F477015

General Info

Members Datasets Scaffolds Average Seq Length
715 230 1430 226

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0017943|Ga0501070_0017943_1073_1744
Length 223
Sequence MTHYLPLLGILIVVVGFAKRWNPMLVVTVSALATGLLAGMNVVTVIETFGRAFNDNRLIAIVWVVLPAIGLLERFGLQERAATLIRGFKAATAGRLLILYMIFRQITAALGLTSIAGHAQTVRPLVAPMALGAAEKEHEIDDASREKVKAWSAATDNVGVFFGEDIFIAVGSIVLIQVTLASEGYDLRPLDLALWAIPSAIAAFVIHAFRLSRLDRTLRRRRK

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
224 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 5.03
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0017943 3300049586 Bacteria 5941
2 JGI24746J21847_1002522 3300001977 Bacteria 2912
3 JGI24740J21852_10027118 3300001979 Bacteria 1910
4 JGI24739J22299_10007526 3300001989 Bacteria 4082
5 JGI24737J22298_10000047 3300001990 Bacteria 34593
6 JGI24743J22301_10044042 3300001991 Bacteria 900
7 JGI24748J21848_1012498 3300002074 Bacteria 1002
8 JGI24738J21930_10000372 3300002075 Bacteria 12499
9 JGI24738J21930_10060419 3300002075 Bacteria 778
10 JGI24749J21850_1003851 3300002076 Bacteria 2094
11 Ga0065712_10072772 3300005290 Bacteria 4622
12 Ga0065712_10244397 3300005290 Bacteria 975
13 Ga0065715_10000733 3300005293 Bacteria 14824
14 Ga0065715_10035676 3300005293 Bacteria 1214
15 Ga0065715_10185321 3300005293 Bacteria 1449
16 Ga0065715_10517741 3300005293 Bacteria 766
17 Ga0070658_10008982 3300005327 Bacteria 8033
18 Ga0070658_10031852 3300005327 Bacteria 4237
19 Ga0070658_10032042 3300005327 Bacteria 4226
20 Ga0070658_10217118 3300005327 Bacteria 1616
21 Ga0070658_10400004 3300005327 Bacteria 1180
22 Ga0070658_10529231 3300005327 Bacteria 1019
23 Ga0070676_10001347 3300005328 Bacteria 12342
24 Ga0070676_10028208 3300005328 Bacteria 3188
25 Ga0070676_10165867 3300005328 Bacteria 1425
26 Ga0070676_10633985 3300005328 Bacteria 774
27 Ga0070683_100109299 3300005329 Bacteria 2608
28 Ga0070690_100000372 3300005330 Bacteria 22887
29 Ga0070690_100070233 3300005330 Bacteria 2274
30 Ga0070670_100009092 3300005331 Bacteria 8491
31 Ga0070670_100010969 3300005331 Bacteria 7741
32 Ga0070670_100027841 3300005331 Bacteria 4863
33 Ga0070670_100036139 3300005331 Bacteria 4252
34 Ga0070670_100079725 3300005331 Bacteria 2814
35 Ga0070670_100174554 3300005331 Bacteria 1865
36 Ga0070670_100201640 3300005331 Bacteria 1729
37 Ga0070670_100266843 3300005331 Bacteria 1493
38 Ga0070670_100318423 3300005331 Bacteria 1362
39 Ga0070677_10007650 3300005333 Bacteria 3615
40 Ga0068869_100000611 3300005334 Bacteria 20169
41 Ga0068869_100225661 3300005334 Bacteria 1487
42 Ga0070666_10031373 3300005335 Bacteria 3508
43 Ga0070680_100114948 3300005336 Bacteria 2242
44 Ga0070680_100134077 3300005336 Bacteria 2073
45 Ga0070682_100162193 3300005337 Bacteria 1545
46 Ga0068868_100001045 3300005338 Bacteria 18935
47 Ga0068868_100852691 3300005338 Bacteria 825
48 Ga0070660_100002566 3300005339 Bacteria 12451
49 Ga0070660_100009420 3300005339 Bacteria 6868
50 Ga0070660_100014944 3300005339 Bacteria 5601
51 Ga0070660_100061058 3300005339 Bacteria 2926
52 Ga0070660_100061697 3300005339 Bacteria 2911
53 Ga0070660_100101289 3300005339 Bacteria 2282
54 Ga0070660_100666605 3300005339 Bacteria 871
55 Ga0070689_100008843 3300005340 Bacteria 7115
56 Ga0070661_100001960 3300005344 Bacteria 14220
57 Ga0070661_100082104 3300005344 Bacteria 2380
58 Ga0070661_100135241 3300005344 Bacteria 1854
59 Ga0070661_100598890 3300005344 Bacteria 891
60 Ga0070692_10075217 3300005345 Bacteria 1808
61 Ga0070692_10253144 3300005345 Bacteria 1055
62 Ga0070668_100003373 3300005347 Bacteria 11777
63 Ga0070668_100014570 3300005347 Bacteria 5876
64 Ga0070668_100104002 3300005347 Bacteria 2253
65 Ga0070668_100154037 3300005347 Bacteria 1861
66 Ga0070668_100179175 3300005347 Bacteria 1730
67 Ga0070669_100000714 3300005353 Bacteria 24315
68 Ga0070669_100133563 3300005353 Bacteria 1907
69 Ga0070669_100163421 3300005353 Bacteria 1732
70 Ga0070669_100269047 3300005353 Bacteria 1362
71 Ga0070669_100728017 3300005353 Bacteria 839
72 Ga0070675_100000410 3300005354 Bacteria 29182
73 Ga0070675_100000886 3300005354 Bacteria 21295
74 Ga0070675_100077893 3300005354 Bacteria 2760
75 Ga0070671_100003073 3300005355 Bacteria 12979
76 Ga0070671_100008231 3300005355 Bacteria 8344
77 Ga0070671_100010842 3300005355 Bacteria 7312
78 Ga0070671_100053604 3300005355 Bacteria 3353
79 Ga0070671_100158169 3300005355 Bacteria 1915
80 Ga0070671_100184633 3300005355 Bacteria 1766
81 Ga0070671_100259910 3300005355 Bacteria 1476
82 Ga0070671_100380383 3300005355 Bacteria 1206
83 Ga0070671_100444548 3300005355 Bacteria 1112
84 Ga0070674_100030751 3300005356 Bacteria 3551
85 Ga0070674_100048004 3300005356 Bacteria 2929
86 Ga0070674_100090347 3300005356 Bacteria 2209
87 Ga0070674_100476027 3300005356 Bacteria 1036
88 Ga0070674_100693325 3300005356 Bacteria 870
89 Ga0070673_100001046 3300005364 Bacteria 15704
90 Ga0070673_100007989 3300005364 Bacteria 7009
91 Ga0070673_100024972 3300005364 Bacteria 4390
92 Ga0070673_100062740 3300005364 Bacteria 2954
93 Ga0070673_100154640 3300005364 Bacteria 1945
94 Ga0070673_100193378 3300005364 Bacteria 1749
95 Ga0070659_100000021 3300005366 Bacteria 154212
96 Ga0070659_100007406 3300005366 Bacteria 7973
97 Ga0070659_100011596 3300005366 Bacteria 6525
98 Ga0070659_100388253 3300005366 Bacteria 1177
99 Ga0070659_100496866 3300005366 Bacteria 1039
100 Ga0070667_100005524 3300005367 Bacteria 10557
101 Ga0070667_100014047 3300005367 Bacteria 6617
102 Ga0070667_100043278 3300005367 Bacteria 3779
103 Ga0070667_100085455 3300005367 Bacteria 2706
104 Ga0070667_100106537 3300005367 Bacteria 2426
105 Ga0070667_100186621 3300005367 Bacteria 1835
106 Ga0070667_100304510 3300005367 Bacteria 1435
107 Ga0070667_100631945 3300005367 Bacteria 988
108 Ga0070701_10024626 3300005438 Bacteria 2913
109 Ga0070700_100576517 3300005441 Bacteria 878
110 Ga0070663_100022041 3300005455 Bacteria 4251
111 Ga0070663_100024903 3300005455 Bacteria 4034
112 Ga0070663_100037599 3300005455 Bacteria 3371
113 Ga0070678_100248661 3300005456 Bacteria 1490
114 Ga0070662_100000230 3300005457 Bacteria 32939
115 Ga0070662_100000323 3300005457 Bacteria 28556
116 Ga0070662_100001313 3300005457 Bacteria 15282
117 Ga0070662_100016400 3300005457 Bacteria 4974
118 Ga0070662_100033073 3300005457 Bacteria 3639
119 Ga0070662_100185615 3300005457 Bacteria 1642
120 Ga0070662_100227514 3300005457 Bacteria 1491
121 Ga0070662_100347260 3300005457 Bacteria 1215
122 Ga0070662_100450537 3300005457 Bacteria 1068
123 Ga0068867_100017503 3300005459 Bacteria 5090
124 Ga0068867_100056938 3300005459 Bacteria 2894
125 Ga0068867_100304397 3300005459 Bacteria 1315
126 Ga0068867_100661267 3300005459 Bacteria 918
