F477019

General Info

Members Datasets Scaffolds Average Seq Length
715 446 1430 340

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501025504|2501410484
Length 396
Sequence PAFAGPLSLVPVRAALRALAAPVRRLTRLTRLTRLTRLTRLTRLTRLTRLTRLPRLTRFSHALPLAAGAAALVAGLAAPLAAQADQTAICYNCPPEWADWASQIQAIQKETGIRVPFDNKNSGQSIAQLMAEQKSPVADVVYLGVSSAFQAKDKGVITPYKPAHWNDIPADLKDPQGYWFAIHSGTLGFFVNKDALEGKPVPHSWADLLKPEYKGMVGYLDPSSAFVGYAGAVAVNLALGGTLDNFQPAFEWFGKLKANQPIVPKQTAYARVLSGEIPILLDYDFDAYRAKYKDHANVEFVIPKEGTISVPYVMSLVKNGPHEANGKKVLDFVLSDEGQKLWANAYLRPVRASALSPEAASKFLPASDYARAKPVDFAKMAAQQQAFGERYLQIMH

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
140 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
141 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
142 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
267 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
268 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
269 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
270 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
271 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
272 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
273 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
274 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
275 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
276 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
277 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
278 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
279 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
280 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
281 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
282 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
283 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
284 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
285 2519103095 Burkholderia sp. KJ006 Isolate Nodule
286 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
287 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
288 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
289 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
290 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
291 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
292 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
293 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
294 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
295 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
296 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
297 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
298 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
299 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
300 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
301 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
302 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
303 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
304 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
305 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
306 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
307 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
308 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
309 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
310 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
311 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
312 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
313 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
314 2643221609 Acidovorax sp. Root217 Isolate Unclassified
315 2643221611 Acidovorax sp. Root219 Isolate Unclassified
316 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
317 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
318 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
319 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
320 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
321 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
322 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
323 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
324 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
325 2721755523 Delftia sp. HK171 Isolate Unclassified
326 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
327 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
328 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
329 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
330 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
331 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
332 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
333 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
334 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
335 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
336 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
337 2738543012 Acidovorax sp. CF301 Isolate Unclassified
338 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
339 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
340 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
341 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
