_0117305
1147 Ga0451577_0129463
1148 Ga0439440_0042499
1149 Ga0466981_0000001
1150 Ga0453683_0000047
1151 Ga0466966_0074125
1152 Ga0466963_0047730
1153 Ga0466964_0169087
1154 Ga0453684_0000273
1155 Ga0453684_0000302
1156 Ga0453684_0012535
1157 Ga0453684_0173338
1158 Ga0453684_0431915
1159 Ga0466970_0704601
1160 Ga0466960_0054641
1161 Ga0466960_0183222
1162 Ga0466959_0522741
1163 Ga0451576_0000006
1164 Ga0451576_0000116
1165 Ga0451576_0000652
1166 Ga0451576_0000868
1167 Ga0451576_1271666
1168 Ga0451576_1905486
1169 Ga0466967_0170697
1170 Ga0466967_0214795
1171 Ga0466967_0499940
1172 Ga0466967_1509989
1173 Ga0495603_0000258
1174 Ga0495591_013966
1175 Ga0495641_0274632
1176 Ga0495650_0000059
1177 Ga0495596_0230626
1178 Ga0495643_0075647
1179 Ga0495648_0006032
1180 Ga0495667_0000047
1181 Ga0495668_0645974
1182 Ga0495660_0008440
1183 Ga0495672_0000025
1184 Ga0495680_0003506
1185 Ga0495679_002550
1186 Ga0495684_0127354
1187 Ga0496100_0046797
1188 Ga0496100_0220279
1189 Ga0496100_0306909
1190 Ga0496100_1008716
1191 Ga0496101_0132458
1192 Ga0496101_0672143
1193 Ga0496101_1058770
1194 Ga0496102_0473250
1195 Ga0496102_0800989
1196 Ga0496103_0333341
1197 Ga0496104_0000680
1198 Ga0496104_0811525
1199 Ga0496105_0006095
1200 Ga0496105_0009823
1201 Ga0496107_0313840
1202 Ga0496108_0050129
1203 Ga0496108_0215378
1204 Ga0496109_0046553
1205 Ga0496109_1859070
1206 Ga0496110_0453927
1207 Ga0496110_0460644
1208 Ga0496110_1058572
1209 Ga0496110_1531880
1210 Ga0496110_1812624
1211 Ga0496113_0462794
1212 Ga0496113_0559873
1213 Ga0496114_0004317
1214 Ga0496114_0007017
1215 Ga0496115_1344821
1216 Ga0496116_0002364
1217 Ga0496116_0067587
1218 Ga0496116_0105035
1219 Ga0496117_0000168
1220 Ga0496118_0000075
1221 Ga0496118_0000304
1222 Ga0496118_0000996
1223 Ga0496119_0000281
1224 Ga0496119_0017781
1225 Ga0496120_0000363
1226 Ga0496120_0013938
1227 Ga0496120_0147265
1228 Ga0496121_0000057
1229 Ga0496121_0020822
1230 Ga0496121_0669107
1231 Ga0496122_0002021
1232 Ga0496122_0002096
1233 Ga0496122_0043786
1234 Ga0496122_0069982
1235 Ga0496123_0000605
1236 Ga0496123_0002325
1237 Ga0496123_0031853
1238 Ga0496123_0472030
1239 Ga0496124_0001851
1240 Ga0496124_0133469
1241 Ga0496124_0177748
1242 Ga0496125_0000081
1243 Ga0496125_0003562
1244 Ga0496125_0007362
1245 Ga0496125_0022828
1246 Ga0496126_0001662
1247 Ga0496126_0005302
1248 Ga0496126_0155487
1249 Ga0496126_0394059
1250 Ga0496126_0408706
1251 Ga0501031_0004039
1252 Ga0501031_0008281
1253 Ga0501031_0058685
1254 Ga0501031_0110192
1255 Ga0501032_0001373
1256 Ga0501032_0007089
1257 Ga0501032_0059099
1258 Ga0501033_0000949
1259 Ga0501033_0001864
1260 Ga0501033_0059974
1261 Ga0501033_0699024
1262 Ga0501034_0024559
1263 Ga0501034_0047437
1264 Ga0501034_0173483
1265 Ga0501034_0541825
1266 Ga0501036_0000382
1267 Ga0501036_0001661
1268 Ga0501036_0035605
1269 Ga0501037_0000474
1270 Ga0501037_0051116
1271 Ga0501037_0193442
1272 Ga0501037_0358177
1273 Ga0501037_0711826
1274 Ga0501038_0008209
1275 Ga0501038_0019437
1276 Ga0501038_0023864
1277 Ga0501038_0076883
1278 Ga0501038_0130565
1279 Ga0501038_0137944
1280 Ga0501038_0336957
1281 Ga0501039_0002238
1282 Ga0501039_0037165
1283 Ga0501039_0043176
1284 Ga0501039_0044783
1285 Ga0501040_0003365
1286 Ga0501040_0076944
1287 Ga0501041_1016395
1288 Ga0501042_0084446
1289 Ga0501042_0825969
1290 Ga0501043_0007578
1291 Ga0501043_0008971
1292 Ga0501043_0083051
1293 Ga0501046_0002898
1294 Ga0501046_0011564
1295 Ga0501046_0700086
1296 Ga0501047_0005810
1297 Ga0501047_0108224
1298 Ga0501048_0059590
1299 Ga0501048_0400031
1300 Ga0501068_0002905
1301 Ga0501068_0172686
1302 Ga0501070_0429924
1303 Ga0501071_0472784
1304 Ga0501071_0757423