127 Ga0070679_100044580 3300005530 Bacteria 4418
128 Ga0070679_100323362 3300005530 Bacteria 1491
129 Ga0070684_100931190 3300005535 Bacteria 814
130 Ga0068853_100026737 3300005539 Bacteria 4847
131 Ga0068853_100042142 3300005539 Bacteria 3902
132 Ga0068853_100443197 3300005539 Bacteria 1220
133 Ga0068853_100637611 3300005539 Bacteria 1013
134 Ga0070672_100000508 3300005543 Bacteria 22754
135 Ga0070672_100009872 3300005543 Bacteria 6598
136 Ga0070672_100025952 3300005543 Bacteria 4352
137 Ga0070672_100273921 3300005543 Bacteria 1426
138 Ga0070672_100473434 3300005543 Bacteria 1081
139 Ga0070696_100309137 3300005546 Bacteria 1213
140 Ga0070665_100011722 3300005548 Bacteria 8859
141 Ga0070665_100058161 3300005548 Bacteria 3876
142 Ga0070665_100342291 3300005548 Bacteria 1500
143 Ga0070665_100366339 3300005548 Bacteria 1448
144 Ga0068855_100019497 3300005563 Bacteria 8151
145 Ga0070664_100018766 3300005564 Bacteria 5689
146 Ga0070664_100087508 3300005564 Bacteria 2693
147 Ga0070664_100182654 3300005564 Bacteria 1865
148 Ga0070664_100297385 3300005564 Bacteria 1458
149 Ga0070664_100445846 3300005564 Bacteria 1188
150 Ga0070664_100571663 3300005564 Bacteria 1047
151 Ga0068857_100011615 3300005577 Bacteria 7661
152 Ga0068857_100025431 3300005577 Bacteria 5213
153 Ga0068854_100004617 3300005578 Bacteria 8689
154 Ga0068854_100012010 3300005578 Bacteria 5660
155 Ga0068854_100033858 3300005578 Bacteria 3564
156 Ga0068854_100039621 3300005578 Bacteria 3321
157 Ga0068854_100088838 3300005578 Bacteria 2295
158 Ga0068854_100595056 3300005578 Bacteria 943
159 Ga0068854_100816743 3300005578 Bacteria 814
160 Ga0068856_100025809 3300005614 Bacteria 5729
161 Ga0068856_100116791 3300005614 Bacteria 2669
162 Ga0068856_101306306 3300005614 Bacteria 741
163 Ga0068852_100019281 3300005616 Bacteria 5394
164 Ga0068852_100029754 3300005616 Bacteria 4489
165 Ga0068852_100051312 3300005616 Bacteria 3539
166 Ga0068852_100174645 3300005616 Bacteria 2016
167 Ga0068852_100303065 3300005616 Bacteria 1547
168 Ga0068859_100008141 3300005617 Bacteria 10630
169 Ga0068859_100009314 3300005617 Bacteria 9916
170 Ga0068859_100280832 3300005617 Bacteria 1758
171 Ga0068859_100402669 3300005617 Bacteria 1464
172 Ga0068864_100000222 3300005618 Bacteria 51430
173 Ga0068864_100001115 3300005618 Bacteria 22458
174 Ga0068864_100004739 3300005618 Bacteria 11138
175 Ga0068864_100054570 3300005618 Bacteria 3449
176 Ga0068864_100662690 3300005618 Bacteria 1017
177 Ga0068864_100715404 3300005618 Bacteria 979
178 Ga0068866_10005239 3300005718 Bacteria 5342
179 Ga0068866_10351702 3300005718 Bacteria 936
180 Ga0068861_100219925 3300005719 Bacteria 1604
181 Ga0068851_10043059 3300005834 Bacteria 2275
182 Ga0068863_100002567 3300005841 Bacteria 18003
183 Ga0068863_100013196 3300005841 Bacteria 7969
184 Ga0068863_100152830 3300005841 Bacteria 2209
185 Ga0068863_100303697 3300005841 Bacteria 1548
186 Ga0068863_100313019 3300005841 Bacteria 1524
187 Ga0068863_100423340 3300005841 Bacteria 1305
188 Ga0068858_100003320 3300005842 Bacteria 16021
189 Ga0068858_100146480 3300005842 Bacteria 2218
190 Ga0068858_100353755 3300005842 Bacteria 1407
191 Ga0068860_100064405 3300005843 Bacteria 3481
192 Ga0068860_100117578 3300005843 Bacteria 2544
193 Ga0068860_100211121 3300005843 Bacteria 1883
194 Ga0068860_100350247 3300005843 Bacteria 1453
195 Ga0068862_100169664 3300005844 Bacteria 1953
196 Ga0068862_100238216 3300005844 Bacteria 1653
197 Ga0068862_100238425 3300005844 Bacteria 1653
198 Ga0068862_100253847 3300005844 Bacteria 1603
199 Ga0081539_10028935 3300005985 Bacteria 3475
200 Ga0097621_100158221 3300006237 Bacteria 1946
201 Ga0068871_100403178 3300006358 Bacteria 1218
202 Ga0068865_100345570 3300006881 Bacteria 1203
203 Ga0097620_100008141 3300006931 Bacteria 10630
204 Ga0097620_100009314 3300006931 Bacteria 9916
205 Ga0097620_100280806 3300006931 Bacteria 1758
206 Ga0097620_100402666 3300006931 Bacteria 1464
207 Ga0105240_10023020 3300009093 Bacteria 8250
208 Ga0111539_10137611 3300009094 Bacteria 2860
209 Ga0105245_10001658 3300009098 Bacteria 20254
210 Ga0105245_10046112 3300009098 Bacteria 3895
211 Ga0105245_10053401 3300009098 Bacteria 3627
212 Ga0105245_10189737 3300009098 Bacteria 1968
213 Ga0105241_10066300 3300009174 Bacteria 2791
214 Ga0105241_10233302 3300009174 Bacteria 1552
215 Ga0105248_10001119 3300009177 Bacteria 29831
216 Ga0105248_10036445 3300009177 Bacteria 5501
217 Ga0105248_10059638 3300009177 Bacteria 4286
218 Ga0105248_10060136 3300009177 Bacteria 4265
219 Ga0105248_10071031 3300009177 Bacteria 3910
220 Ga0105248_10175391 3300009177 Bacteria 2416
221 Ga0105248_10178870 3300009177 Bacteria 2390
222 Ga0105237_10006758 3300009545 Bacteria 12663
223 Ga0105237_10402871 3300009545 Bacteria 1373
224 Ga0105238_10002196 3300009551 Bacteria 19711
225 Ga0105238_10025471 3300009551 Bacteria 6030
226 Ga0105238_10031614 3300009551 Bacteria 5389
227 Ga0105238_10109475 3300009551 Bacteria 2744
228 Ga0105249_10008569 3300009553 Bacteria 8917
229 Ga0105246_10036861 3300011119 Bacteria 3278
230 Ga0157373_10010749 3300013100 Bacteria 6735
231 Ga0157373_10055444 3300013100 Bacteria 2816
232 Ga0157373_10062686 3300013100 Bacteria 2633
233 Ga0157373_10529498 3300013100 Bacteria 853
234 Ga0157371_10106361 3300013102 Bacteria 1991
235 Ga0157371_10113352 3300013102 Bacteria 1925
236 Ga0157371_10219133 3300013102 Bacteria 1366
237 Ga0157371_10350798 3300013102 Bacteria 1074
238 Ga0157371_10398554 3300013102 Bacteria 1007
239 Ga0157370_10183127 3300013104 Bacteria 1946
240 Ga0157370_10305643 3300013104 Bacteria 1468
241 Ga0157369_10003181 3300013105 Bacteria 19593
242 Ga0157369_10535041 3300013105 Bacteria 1211
243 Ga0157378_10094973 3300013297 Bacteria 2715
244 Ga0157378_10209951 3300013297 Bacteria 1846
245 Ga0163162_10391397 3300013306 Bacteria 1523
246 Ga0157372_10011784 3300013307 Bacteria 9314
247 Ga0157372_10168146 3300013307 Bacteria 2536
248 Ga0157372_10573876 3300013307 Bacteria 1315
249 Ga0157375_10040160 3300013308 Bacteria 4509
250 Ga0157375_11197219 3300013308 Bacteria 891
251 Ga0163163_10003326 3300014325 Bacteria 13638
252 Ga0163163_10021332 3300014325 Bacteria 6111
253 Ga0163163_10129995 3300014325 Bacteria 2558
254 Ga0157380_10000743 3300014326 Bacteria 20330
255 Ga0157380_10002497 3300014326 Bacteria 12394
256 Ga0157380_10029231 3300014326 Bacteria 4211
257 Ga0157380_10209276 3300014326 Bacteria 1737
258 Ga0157380_10376484 3300014326 Bacteria 1338
259 Ga0157380_10705637 3300014326 Bacteria 1014
260 Ga0157376_10645696 3300014969 Bacteria 1058
261 Ga0163161_10010380 3300017792 Bacteria 6449
262 Ga0163161_10101172 3300017792 Bacteria 2146
263 Ga0213876_10007897 3300021384 Bacteria 5772
264 Ga0207673_1004390 3300025290 Bacteria 1687