342 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
343 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
344 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
345 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
346 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
347 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
348 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
349 2816332133 Acidovorax radicis 2721A Isolate Unclassified
350 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
351 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
352 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
353 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
354 2818991450 Burkholderia sp. 604 Isolate Unclassified
355 2818991452 Burkholderia cepacia 561 Isolate Unclassified
356 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
357 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
358 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
359 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
360 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
361 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
362 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
363 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
364 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
365 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
366 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
367 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
368 2855730933 Achromobacter sp. HZ28 Isolate Nodule
369 2855767633 Achromobacter sp. HZ34 Isolate Nodule
370 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
371 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
372 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
373 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
374 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
375 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
376 2865014394 Pantoea sp. R-71966 Isolate Unclassified
377 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
378 2876601092 Pantoea endophytica 596 Isolate Unclassified
379 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
380 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
381 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
382 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
383 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
384 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
385 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
386 2904564687 Burkholderia sp. 571 Isolate Unclassified
387 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
388 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
389 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
390 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
391 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
392 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
393 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
394 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
395 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
396 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
397 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
398 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
399 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
400 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
401 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
402 2928163908 Burkholderia sp. 567 Isolate Unclassified
403 2928170801 Burkholderia sp. 572 Isolate Unclassified
404 2928536128 Burkholderia sola 565 Isolate Unclassified
405 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
406 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
407 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
408 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
409 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
410 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
411 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
412 2952252522 Salinicola sp. DM10 Isolate Unclassified
413 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
414 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
415 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
416 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
417 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
418 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
419 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
420 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
421 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
422 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
423 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
424 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
425 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
426 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
427 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
428 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
429 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
430 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