1305 Ga0501072_0034667
1306 Ga0501073_0642907
1307 Ga0501074_0313318
1308 Ga0501075_0444772
1309 Ga0501076_0630063
1310 Ga0501077_0128707
1311 Ga0501201_031051
1312 Ga0501079_0183796
1313 Ga0501080_1065275
1314 Ga0501080_1151802
1315 Ga0501035_0001429
1316 Ga0501035_0001968
1317 Ga0501035_0009680
1318 Ga0501035_0076193
1319 Ga0501035_0651072
1320 Ga0501044_0000111
1321 Ga0501044_0018048
1322 Ga0501044_0025482
1323 Ga0501044_0053451
1324 Ga0501044_0259856
1325 Ga0501044_0278379
1326 Ga0501045_0003419
1327 Ga0501045_0271813
1328 nmdc:mga00v17_6047_c1
1329 nmdc:mga0yw44_478990_c1
1330 nmdc:mga0yw44_651572_c1
1331 nmdc:mga0k408_4578_c1
1332 nmdc:mga05p37_1595478_c1
1333 nmdc:mga05p37_899665_c1
1334 nmdc:mga05p37_907138_c1
1335 nmdc:mga09592_404646_c1
1336 nmdc:mga0qj67_405998_c1
1337 nmdc:mga0qj67_686457_c1
1338 nmdc:mga06r32_1649980_c1
1339 nmdc:mga06r32_970495_c1
1340 nmdc:mga08y16_342400_c1
1341 nmdc:mga08y16_775092_c1
1342 Ga0500604_0143311
1343 Ga0500633_0251248
1344 Ga0501084_0324607
1345 Ga0587067_160100
1346 2511349542
1347 2511359274
1348 2548648618
1349 2555258644
1350 2599410062
1351 2601523257
1352 2601528416
1353 2601615249
1354 2601619825
1355 2601643768
1356 2601648230
1357 2601653301
1358 2601658578
1359 2601663593
1360 2601696526
1361 2601701225
1362 2601705956
1363 2601711541
1364 2601716559
1365 2601721550
1366 2601726965
1367 2601731505
1368 2601736517
1369 2601740500
1370 2601751437
1371 2602018703
1372 2603644054
1373 2603660980
1374 2603666254
1375 2603700740
1376 2603704574
1377 2603838899
1378 2603843841
1379 2603849055
1380 2603854126
1381 2603865413
1382 2603872180
1383 2603877067
1384 2606049362
1385 2606070687
1386 2606147045
1387 2606176771
1388 2609911750
1389 2637223389
1390 2671104374
1391 2671588510
1392 2676408432
1393 2681997834
1394 2682007934
1395 2735816257
1396 2753857468
1397 2765590560
1398 2775540096
1399 2777019705
1400 2793404152
1401 2821120389
1402 2823376224
1403 2844428901
1404 2844530260
1405 2865016384
1406 2884087271
1407 2904516666
1408 2904551378
1409 2919110512
1410 2919497867
1411 2919535366
1412 2923636436
1413 2927837081
1414 2937541025
1415 2939576293
1416 2939610262
1417 2945876156
1418 2945951685
1419 2969080418
1420 2971821785
1421 2974315224
1422 2984562858
1423 2984600915
1424 2990197159
1425 3000377768
1426 8018225418
1427 8018406086
1428 8055089826
1429 8055097214
1430 8055098068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

26

147

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9901 3 127
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9896 3 129
3a7a-assembly2.cif.gz_D crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9871 3 129
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9845 3 128
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9827 2 128
ID Description Score Start End Superfamily
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9855 2 127 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9835 8 125 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9806 8 128 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9715 38 129 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9701 2 127 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3N5GR25-F1-model_v4 Glycine cleavage system H protein 0.9989 3 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A6I6IGN9-F1-model_v4 deleted 0.9976 1 127
AF-A0A3M0Z9B7-F1-model_v4 Glycine cleavage system H protein 0.9976 3 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A6N9B0N4-F1-model_v4 Glycine cleavage system H protein 0.9975 1 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A6A5KVE9-F1-model_v4 deleted 0.9974 1 117

Map