265 Ga0207697_10002140 3300025315 Bacteria 10364
266 Ga0207697_10029517 3300025315 Bacteria 2244
267 Ga0207656_10123072 3300025321 Bacteria 1209
268 Ga0207682_10000869 3300025893 Bacteria 14040
269 Ga0207682_10118585 3300025893 Bacteria 1172
270 Ga0207642_10005370 3300025899 Bacteria 4178
271 Ga0207688_10000145 3300025901 Bacteria 29979
272 Ga0207688_10025228 3300025901 Bacteria 3264
273 Ga0207680_10001780 3300025903 Bacteria 10171
274 Ga0207680_10054433 3300025903 Bacteria 2407
275 Ga0207680_10082683 3300025903 Bacteria 2021
276 Ga0207647_10000832 3300025904 Bacteria 23993
277 Ga0207647_10008958 3300025904 Bacteria 7129
278 Ga0207645_10003931 3300025907 Bacteria 11101
279 Ga0207645_10009522 3300025907 Bacteria 6714
280 Ga0207645_10046176 3300025907 Bacteria 2783
281 Ga0207645_10185619 3300025907 Bacteria 1365
282 Ga0207645_10200692 3300025907 Bacteria 1312
283 Ga0207643_10344105 3300025908 Bacteria 935
284 Ga0207705_10011733 3300025909 Bacteria 6329
285 Ga0207705_10012021 3300025909 Bacteria 6254
286 Ga0207705_10016053 3300025909 Bacteria 5376
287 Ga0207705_10023710 3300025909 Bacteria 4378
288 Ga0207705_10064097 3300025909 Bacteria 2656
289 Ga0207705_10092739 3300025909 Bacteria 2213
290 Ga0207707_10139696 3300025912 Bacteria 2118
291 Ga0207707_10364111 3300025912 Bacteria 1245
292 Ga0207695_10050007 3300025913 Bacteria 4400
293 Ga0207660_10028845 3300025917 Bacteria 3801
294 Ga0207657_10000743 3300025919 Bacteria 34553
295 Ga0207657_10011975 3300025919 Bacteria 8581
296 Ga0207657_10014502 3300025919 Bacteria 7687
297 Ga0207657_10024925 3300025919 Bacteria 5526
298 Ga0207657_10059180 3300025919 Bacteria 3294
299 Ga0207657_10099384 3300025919 Bacteria 2417
300 Ga0207657_10216786 3300025919 Bacteria 1535
301 Ga0207649_10096475 3300025920 Bacteria 1948
302 Ga0207649_10175178 3300025920 Bacteria 1497
303 Ga0207652_10036238 3300025921 Bacteria 4170
304 Ga0207652_10188404 3300025921 Bacteria 1855
305 Ga0207681_10000376 3300025923 Bacteria 31532
306 Ga0207681_10002452 3300025923 Bacteria 11758
307 Ga0207681_10018170 3300025923 Bacteria 4428
308 Ga0207681_10121239 3300025923 Bacteria 1918
309 Ga0207681_10134073 3300025923 Bacteria 1835
310 Ga0207681_10368048 3300025923 Bacteria 1154
311 Ga0207694_10000776 3300025924 Bacteria 28653
312 Ga0207694_10026504 3300025924 Bacteria 4410
313 Ga0207694_10288538 3300025924 Bacteria 1349
314 Ga0207650_10002939 3300025925 Bacteria 11756
315 Ga0207650_10008951 3300025925 Bacteria 6843
316 Ga0207650_10019269 3300025925 Bacteria 4791
317 Ga0207650_10053332 3300025925 Bacteria 2997
318 Ga0207650_10233392 3300025925 Bacteria 1485
319 Ga0207659_10000215 3300025926 Bacteria 34824
320 Ga0207659_10001902 3300025926 Bacteria 12388
321 Ga0207659_10051447 3300025926 Bacteria 2930
322 Ga0207687_10020192 3300025927 Bacteria 4419
323 Ga0207687_10023369 3300025927 Bacteria 4120
324 Ga0207687_10084918 3300025927 Bacteria 2295
325 Ga0207644_10000612 3300025931 Bacteria 22729
326 Ga0207644_10002558 3300025931 Bacteria 11707
327 Ga0207644_10005478 3300025931 Bacteria 8266
328 Ga0207644_10005992 3300025931 Bacteria 7922
329 Ga0207644_10022006 3300025931 Bacteria 4349
330 Ga0207644_10053555 3300025931 Bacteria 2904
331 Ga0207644_10091559 3300025931 Bacteria 2268
332 Ga0207644_10140559 3300025931 Bacteria 1859
333 Ga0207644_10169938 3300025931 Unclassified 1701
334 Ga0207644_10250611 3300025931 Bacteria 1413
335 Ga0207644_10347393 3300025931 Bacteria 1204
336 Ga0207644_10453246 3300025931 Bacteria 1054
337 Ga0207644_10530197 3300025931 Bacteria 973
338 Ga0207690_10000030 3300025932 Bacteria 156832
339 Ga0207690_10026431 3300025932 Bacteria 3655
340 Ga0207690_10041864 3300025932 Bacteria 3005
341 Ga0207690_10055688 3300025932 Bacteria 2664
342 Ga0207690_10294284 3300025932 Bacteria 1268
343 Ga0207690_10336178 3300025932 Bacteria 1191
344 Ga0207706_10000557 3300025933 Bacteria 39725
345 Ga0207706_10000829 3300025933 Bacteria 32031
346 Ga0207706_10009237 3300025933 Bacteria 9061
347 Ga0207706_10010852 3300025933 Bacteria 8311
348 Ga0207706_10123230 3300025933 Bacteria 2280
349 Ga0207706_10194726 3300025933 Bacteria 1778
350 Ga0207706_10292546 3300025933 Bacteria 1420
351 Ga0207706_10437820 3300025933 Bacteria 1132
352 Ga0207706_10530481 3300025933 Bacteria 1015
353 Ga0207670_10013473 3300025936 Bacteria 4824
354 Ga0207669_10084228 3300025937 Bacteria 2048
355 Ga0207669_10130422 3300025937 Bacteria 1726
356 Ga0207669_10149598 3300025937 Bacteria 1633
357 Ga0207704_10291486 3300025938 Bacteria 1245
358 Ga0207691_10000143 3300025940 Bacteria 65645
359 Ga0207691_10003013 3300025940 Bacteria 16442
360 Ga0207691_10003632 3300025940 Bacteria 14973
361 Ga0207691_10040889 3300025940 Bacteria 4283
362 Ga0207691_10215013 3300025940 Bacteria 1668
363 Ga0207711_10002065 3300025941 Bacteria 18165
364 Ga0207711_10009128 3300025941 Bacteria 8280
365 Ga0207711_10012266 3300025941 Bacteria 7125
366 Ga0207711_10023955 3300025941 Bacteria 5109
367 Ga0207711_10030792 3300025941 Bacteria 4526
368 Ga0207711_10089443 3300025941 Bacteria 2705
369 Ga0207711_10138392 3300025941 Bacteria 2188
370 Ga0207711_10472273 3300025941 Unclassified 1168
371 Ga0207689_10000017 3300025942 Bacteria 117159
372 Ga0207661_10193148 3300025944 Bacteria 1786
373 Ga0207661_10930350 3300025944 Bacteria 801
374 Ga0207679_10002720 3300025945 Bacteria 10933
375 Ga0207679_10008561 3300025945 Bacteria 6518
376 Ga0207679_10039037 3300025945 Bacteria 3388
377 Ga0207679_10060491 3300025945 Bacteria 2815
378 Ga0207679_10166327 3300025945 Bacteria 1811
379 Ga0207679_10200894 3300025945 Bacteria 1665
380 Ga0207679_10246301 3300025945 Bacteria 1517
381 Ga0207679_10250288 3300025945 Bacteria 1506
382 Ga0207679_10315871 3300025945 Bacteria 1351
383 Ga0207667_10045546 3300025949 Bacteria 4645
384 Ga0207667_10236894 3300025949 Bacteria 1868
385 Ga0207651_10002362 3300025960 Bacteria 9004
386 Ga0207651_10012623 3300025960 Bacteria 4791
387 Ga0207651_10012938 3300025960 Bacteria 4749
388 Ga0207651_10077140 3300025960 Bacteria 2384
389 Ga0207712_10173170 3300025961 Bacteria 1689
390 Ga0207668_10000233 3300025972 Bacteria 37280
391 Ga0207668_10085470 3300025972 Bacteria 2302
392 Ga0207668_10155772 3300025972 Bacteria 1775
393 Ga0207668_10191419 3300025972 Bacteria 1621
394 Ga0207668_10195388 3300025972 Bacteria 1607
395 Ga0207640_10013794 3300025981 Bacteria 4640
396 Ga0207640_10031528 3300025981 Bacteria 3276
397 Ga0207640_10067955 3300025981 Bacteria 2387
398 Ga0207640_10317761 3300025981 Bacteria 1238
399 Ga0207658_10007010 3300025986 Bacteria 7675
400 Ga0207658_10019412 3300025986 Bacteria 4701
401 Ga0207658_10029098 3300025986 Bacteria 3897
402 Ga0207658_10037172 3300025986 Bacteria 3496