431 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
432 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
433 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
434 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
435 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
436 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
437 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
438 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
439 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
440 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
441 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
442 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
443 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
444 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
445 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
446 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.83
Metatranscriptomes 0
Isolates 25.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 8.39
Nodule 3.36
Rhizoplane 6.29
Rhizosphere 60.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6865 2124908027 Bacteria 2759
2 MRS1b_contig_1130785 2162886011 Bacteria 1481
3 JGI24740J21852_10003531 3300001979 Bacteria 6850
4 JGI24740J21852_10044095 3300001979 Bacteria 1326
5 JGI24739J22299_10000111 3300001989 Bacteria 25218
6 JGI24739J22299_10009313 3300001989 Bacteria 3663
7 JGI24739J22299_10009453 3300001989 Bacteria 3633
8 JGI24735J21928_10000087 3300002067 Bacteria 35083
9 JGI24738J21930_10002901 3300002075 Bacteria 4390
10 JGI25156J39149_1000429 3300002705 Bacteria 26030
11 JGI25156J39149_1002844 3300002705 Bacteria 5955
12 JGI25156J39149_1017479 3300002705 Bacteria 1357
13 JGI25162J39368_1004043 3300002737 Bacteria 3672
14 JGI25165J46597_1000886 3300003214 Bacteria 21064
15 rootL2_10038977 3300003322 Bacteria 5679
16 rootL2_10137897 3300003322 Bacteria 2831
17 JGI25160J50197_1001438 3300003354 Bacteria 11911
18 Ga0055533_1000253 3300003756 Bacteria 32721
19 Ga0055533_1000303 3300003756 Bacteria 24530
20 Ga0055533_1001847 3300003756 Bacteria 5300
21 Ga0055532_1000001 3300003758 Bacteria 1119836
22 Ga0055532_1002855 3300003758 Bacteria 3304
23 Ga0055527_1000002 3300003760 Bacteria 830488
24 Ga0055527_1000564 3300003760 Bacteria 12217
25 Ga0055527_1000600 3300003760 Bacteria 11625
26 Ga0055535_1000001 3300003761 Bacteria 1119836
27 Ga0055535_1001424 3300003761 Bacteria 12217
28 Ga0055535_1001498 3300003761 Bacteria 11625
29 Ga0055542_1000001 3300003762 Bacteria 1119836
30 Ga0055542_1001400 3300003762 Bacteria 12217
31 Ga0055529_1000001 3300003763 Bacteria 826680
32 Ga0055529_1000418 3300003763 Bacteria 43789
33 Ga0055530_10000016 3300003791 Bacteria 146874
34 Ga0055540_1000048 3300003792 Bacteria 146874
35 Ga0058692_1000510 3300003856 Bacteria 17182
36 Ga0058692_1000633 3300003856 Bacteria 14532
37 Ga0058692_1000833 3300003856 Bacteria 12218
38 Ga0058692_1002146 3300003856 Bacteria 6783
39 Ga0065165_1002944 3300005262 Bacteria 12976
40 Ga0065714_10003520 3300005288 Bacteria 9242
41 Ga0065714_10066603 3300005288 Bacteria 6571
42 Ga0065704_10015303 3300005289 Bacteria 3570
43 Ga0065712_10000124 3300005290 Bacteria 105429
44 Ga0065712_10171664 3300005290 Bacteria 1240
45 Ga0070658_10008756 3300005327 Bacteria 8130
46 Ga0070658_10120180 3300005327 Bacteria 2183
47 Ga0070676_10062871 3300005328 Bacteria 2210
48 Ga0070670_100003668 3300005331 Bacteria 12797
49 Ga0070670_100004735 3300005331 Bacteria 11419
50 Ga0070670_100006345 3300005331 Bacteria 10007
51 Ga0070677_10002183 3300005333 Bacteria 6252
52 Ga0070660_100000028 3300005339 Bacteria 88388
53 Ga0070661_100000025 3300005344 Bacteria 121698
54 Ga0070661_100109132 3300005344 Bacteria 2065
55 Ga0070668_100008307 3300005347 Bacteria 7706
56 Ga0070669_100002340 3300005353 Bacteria 13700
57 Ga0070669_100101741 3300005353 Bacteria 2169
58 Ga0070675_100002569 3300005354 Bacteria 13593
59 Ga0070671_100018623 3300005355 Bacteria 5641
60 Ga0070674_100001349 3300005356 Bacteria 12937
61 Ga0070659_100000152 3300005366 Bacteria 52790
62 Ga0070667_100157580 3300005367 Bacteria 1998
63 Ga0070694_100219837 3300005444 Bacteria 1424
64 Ga0070663_100002650 3300005455 Bacteria 10129
65 Ga0070678_100014570 3300005456 Bacteria 4967
66 Ga0070662_100004610 3300005457 Bacteria 8732
67 Ga0070662_100007483 3300005457 Bacteria 7081
68 Ga0070685_10179210 3300005466 Bacteria 1363
69 Ga0068853_100131074 3300005539 Bacteria 2244
70 Ga0070672_100005395 3300005543 Bacteria 8468
71 Ga0068855_100077059 3300005563 Bacteria 3868
72 Ga0068855_100136676 3300005563 Bacteria 2796
73 Ga0070664_100000019 3300005564 Bacteria 121708
74 Ga0068851_10000170 3300005834 Bacteria 33347
75 Ga0068851_10061925 3300005834 Bacteria 1919
76 Ga0075364_10006083 3300006051 Bacteria 7071
77 Ga0075364_10029261 3300006051 Bacteria 3532
78 Ga0075432_10001128 3300006058 Bacteria 8551
79 Ga0075366_10044050 3300006195 Bacteria 2644
80 Ga0097621_100048533 3300006237 Bacteria 3444
81 Ga0079104_1000004 3300006946 Bacteria 444549
82 Ga0105251_10000164 3300009011 Bacteria 68693
83 Ga0105251_10000870 3300009011 Bacteria 27091
84 Ga0105251_10004080 3300009011 Bacteria 10241