403 Ga0207658_10185292 3300025986 Bacteria 1726
404 Ga0207658_10444212 3300025986 Bacteria 1147
405 Ga0207658_10526936 3300025986 Bacteria 1055
406 Ga0207677_10000336 3300026023 Bacteria 33858
407 Ga0207677_10001815 3300026023 Bacteria 11286
408 Ga0207677_10025277 3300026023 Bacteria 3702
409 Ga0207677_10223566 3300026023 Bacteria 1511
410 Ga0207703_10009234 3300026035 Bacteria 7753
411 Ga0207703_10010554 3300026035 Bacteria 7222
412 Ga0207639_10000554 3300026041 Bacteria 25675
413 Ga0207639_10078001 3300026041 Bacteria 2613
414 Ga0207678_10008367 3300026067 Bacteria 9124
415 Ga0207678_10043798 3300026067 Bacteria 3872
416 Ga0207678_10109021 3300026067 Bacteria 2362
417 Ga0207678_10160866 3300026067 Bacteria 1918
418 Ga0207678_10766354 3300026067 Bacteria 851
419 Ga0207702_10089285 3300026078 Bacteria 2695
420 Ga0207702_10555970 3300026078 Bacteria 1123
421 Ga0207641_10010018 3300026088 Bacteria 7795
422 Ga0207641_10023683 3300026088 Bacteria 5059
423 Ga0207641_10173730 3300026088 Bacteria 1969
424 Ga0207641_10381800 3300026088 Bacteria 1349
425 Ga0207641_10536749 3300026088 Bacteria 1139
426 Ga0207641_10542357 3300026088 Bacteria 1133
427 Ga0207648_10003142 3300026089 Bacteria 17423
428 Ga0207648_10017498 3300026089 Bacteria 6519
429 Ga0207676_10003030 3300026095 Bacteria 11986
430 Ga0207676_10013865 3300026095 Bacteria 5787
431 Ga0207676_10126772 3300026095 Bacteria 2163
432 Ga0207676_10650683 3300026095 Bacteria 1017
433 Ga0207674_10010363 3300026116 Bacteria 10564
434 Ga0207674_10146122 3300026116 Bacteria 2323
435 Ga0207674_10531797 3300026116 Bacteria 1136
436 Ga0207675_100064800 3300026118 Bacteria 3415
437 Ga0207675_100066434 3300026118 Bacteria 3371
438 Ga0207675_100260193 3300026118 Bacteria 1681
439 Ga0207683_10291185 3300026121 Bacteria 1493
440 Ga0207683_10594682 3300026121 Bacteria 1024
441 Ga0207683_10833433 3300026121 Unclassified 856
442 Ga0207698_10006901 3300026142 Bacteria 7105
443 Ga0207698_10018376 3300026142 Bacteria 4762
444 Ga0207698_10067018 3300026142 Bacteria 2829
445 Ga0207698_10599785 3300026142 Bacteria 1085
446 Ga0209983_1008898 3300027665 Bacteria 2052
447 Ga0209974_10001361 3300027876 Bacteria 8804
448 Ga0207428_10300344 3300027907 Bacteria 1188
449 Ga0268266_10000058 3300028379 Bacteria 277346
450 Ga0268266_10021348 3300028379 Bacteria 5516
451 Ga0268266_10026250 3300028379 Bacteria 4957
452 Ga0268266_10073634 3300028379 Bacteria 2964
453 Ga0268266_10179571 3300028379 Bacteria 1926
454 Ga0268266_10256666 3300028379 Bacteria 1619
455 Ga0268265_10010313 3300028380 Bacteria 6309
456 Ga0268265_10088208 3300028380 Bacteria 2471
457 Ga0268265_10178978 3300028380 Bacteria 1820
458 Ga0268265_10300515 3300028380 Bacteria 1445
459 Ga0268264_10050050 3300028381 Bacteria 3478
460 Ga0268264_10313542 3300028381 Bacteria 1481
461 Ga0268264_10419383 3300028381 Bacteria 1290
462 Ga0316182_1265017 3300030745 Bacteria 904
463 Ga0307513_10144266 3300031456 Bacteria 2302
464 Ga0307408_100049969 3300031548 Bacteria 3005
465 Ga0307408_100050048 3300031548 Bacteria 3003
466 Ga0307408_100065874 3300031548 Bacteria 2658
467 Ga0307408_100082514 3300031548 Bacteria 2406
468 Ga0307408_100084595 3300031548 Bacteria 2380
469 Ga0307408_100088067 3300031548 Bacteria 2338
470 Ga0307408_100103396 3300031548 Bacteria 2174
471 Ga0307405_10002876 3300031731 Bacteria 7742
472 Ga0307405_10006195 3300031731 Bacteria 5861
473 Ga0307405_10051740 3300031731 Bacteria 2550
474 Ga0307405_10081514 3300031731 Bacteria 2115
475 Ga0307405_10273983 3300031731 Bacteria 1267
476 Ga0307405_10283364 3300031731 Bacteria 1248
477 Ga0307405_10321879 3300031731 Bacteria 1181
478 Ga0307413_10007316 3300031824 Bacteria 5117
479 Ga0307413_10031831 3300031824 Bacteria 2981
480 Ga0307413_10036896 3300031824 Bacteria 2819
481 Ga0307413_10059996 3300031824 Bacteria 2340
482 Ga0307413_10061947 3300031824 Bacteria 2311
483 Ga0307413_10079243 3300031824 Bacteria 2099
484 Ga0307413_10105870 3300031824 Bacteria 1871
485 Ga0307413_10134170 3300031824 Bacteria 1699
486 Ga0307413_10158323 3300031824 Bacteria 1588
487 Ga0307413_10259722 3300031824 Bacteria 1294
488 Ga0307413_10324470 3300031824 Bacteria 1177
489 Ga0307413_10378064 3300031824 Bacteria 1102
490 Ga0307413_10429792 3300031824 Bacteria 1042
491 Ga0307413_10525820 3300031824 Bacteria 955
492 Ga0307413_10819878 3300031824 Bacteria 784
493 Ga0307410_10007018 3300031852 Bacteria 6131
494 Ga0307410_10009678 3300031852 Bacteria 5420
495 Ga0307410_10012527 3300031852 Bacteria 4911
496 Ga0307410_10023876 3300031852 Bacteria 3811
497 Ga0307410_10039509 3300031852 Bacteria 3098
498 Ga0307410_10059984 3300031852 Bacteria 2598
499 Ga0307410_10127882 3300031852 Bacteria 1862
500 Ga0307410_10205384 3300031852 Bacteria 1507
501 Ga0307410_10258048 3300031852 Bacteria 1358
502 Ga0307410_10790939 3300031852 Bacteria 806
503 Ga0307406_10044349 3300031901 Bacteria 2786
504 Ga0307406_10076981 3300031901 Bacteria 2205
505 Ga0307406_10105370 3300031901 Bacteria 1929
506 Ga0307406_10131003 3300031901 Bacteria 1760
507 Ga0307406_10172091 3300031901 Bacteria 1568
508 Ga0307406_10386083 3300031901 Bacteria 1105
509 Ga0307407_10004305 3300031903 Bacteria 6015
510 Ga0307407_10004515 3300031903 Bacteria 5921
511 Ga0307407_10007365 3300031903 Bacteria 4979
512 Ga0307407_10009947 3300031903 Bacteria 4456
513 Ga0307407_10017051 3300031903 Bacteria 3633
514 Ga0307407_10056078 3300031903 Bacteria 2279
515 Ga0307407_10109352 3300031903 Bacteria 1732
516 Ga0307407_10173076 3300031903 Bacteria 1424
517 Ga0307412_10006136 3300031911 Bacteria 6773
518 Ga0307412_10006500 3300031911 Bacteria 6611
519 Ga0307412_10010780 3300031911 Bacteria 5273
520 Ga0307412_10011521 3300031911 Bacteria 5126
521 Ga0307412_10032284 3300031911 Bacteria 3316
522 Ga0307412_10042079 3300031911 Bacteria 2965
523 Ga0307412_10065325 3300031911 Bacteria 2462
524 Ga0307412_10102514 3300031911 Bacteria 2026
525 Ga0307412_10315938 3300031911 Bacteria 1241
526 Ga0307412_10435201 3300031911 Bacteria 1076
527 Ga0307412_10647761 3300031911 Bacteria 901
528 Ga0307409_100001770 3300031995 Bacteria 10918
529 Ga0307409_100013826 3300031995 Bacteria 5217
530 Ga0307409_100037200 3300031995 Bacteria 3586
531 Ga0307409_100047479 3300031995 Bacteria 3259
532 Ga0307409_100056706 3300031995 Bacteria 3031
533 Ga0307409_100057729 3300031995 Bacteria 3009
534 Ga0307409_100236090 3300031995 Bacteria 1661
535 Ga0307409_100239375 3300031995 Bacteria 1651
536 Ga0307409_100280201 3300031995 Bacteria 1540
537 Ga0307409_100473580 3300031995 Bacteria 1213
538 Ga0307409_100604099 3300031995 Bacteria 1084
539 Ga0307409_100652347 3300031995 Bacteria 1046
540 Ga0307409_100833921 3300031995 Bacteria 932
541 Ga0307416_100002349 3300032002 Bacteria 10822
542 Ga0307416_100010714 3300032002 Bacteria 6074
543 Ga0307416_100061114 3300032002 Bacteria 3072
544 Ga0307416_100071180 3300032002 Bacteria 2887
545 Ga0307416_100087225 3300032002 Bacteria 2663
546 Ga0307416_100106951 3300032002 Bacteria 2453
547 Ga0307416_100144333 3300032002 Bacteria 2170
548 Ga0307416_100158220 3300032002 Bacteria 2089
549 Ga0307416_100289032 3300032002 Bacteria 1622
550 Ga0307416_100490274 3300032002 Bacteria 1291
551 Ga0307416_100502374 3300032002 Bacteria 1277
552 Ga0307416_100615528 3300032002 Bacteria 1167
553 Ga0307416_100804422 3300032002 Bacteria 1036
554 Ga0307416_100863811 3300032002 Bacteria 1003
555 Ga0307416_100921043 3300032002 Bacteria 975
556 Ga0307416_101038135 3300032002 Bacteria 923
557 Ga0307416_101742075 3300032002 Bacteria 727
558 Ga0307414_10162772 3300032004 Bacteria 1774
559 Ga0307414_10196948 3300032004 Bacteria 1635
560 Ga0307414_10234837 3300032004 Bacteria 1514
561 Ga0307414_10343955 3300032004 Bacteria 1278
562 Ga0307414_10344698 3300032004 Bacteria 1276
563 Ga0307414_10344763 3300032004 Bacteria 1276
564 Ga0307414_10364956 3300032004 Bacteria 1244
565 Ga0307414_10415803 3300032004 Bacteria 1171
566 Ga0307414_10571376 3300032004 Bacteria 1010
567 Ga0307414_10625071 3300032004 Bacteria 968
568 Ga0307411_10001961 3300032005 Bacteria 8817
569 Ga0307411_10003274 3300032005 Bacteria 7475
570 Ga0307411_10005242 3300032005 Bacteria 6344
571 Ga0307411_10007433 3300032005 Bacteria 5582
572 Ga0307411_10009500 3300032005 Bacteria 5118
573 Ga0307411_10026334 3300032005 Bacteria 3500
574 Ga0307411_10032766 3300032005 Bacteria 3215
575 Ga0307411_10040357 3300032005 Bacteria 2960
576 Ga0307411_10052177 3300032005 Bacteria 2672
577 Ga0307411_10227882 3300032005 Bacteria 1450
578 Ga0307411_10241936 3300032005 Bacteria 1413
579 Ga0307411_10500897 3300032005 Bacteria 1027
580 Ga0307411_10667281 3300032005 Bacteria 902
581 Ga0307415_100003384 3300032126 Bacteria 8114
582 Ga0307415_100006827 3300032126 Bacteria 6193
583 Ga0307415_100018561 3300032126 Bacteria 4204
584 Ga0307415_100023094 3300032126 Bacteria 3854
585 Ga0307415_100076355 3300032126 Bacteria 2375
586 Ga0307415_100139831 3300032126 Bacteria 1847
587 Ga0307415_100175542 3300032126 Bacteria 1675
588 Ga0307415_100240745 3300032126 Bacteria 1463
589 Ga0307415_100255945 3300032126 Bacteria 1425
590 Ga0307415_100313616 3300032126 Bacteria 1304
591 Ga0307415_100746722 3300032126 Bacteria 888
592 Ga0373935_0015741 3300035692 Bacteria 4575
593 Ga0395899_0066103 3300037312 Bacteria 2655
594 Ga0395899_0458104 3300037312 Bacteria 834
595 Ga0395900_0040278 3300037418 Bacteria 4815
596 Ga0395900_0060649 3300037418 Bacteria 3892
597 Ga0395900_0202196 3300037418 Bacteria 2009
598 Ga0395900_0450394 3300037418 Bacteria 1243
599 Ga0395900_0613136 3300037418 Bacteria 1028
600 Ga0395898_0032482 3300037466 Bacteria 5210
601 Ga0395898_0824083 3300037466 Bacteria 868
602 Ga0395905_0022613 3300037471 Bacteria 5944
603 Ga0395905_0041734 3300037471 Bacteria 4306
604 Ga0395905_0061015 3300037471 Bacteria 3526
605 Ga0395905_0084072 3300037471 Bacteria 2981
606 Ga0395905_0150750 3300037471 Bacteria 2188
607 Ga0395905_0281872 3300037471 Bacteria 1548
608 Ga0395905_0330196 3300037471 Bacteria 1415
609 Ga0395905_0592649 3300037471 Bacteria 1010
610 Ga0395901_0051368 3300038443 Bacteria 4286
611 Ga0395901_0121831 3300038443 Bacteria 2741
612 Ga0436365_1017006 3300039437 Bacteria 12784
613 Ga0436365_1022879 3300039437 Bacteria 3549
614 Ga0436363_0767548 3300039450 Bacteria 1802
615 Ga0439465_0116136 3300041413 Bacteria 935
616 Ga0439445_0005040 3300042004 Bacteria 2999
617 Ga0439432_007146 3300042006 Bacteria 3968
618 Ga0439449_0077258 3300042007 Bacteria 1228
619 Ga0439446_0079133 3300042156 Bacteria 1016
620 Ga0439458_0000465 3300042157 Bacteria 10315
621 Ga0439458_0022638 3300042157 Bacteria 1461
622 Ga0466969_0043869 3300044656 Bacteria 2227
623 Ga0466972_0032776 3300044658 Bacteria 2550
624 Ga0466972_0044955 3300044658 Bacteria 2141
625 Ga0466965_0027320 3300044683 Bacteria 2770
626 Ga0466965_0093294 3300044683 Bacteria 1533
627 Ga0466964_0006258 3300044706 Bacteria 4437
628 Ga0466968_0012366 3300044735 Bacteria 3340
629 Ga0466970_0086641 3300044765 Bacteria 1697
630 Ga0466959_0067440 3300045049 Bacteria 2594
631 Ga0466958_0028409 3300045836 Bacteria 3316
632 Ga0466967_0371018 3300045976 Bacteria 1388
633 Ga0466967_0463114 3300045976 Bacteria 1240
634 Ga0495643_0147038 3300046522 Bacteria 1170
635 Ga0495663_0002626 3300046525 Bacteria 5357
636 Ga0495663_0002665 3300046525 Bacteria 5321
637 Ga0495663_0043994 3300046525 Bacteria 1365
638 Ga0495663_0044528 3300046525 Bacteria 1358
639 Ga0495642_0152348 3300046528 Bacteria 1000
640 Ga0495598_0008176 3300046537 Bacteria 2426
641 Ga0495621_0003072 3300046539 Bacteria 4557
642 Ga0495621_0010269 3300046539 Bacteria 2858
643 Ga0495621_0016950 3300046539 Bacteria 2346
644 Ga0495633_0002025 3300046558 Bacteria 14632
645 Ga0495633_0120014 3300046558 Bacteria 1218
646 Ga0495656_0236417 3300046615 Bacteria 919
647 Ga0495661_0104234 3300046665 Bacteria 1591
648 Ga0495588_0162290 3300046674 Bacteria 1182
649 Ga0495669_0001563 3300046684 Bacteria 9410
650 Ga0495669_0007751 3300046684 Bacteria 4507
651 Ga0495669_0089205 3300046684 Bacteria 1422
652 Ga0495670_0023421 3300046691 Bacteria 3047
653 Ga0495670_0040763 3300046691 Bacteria 2316
654 Ga0495670_0071598 3300046691 Bacteria 1755
655 Ga0495670_0195120 3300046691 Bacteria 1071
656 Ga0495636_0125221 3300047318 Bacteria 1140
657 Ga0495677_0013213 3300047445 Bacteria 3004
658 Ga0495677_0014706 3300047445 Bacteria 2847
659 Ga0496100_0021738 3300048903 Bacteria 3870
660 Ga0496100_0039396 3300048903 Bacteria 3001
661 Ga0496101_0042442 3300048904 Bacteria 3246
662 Ga0496101_0240047 3300048904 Bacteria 1410
663 Ga0496102_0030450 3300048905 Bacteria 4831
664 Ga0496103_0015112 3300048906 Bacteria 4589
665 Ga0496104_0117289 3300048907 Bacteria 2555
666 Ga0496106_0010069 3300048909 Bacteria 6983
667 Ga0496106_0054861 3300048909 Bacteria 3012
668 Ga0496107_0004419 3300048910 Bacteria 9528
669 Ga0496107_0009911 3300048910 Bacteria 6612
670 Ga0496107_0057489 3300048910 Bacteria 2812
671 Ga0496107_0210058 3300048910 Bacteria 1447
672 Ga0496107_0556008 3300048910 Bacteria 850
673 Ga0496108_0014581 3300048911 Bacteria 6415
674 Ga0496108_0059820 3300048911 Bacteria 3204
675 Ga0496108_0254958 3300048911 Bacteria 1526
676 Ga0496108_0705421 3300048911 Bacteria 875
677 Ga0496109_0056697 3300048912 Bacteria 3574
678 Ga0496109_0075565 3300048912 Bacteria 3098
679 Ga0496109_0090214 3300048912 Bacteria 2834
680 Ga0496109_0227679 3300048912 Bacteria 1753
681 Ga0496109_0259992 3300048912 Bacteria 1635
682 Ga0496110_0000637 3300048913 Bacteria 24040
683 Ga0496110_0004505 3300048913 Bacteria 10808
684 Ga0496110_0044450 3300048913 Bacteria 3879
685 Ga0496110_0817109 3300048913 Bacteria 837
686 Ga0496111_0000353 3300048914 Bacteria 22730
687 Ga0496111_0000937 3300048914 Bacteria 15966
688 Ga0496111_0043506 3300048914 Bacteria 3228
689 Ga0496111_0059938 3300048914 Bacteria 2758
690 Ga0496112_0026570 3300048915 Bacteria 5573
691 Ga0496113_0014432 3300048916 Bacteria 5389
692 Ga0496113_0258035 3300048916 Bacteria 1392
693 Ga0496114_0123797 3300048917 Bacteria 2226
694 Ga0496115_0367585 3300048918 Unclassified 1171
695 Ga0501034_0080242 3300049571 Bacteria 3266
696 Ga0501217_062510 3300049661 Bacteria 997
697 Ga0501227_085506 3300049665 Bacteria 829
698 Ga0501233_071035 3300049668 Bacteria 882
699 Ga0501239_006084 3300049672 Bacteria 1231
700 Ga0501243_005956 3300049675 Bacteria 1842
701 Ga0501247_021409 3300049677 Bacteria 841
702 Ga0501249_015884 3300049679 Bacteria 1613
703 Ga0501249_029219 3300049679 Bacteria 1225
704 Ga0501257_079096 3300049686 Bacteria 846
705 Ga0501259_005204 3300049688 Bacteria 2060
706 Ga0501225_0089944 3300049705 Bacteria 888
707 Ga0501234_027453 3300049707 Bacteria 915
708 Ga0501263_000540 3300049760 Bacteria 2903
709 Ga0501267_007777 3300049764 Bacteria 1048
710 Ga0501268_004946 3300049765 Bacteria 1897
711 Ga0501283_015272 3300049779 Bacteria 1181
712 nmdc:mga08y16_119882_c1 3300050511 Bacteria 2738
713 Ga0500641_0025857 3300053096 Bacteria 2275
714 Ga0500568_0020300 3300053139 Bacteria 2876
715 Ga0500616_0001034 3300053153 Bacteria 29477
716 Ga0501070_0017943
717 JGI24746J21847_1002522
718 JGI24740J21852_10027118
719 JGI24739J22299_10007526
720 JGI24737J22298_10000047
721 JGI24743J22301_10044042
722 JGI24748J21848_1012498
723 JGI24738J21930_10000372
724 JGI24738J21930_10060419
725 JGI24749J21850_1003851
726 Ga0065712_10072772
727 Ga0065712_10244397
728 Ga0065715_10000733
729 Ga0065715_10035676
730 Ga0065715_10185321
731 Ga0065715_10517741
732 Ga0070658_10008982
733 Ga0070658_10031852
734 Ga0070658_10032042
735 Ga0070658_10217118
736 Ga0070658_10400004
737 Ga0070658_10529231
738 Ga0070676_10001347
739 Ga0070676_10028208
740 Ga0070676_10165867
741 Ga0070676_10633985
742 Ga0070683_100109299
743 Ga0070690_100000372
744 Ga0070690_100070233
745 Ga0070670_100009092
746 Ga0070670_100010969
747 Ga0070670_100027841
748 Ga0070670_100036139
749 Ga0070670_100079725
750 Ga0070670_100174554
751 Ga0070670_100201640
752 Ga0070670_100266843
753 Ga0070670_100318423
754 Ga0070677_10007650
755 Ga0068869_100000611
756 Ga0068869_100225661
757 Ga0070666_10031373
758 Ga0070680_100114948
759 Ga0070680_100134077
760 Ga0070682_100162193
761 Ga0068868_100001045
762 Ga0068868_100852691
763 Ga0070660_100002566
764 Ga0070660_100009420
765 Ga0070660_100014944
766 Ga0070660_100061058
767 Ga0070660_100061697
768 Ga0070660_100101289
769 Ga0070660_100666605
770 Ga0070689_100008843
771 Ga0070661_100001960
772 Ga0070661_100082104
773 Ga0070661_100135241
774 Ga0070661_100598890
775 Ga0070692_10075217
776 Ga0070692_10253144
777 Ga0070668_100003373
778 Ga0070668_100014570
779 Ga0070668_100104002
780 Ga0070668_100154037
781 Ga0070668_100179175
782 Ga0070669_100000714
783 Ga0070669_100133563
784 Ga0070669_100163421
785 Ga0070669_100269047
786 Ga0070669_100728017
787 Ga0070675_100000410
788 Ga0070675_100000886
789 Ga0070675_100077893
790 Ga0070671_100003073
791 Ga0070671_100008231
792 Ga0070671_100010842
793 Ga0070671_100053604
794 Ga0070671_100158169
795 Ga0070671_100184633
796 Ga0070671_100259910
797 Ga0070671_100380383
798 Ga0070671_100444548
799 Ga0070674_100030751
800 Ga0070674_100048004
801 Ga0070674_100090347
802 Ga0070674_100476027
803 Ga0070674_100693325
804 Ga0070673_100001046
805 Ga0070673_100007989
806 Ga0070673_100024972
807 Ga0070673_100062740
808 Ga0070673_100154640
809 Ga0070673_100193378
810 Ga0070659_100000021
811 Ga0070659_100007406
812 Ga0070659_100011596
813 Ga0070659_100388253
814 Ga0070659_100496866
815 Ga0070667_100005524
816 Ga0070667_100014047
817 Ga0070667_100043278
818 Ga0070667_100085455
819 Ga0070667_100106537
820 Ga0070667_100186621
821 Ga0070667_100304510
822 Ga0070667_100631945
823 Ga0070701_10024626
824 Ga0070700_100576517
825 Ga0070663_100022041
826 Ga0070663_100024903
827 Ga0070663_100037599
828 Ga0070678_100248661
829 Ga0070662_100000230
830 Ga0070662_100000323
831 Ga0070662_100001313
832 Ga0070662_100016400
833 Ga0070662_100033073
834 Ga0070662_100185615
835 Ga0070662_100227514
836 Ga0070662_100347260
837 Ga0070662_100450537
838 Ga0068867_100017503
839 Ga0068867_100056938
840 Ga0068867_100304397
841 Ga0068867_100661267
842 Ga0070679_100044580
843 Ga0070679_100323362
844 Ga0070684_100931190
845 Ga0068853_100026737
846 Ga0068853_100042142
847 Ga0068853_100443197
848 Ga0068853_100637611
849 Ga0070672_100000508
850 Ga0070672_100009872
851 Ga0070672_100025952
852 Ga0070672_100273921
853 Ga0070672_100473434
854 Ga0070696_100309137
855 Ga0070665_100011722
856 Ga0070665_100058161
857 Ga0070665_100342291
858 Ga0070665_100366339
859 Ga0068855_100019497
860 Ga0070664_100018766
861 Ga0070664_100087508
862 Ga0070664_100182654
863 Ga0070664_100297385
864 Ga0070664_100445846
865 Ga0070664_100571663
866 Ga0068857_100011615
867 Ga0068857_100025431
868 Ga0068854_100004617
869 Ga0068854_100012010
870 Ga0068854_100033858
871 Ga0068854_100039621
872 Ga0068854_100088838
873 Ga0068854_100595056
874 Ga0068854_100816743
875 Ga0068856_100025809
876 Ga0068856_100116791
877 Ga0068856_101306306
878 Ga0068852_100019281
879 Ga0068852_100029754
880 Ga0068852_100051312
881 Ga0068852_100174645
882 Ga0068852_100303065
883 Ga0068859_100008141
884 Ga0068859_100009314
885 Ga0068859_100280832
886 Ga0068859_100402669
887 Ga0068864_100000222
888 Ga0068864_100001115
889 Ga0068864_100004739
890 Ga0068864_100054570
891 Ga0068864_100662690
892 Ga0068864_100715404
893 Ga0068866_10005239
894 Ga0068866_10351702
895 Ga0068861_100219925
896 Ga0068851_10043059
897 Ga0068863_100002567
898 Ga0068863_100013196
899 Ga0068863_100152830
900 Ga0068863_100303697
901 Ga0068863_100313019
902 Ga0068863_100423340
903 Ga0068858_100003320
904 Ga0068858_100146480
905 Ga0068858_100353755
906 Ga0068860_100064405
907 Ga0068860_100117578
908 Ga0068860_100211121
909 Ga0068860_100350247
910 Ga0068862_100169664
911 Ga0068862_100238216
912 Ga0068862_100238425
913 Ga0068862_100253847
914 Ga0081539_10028935
915 Ga0097621_100158221
916 Ga0068871_100403178
917 Ga0068865_100345570
918 Ga0097620_100008141
919 Ga0097620_100009314
920 Ga0097620_100280806
921 Ga0097620_100402666
922 Ga0105240_10023020
923 Ga0111539_10137611
924 Ga0105245_10001658
925 Ga0105245_10046112
926 Ga0105245_10053401
927 Ga0105245_10189737
928 Ga0105241_10066300
929 Ga0105241_10233302
930 Ga0105248_10001119
931 Ga0105248_10036445
932 Ga0105248_10059638
933 Ga0105248_10060136
934 Ga0105248_10071031
935 Ga0105248_10175391
936 Ga0105248_10178870
937 Ga0105237_10006758
938 Ga0105237_10402871
939 Ga0105238_10002196
940 Ga0105238_10025471
941 Ga0105238_10031614
942 Ga0105238_10109475
943 Ga0105249_10008569
944 Ga0105246_10036861
945 Ga0157373_10010749
946 Ga0157373_10055444
947 Ga0157373_10062686
948 Ga0157373_10529498
949 Ga0157371_10106361
950 Ga0157371_10113352
951 Ga0157371_10219133
952 Ga0157371_10350798
953 Ga0157371_10398554
954 Ga0157370_10183127
955 Ga0157370_10305643
956 Ga0157369_10003181
957 Ga0157369_10535041
958 Ga0157378_10094973
959 Ga0157378_10209951
960 Ga0163162_10391397
961 Ga0157372_10011784
962 Ga0157372_10168146
963 Ga0157372_10573876
964 Ga0157375_10040160
965 Ga0157375_11197219
966 Ga0163163_10003326
967 Ga0163163_10021332
968 Ga0163163_10129995
969 Ga0157380_10000743
970 Ga0157380_10002497
971 Ga0157380_10029231
972 Ga0157380_10209276
973 Ga0157380_10376484
974 Ga0157380_10705637
975 Ga0157376_10645696
976 Ga0163161_10010380
977 Ga0163161_10101172
978 Ga0213876_10007897
979 Ga0207673_1004390
980 Ga0207697_10002140
981 Ga0207697_10029517
982 Ga0207656_10123072
983 Ga0207682_10000869
984 Ga0207682_10118585
985 Ga0207642_10005370
986 Ga0207688_10000145
987 Ga0207688_10025228
988 Ga0207680_10001780
989 Ga0207680_10054433
990 Ga0207680_10082683
991 Ga0207647_10000832
992 Ga0207647_10008958
993 Ga0207645_10003931
994 Ga0207645_10009522
995 Ga0207645_10046176
996 Ga0207645_10185619
997 Ga0207645_10200692
998 Ga0207643_10344105
999 Ga0207705_10011733
1000 Ga0207705_10012021
1001 Ga0207705_10016053
1002 Ga0207705_10023710
1003 Ga0207705_10064097
1004 Ga0207705_10092739
1005 Ga0207707_10139696
1006 Ga0207707_10364111
1007 Ga0207695_10050007
1008 Ga0207660_10028845
1009 Ga0207657_10000743
1010 Ga0207657_10011975
1011 Ga0207657_10014502
1012 Ga0207657_10024925
1013 Ga0207657_10059180
1014 Ga0207657_10099384
1015 Ga0207657_10216786
1016 Ga0207649_10096475
1017 Ga0207649_10175178
1018 Ga0207652_10036238
1019 Ga0207652_10188404
1020 Ga0207681_10000376
1021 Ga0207681_10002452
1022 Ga0207681_10018170
1023 Ga0207681_10121239
1024 Ga0207681_10134073
1025 Ga0207681_10368048
1026 Ga0207694_10000776
1027 Ga0207694_10026504
1028 Ga0207694_10288538
1029 Ga0207650_10002939
1030 Ga0207650_10008951
1031 Ga0207650_10019269
1032 Ga0207650_10053332
1033 Ga0207650_10233392
1034 Ga0207659_10000215
1035 Ga0207659_10001902
1036 Ga0207659_10051447
1037 Ga0207687_10020192
1038 Ga0207687_10023369
1039 Ga0207687_10084918
1040 Ga0207644_10000612
1041 Ga0207644_10002558
1042 Ga0207644_10005478
1043 Ga0207644_10005992
1044 Ga0207644_10022006
1045 Ga0207644_10053555
1046 Ga0207644_10091559
1047 Ga0207644_10140559
1048 Ga0207644_10169938
1049 Ga0207644_10250611
1050 Ga0207644_10347393
1051 Ga0207644_10453246
1052 Ga0207644_10530197
1053 Ga0207690_10000030
1054 Ga0207690_10026431
1055 Ga0207690_10041864
1056 Ga0207690_10055688
1057 Ga0207690_10294284
1058 Ga0207690_10336178
1059 Ga0207706_10000557
1060 Ga0207706_10000829
1061 Ga0207706_10009237
1062 Ga0207706_10010852
1063 Ga0207706_10123230
1064 Ga0207706_10194726
1065 Ga0207706_10292546
1066 Ga0207706_10437820
1067 Ga0207706_10530481
1068 Ga0207670_10013473
1069 Ga0207669_10084228
1070 Ga0207669_10130422
1071 Ga0207669_10149598
1072 Ga0207704_10291486
1073 Ga0207691_10000143
1074 Ga0207691_10003013
1075 Ga0207691_10003632
1076 Ga0207691_10040889
1077 Ga0207691_10215013
1078 Ga0207711_10002065
1079 Ga0207711_10009128
1080 Ga0207711_10012266
1081 Ga0207711_10023955
1082 Ga0207711_10030792
1083 Ga0207711_10089443
1084 Ga0207711_10138392
1085 Ga0207711_10472273
1086 Ga0207689_10000017
1087 Ga0207661_10193148
1088 Ga0207661_10930350
1089 Ga0207679_10002720
1090 Ga0207679_10008561
1091 Ga0207679_10039037
1092 Ga0207679_10060491
1093 Ga0207679_10166327
1094 Ga0207679_10200894
1095 Ga0207679_10246301
1096 Ga0207679_10250288
1097 Ga0207679_10315871
1098 Ga0207667_10045546
1099 Ga0207667_10236894
1100 Ga0207651_10002362
1101 Ga0207651_10012623
1102 Ga0207651_10012938
1103 Ga0207651_10077140
1104 Ga0207712_10173170
1105 Ga0207668_10000233
1106 Ga0207668_10085470
1107 Ga0207668_10155772
1108 Ga0207668_10191419
1109 Ga0207668_10195388
1110 Ga0207640_10013794
1111 Ga0207640_10031528
1112 Ga0207640_10067955
1113 Ga0207640_10317761
1114 Ga0207658_10007010
1115 Ga0207658_10019412
1116 Ga0207658_10029098
1117 Ga0207658_10037172
1118 Ga0207658_10185292
1119 Ga0207658_10444212
1120 Ga0207658_10526936
1121 Ga0207677_10000336
1122 Ga0207677_10001815
1123 Ga0207677_10025277
1124 Ga0207677_10223566
1125 Ga0207703_10009234
1126 Ga0207703_10010554
1127 Ga0207639_10000554
1128 Ga0207639_10078001
1129 Ga0207678_10008367
1130 Ga0207678_10043798
1131 Ga0207678_10109021
1132 Ga0207678_10160866
1133 Ga0207678_10766354
1134 Ga0207702_10089285
1135 Ga0207702_10555970
1136 Ga0207641_10010018
1137 Ga0207641_10023683
1138 Ga0207641_10173730
1139 Ga0207641_10381800
1140 Ga0207641_10536749
1141 Ga0207641_10542357
1142 Ga0207648_10003142
1143 Ga0207648_10017498
1144 Ga0207676_10003030
1145 Ga0207676_10013865
1146 Ga0207676_10126772
1147 Ga0207676_10650683
1148 Ga0207674_10010363
1149 Ga0207674_10146122
1150 Ga0207674_10531797
1151 Ga0207675_100064800
1152 Ga0207675_100066434
1153 Ga0207675_100260193
1154 Ga0207683_10291185
1155 Ga0207683_10594682
1156 Ga0207683_10833433
1157 Ga0207698_10006901
1158 Ga0207698_10018376
1159 Ga0207698_10067018
1160 Ga0207698_10599785
1161 Ga0209983_1008898
1162 Ga0209974_10001361
1163 Ga0207428_10300344
1164 Ga0268266_10000058
1165 Ga0268266_10021348
1166 Ga0268266_10026250
1167 Ga0268266_10073634
1168 Ga0268266_10179571
1169 Ga0268266_10256666
1170 Ga0268265_10010313
1171 Ga0268265_10088208
1172 Ga0268265_10178978
1173 Ga0268265_10300515
1174 Ga0268264_10050050
1175 Ga0268264_10313542
1176 Ga0268264_10419383
1177 Ga0316182_1265017
1178 Ga0307513_10144266
1179 Ga0307408_100049969
1180 Ga0307408_100050048
1181 Ga0307408_100065874
1182 Ga0307408_100082514
1183 Ga0307408_100084595
1184 Ga0307408_100088067
1185 Ga0307408_100103396
1186 Ga0307405_10002876
1187 Ga0307405_10006195
1188 Ga0307405_10051740
1189 Ga0307405_10081514
1190 Ga0307405_10273983
1191 Ga0307405_10283364
1192 Ga0307405_10321879
1193 Ga0307413_10007316
1194 Ga0307413_10031831
1195 Ga0307413_10036896
1196 Ga0307413_10059996
1197 Ga0307413_10061947
1198 Ga0307413_10079243
1199 Ga0307413_10105870
1200 Ga0307413_10134170
1201 Ga0307413_10158323
1202 Ga0307413_10259722
1203 Ga0307413_10324470
1204 Ga0307413_10378064
1205 Ga0307413_10429792
1206 Ga0307413_10525820
1207 Ga0307413_10819878
1208 Ga0307410_10007018
1209 Ga0307410_10009678
1210 Ga0307410_10012527
1211 Ga0307410_10023876
1212 Ga0307410_10039509
1213 Ga0307410_10059984
1214 Ga0307410_10127882
1215 Ga0307410_10205384
1216 Ga0307410_10258048
1217 Ga0307410_10790939
1218 Ga0307406_10044349
1219 Ga0307406_10076981
1220 Ga0307406_10105370
1221 Ga0307406_10131003
1222 Ga0307406_10172091
1223 Ga0307406_10386083
1224 Ga0307407_10004305
1225 Ga0307407_10004515
1226 Ga0307407_10007365
1227 Ga0307407_10009947
1228 Ga0307407_10017051
1229 Ga0307407_10056078
1230 Ga0307407_10109352
1231 Ga0307407_10173076
1232 Ga0307412_10006136
1233 Ga0307412_10006500
1234 Ga0307412_10010780
1235 Ga0307412_10011521
1236 Ga0307412_10032284
1237 Ga0307412_10042079
1238 Ga0307412_10065325
1239 Ga0307412_10102514
1240 Ga0307412_10315938
1241 Ga0307412_10435201
1242 Ga0307412_10647761
1243 Ga0307409_100001770
1244 Ga0307409_100013826
1245 Ga0307409_100037200
1246 Ga0307409_100047479
1247 Ga0307409_100056706
1248 Ga0307409_100057729
1249 Ga0307409_100236090
1250 Ga0307409_100239375
1251 Ga0307409_100280201
1252 Ga0307409_100473580
1253 Ga0307409_100604099
1254 Ga0307409_100652347
1255 Ga0307409_100833921
1256 Ga0307416_100002349
1257 Ga0307416_100010714
1258 Ga0307416_100061114
1259 Ga0307416_100071180
1260 Ga0307416_100087225
1261 Ga0307416_100106951
1262 Ga0307416_100144333
1263 Ga0307416_100158220
1264 Ga0307416_100289032
1265 Ga0307416_100490274
1266 Ga0307416_100502374
1267 Ga0307416_100615528
1268 Ga0307416_100804422
1269 Ga0307416_100863811
1270 Ga0307416_100921043
1271 Ga0307416_101038135
1272 Ga0307416_101742075
1273 Ga0307414_10162772
1274 Ga0307414_10196948
1275 Ga0307414_10234837
1276 Ga0307414_10343955
1277 Ga0307414_10344698
1278 Ga0307414_10344763
1279 Ga0307414_10364956
1280 Ga0307414_10415803
1281 Ga0307414_10571376
1282 Ga0307414_10625071
1283 Ga0307411_10001961
1284 Ga0307411_10003274
1285 Ga0307411_10005242
1286 Ga0307411_10007433
1287 Ga0307411_10009500
1288 Ga0307411_10026334
1289 Ga0307411_10032766
1290 Ga0307411_10040357
1291 Ga0307411_10052177
1292 Ga0307411_10227882
1293 Ga0307411_10241936
1294 Ga0307411_10500897
1295 Ga0307411_10667281
1296 Ga0307415_100003384
1297 Ga0307415_100006827
1298 Ga0307415_100018561
1299 Ga0307415_100023094
1300 Ga0307415_100076355
1301 Ga0307415_100139831
1302 Ga0307415_100175542
1303 Ga0307415_100240745
1304 Ga0307415_100255945
1305 Ga0307415_100313616
1306 Ga0307415_100746722
1307 Ga0373935_0015741
1308 Ga0395899_0066103
1309 Ga0395899_0458104
1310 Ga0395900_0040278
1311 Ga0395900_0060649
1312 Ga0395900_0202196
1313 Ga0395900_0450394
1314 Ga0395900_0613136
1315 Ga0395898_0032482
1316 Ga0395898_0824083
1317 Ga0395905_0022613
1318 Ga0395905_0041734
1319 Ga0395905_0061015
1320 Ga0395905_0084072
1321 Ga0395905_0150750
1322 Ga0395905_0281872
1323 Ga0395905_0330196
1324 Ga0395905_0592649
1325 Ga0395901_0051368
1326 Ga0395901_0121831
1327 Ga0436365_1017006
1328 Ga0436365_1022879
1329 Ga0436363_0767548
1330 Ga0439465_0116136
1331 Ga0439445_0005040
1332 Ga0439432_007146
1333 Ga0439449_0077258
1334 Ga0439446_0079133
1335 Ga0439458_0000465
1336 Ga0439458_0022638
1337 Ga0466969_0043869
1338 Ga0466972_0032776
1339 Ga0466972_0044955
1340 Ga0466965_0027320
1341 Ga0466965_0093294
1342 Ga0466964_0006258
1343 Ga0466968_0012366
1344 Ga0466970_0086641
1345 Ga0466959_0067440
1346 Ga0466958_0028409
1347 Ga0466967_0371018
1348 Ga0466967_0463114
1349 Ga0495643_0147038
1350 Ga0495663_0002626
1351 Ga0495663_0002665
1352 Ga0495663_0043994
1353 Ga0495663_0044528
1354 Ga0495642_0152348
1355 Ga0495598_0008176
1356 Ga0495621_0003072
1357 Ga0495621_0010269
1358 Ga0495621_0016950
1359 Ga0495633_0002025
1360 Ga0495633_0120014
1361 Ga0495656_0236417
1362 Ga0495661_0104234
1363 Ga0495588_0162290
1364 Ga0495669_0001563
1365 Ga0495669_0007751
1366 Ga0495669_0089205
1367 Ga0495670_0023421
1368 Ga0495670_0040763
1369 Ga0495670_0071598
1370 Ga0495670_0195120
1371 Ga0495636_0125221
1372 Ga0495677_0013213
1373 Ga0495677_0014706
1374 Ga0496100_0021738
1375 Ga0496100_0039396
1376 Ga0496101_0042442
1377 Ga0496101_0240047
1378 Ga0496102_0030450
1379 Ga0496103_0015112
1380 Ga0496104_0117289
1381 Ga0496106_0010069
1382 Ga0496106_0054861
1383 Ga0496107_0004419
1384 Ga0496107_0009911
1385 Ga0496107_0057489
1386 Ga0496107_0210058
1387 Ga0496107_0556008
1388 Ga0496108_0014581
1389 Ga0496108_0059820
1390 Ga0496108_0254958
1391 Ga0496108_0705421
1392 Ga0496109_0056697
1393 Ga0496109_0075565
1394 Ga0496109_0090214
1395 Ga0496109_0227679
1396 Ga0496109_0259992
1397 Ga0496110_0000637
1398 Ga0496110_0004505
1399 Ga0496110_0044450
1400 Ga0496110_0817109
1401 Ga0496111_0000353
1402 Ga0496111_0000937
1403 Ga0496111_0043506
1404 Ga0496111_0059938
1405 Ga0496112_0026570
1406 Ga0496113_0014432
1407 Ga0496113_0258035
1408 Ga0496114_0123797
1409 Ga0496115_0367585
1410 Ga0501034_0080242
1411 Ga0501217_062510
1412 Ga0501227_085506
1413 Ga0501233_071035
1414 Ga0501239_006084
1415 Ga0501243_005956
1416 Ga0501247_021409
1417 Ga0501249_015884
1418 Ga0501249_029219
1419 Ga0501257_079096
1420 Ga0501259_005204
1421 Ga0501225_0089944
1422 Ga0501234_027453
1423 Ga0501263_000540
1424 Ga0501267_007777
1425 Ga0501268_004946
1426 Ga0501283_015272
1427 nmdc:mga08y16_119882_c1
1428 Ga0500641_0025857
1429 Ga0500568_0020300
1430 Ga0500616_0001034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06149

DUF969

Protein of unknown function (DUF969)

4

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xgf-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.4576 77 221
7xgf-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.4172 77 221
5j0l-assembly2.cif.gz_C de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.4085 65 223
7x2a-assembly1.cif.gz_C mers-cov spike complex with s41 neutralizing antibody fab class1 (1u2d rbd with 1fab) 0.3911 94 224
7sbs-assembly1.cif.gz_A one rbd-up 1 of pre-fusion sars-cov-2 gamma variant spike protein 0.3902 98 223
ID Description Score Start End Superfamily
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4688 93 224 1.10.1760.20
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4481 93 224 1.10.1760.20
af_I1KQQ7_1_146_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.439 93 218 1.20.930.20
af_A0A1D6FA56_314_575_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4347 56 223 1.20.1250.20
2d4eD01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.4216 77 164 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A3C2BJB5-F1-model_v4 deleted 0.855 69 223
AF-A0A2W4JU24-F1-model_v4 DUF969 domain-containing protein 0.8404 94 223 GO:0016020
AF-A0A645GY30-F1-model_v4 DUF969 domain-containing protein 0.8342 88 223 GO:0016020
AF-A0A6J4S9I3-F1-model_v4 FIG015373: Membrane protein 0.8263 95 224 GO:0016020
AF-A0A654XX93-F1-model_v4 deleted 0.8251 73 223

Map