85 Ga0105251_10005616 3300009011 Bacteria 8157
86 Ga0105251_10005977 3300009011 Bacteria 7854
87 Ga0105251_10019299 3300009011 Bacteria 3605
88 Ga0105251_10020137 3300009011 Bacteria 3509
89 Ga0105251_10025501 3300009011 Bacteria 3023
90 Ga0105251_10071664 3300009011 Bacteria 1612
91 Ga0105244_10000327 3300009036 Bacteria 45346
92 Ga0105244_10001910 3300009036 Bacteria 16181
93 Ga0105244_10001938 3300009036 Bacteria 16083
94 Ga0105244_10002043 3300009036 Bacteria 15550
95 Ga0105244_10002430 3300009036 Bacteria 14052
96 Ga0105244_10004588 3300009036 Bacteria 9455
97 Ga0105244_10020953 3300009036 Bacteria 3622
98 Ga0105250_10000337 3300009092 Bacteria 36160
99 Ga0105250_10003445 3300009092 Bacteria 7496
100 Ga0105250_10018785 3300009092 Bacteria 2797
101 Ga0105243_10000067 3300009148 Bacteria 123656
102 Ga0105243_10002650 3300009148 Bacteria 14865
103 Ga0105242_10002802 3300009176 Bacteria 13656
104 Ga0105242_10442567 3300009176 Bacteria 1223
105 Ga0105248_10097045 3300009177 Bacteria 3321
106 Ga0105248_10129630 3300009177 Bacteria 2845
107 Ga0105237_10000093 3300009545 Bacteria 122006
108 Ga0105237_10229880 3300009545 Bacteria 1855
109 Ga0105238_10018266 3300009551 Bacteria 7133
110 Ga0105246_10002024 3300011119 Bacteria 12250
111 Ga0105246_10008857 3300011119 Bacteria 6193
112 Ga0105246_10009427 3300011119 Bacteria 6017
113 Ga0105246_10018354 3300011119 Bacteria 4458
114 Ga0157373_10000739 3300013100 Bacteria 25327
115 Ga0157373_10047786 3300013100 Bacteria 3052
116 Ga0157373_10087852 3300013100 Bacteria 2190
117 Ga0157373_10103295 3300013100 Bacteria 2005
118 Ga0157373_10131437 3300013100 Bacteria 1760
119 Ga0157371_10000780 3300013102 Bacteria 36631
120 Ga0157371_10013564 3300013102 Bacteria 6187
121 Ga0157371_10020225 3300013102 Bacteria 4899
122 Ga0157370_10000053 3300013104 Bacteria 119285
123 Ga0157370_10001977 3300013104 Bacteria 25193
124 Ga0157370_10037342 3300013104 Bacteria 4709
125 Ga0157370_10284624 3300013104 Bacteria 1527
126 Ga0157370_10285909 3300013104 Bacteria 1523
127 Ga0157369_10002960 3300013105 Bacteria 20309
128 Ga0157369_10011611 3300013105 Bacteria 10001
129 Ga0157369_10012325 3300013105 Bacteria 9711
130 Ga0171462_1023 3300013250 Bacteria 136797
131 Ga0157378_10205415 3300013297 Bacteria 1865
132 Ga0163162_10065393 3300013306 Bacteria 3683
133 Ga0163162_10242625 3300013306 Bacteria 1933
134 Ga0163162_10257219 3300013306 Bacteria 1878
135 Ga0163162_10472826 3300013306 Bacteria 1385
136 Ga0157372_10027933 3300013307 Bacteria 6150
137 Ga0157375_10001719 3300013308 Bacteria 18803
138 Ga0157375_10052240 3300013308 Bacteria 4017
139 Ga0157375_10070605 3300013308 Bacteria 3503
140 Ga0182008_10009313 3300014497 Bacteria 5307
141 Ga0182008_10059835 3300014497 Bacteria 1879
142 Ga0182008_10089892 3300014497 Bacteria 1513
143 Ga0157376_10152552 3300014969 Bacteria 2085
144 Ga0182006_1006542 3300015261 Bacteria 5407
145 Ga0182007_10002335 3300015262 Bacteria 9499
146 Ga0182007_10008173 3300015262 Bacteria 4315
147 Ga0182007_10009615 3300015262 Bacteria 3882
148 Ga0182007_10034779 3300015262 Bacteria 1700
149 Ga0182005_1011725 3300015265 Bacteria 2491
150 Ga0183361_10006 3300016635 Bacteria 368532
151 Ga0163161_10004415 3300017792 Bacteria 9809
152 Ga0213872_10045946 3300021361 Bacteria 1987
153 Ga0209566_100276 3300025225 Bacteria 47894
154 Ga0209674_100005 3300025226 Bacteria 1708125
155 Ga0209674_100146 3300025226 Bacteria 98804
156 Ga0209674_103030 3300025226 Bacteria 3239
157 Ga0209672_100001 3300025228 Bacteria 2828210
158 Ga0209672_100019 3300025228 Bacteria 432215
159 Ga0209672_100069 3300025228 Bacteria 174956
160 Ga0209147_100001 3300025229 Bacteria 2384371
161 Ga0209147_100026 3300025229 Bacteria 421622
162 Ga0209147_100044 3300025229 Bacteria 300330
163 Ga0209147_100128 3300025229 Bacteria 122259
164 Ga0209563_104186 3300025230 Bacteria 2804
165 Ga0209437_100115 3300025233 Bacteria 209911
166 Ga0209258_100001 3300025242 Bacteria 2384269
167 Ga0209258_100031 3300025242 Bacteria 463572
168 Ga0209258_100079 3300025242 Bacteria 263132
169 Ga0209148_1000003 3300025254 Bacteria 2384288
170 Ga0209148_1000027 3300025254 Bacteria 616374
171 Ga0209148_1001002 3300025254 Bacteria 17931
172 Ga0209759_1000079 3300025256 Bacteria 174354
173 Ga0209759_1000088 3300025256 Bacteria 165748
174 Ga0209759_1007984 3300025256 Bacteria 3343
175 Ga0209759_1019292 3300025256 Bacteria 1622
176 Ga0209233_1000016 3300025261 Bacteria 907830
177 Ga0209455_1000001 3300025272 Bacteria 2384278
178 Ga0209455_1000058 3300025272 Bacteria 342028
179 Ga0209455_1000421 3300025272 Bacteria 33292
180 Ga0209673_1000059 3300025273 Bacteria 268892
181 Ga0209676_1003489 3300025292 Bacteria 9630
182 Ga0209025_1002963 3300025294 Bacteria 16867
183 Ga0209564_1001947 3300025295 Bacteria 18289
184 Ga0209564_1011838 3300025295 Bacteria 3868
185 Ga0209050_1000013 3300025298 Bacteria 811408
186 Ga0207426_1000245 3300025302 Bacteria 120041
187 Ga0209051_1000007 3300025303 Bacteria 811408
188 Ga0207656_10042641 3300025321 Bacteria 1932
189 Ga0207696_1000035 3300025711 Bacteria 339626
190 Ga0207696_1000090 3300025711 Bacteria 188474
191 Ga0207696_1000176 3300025711 Bacteria 100134
192 Ga0207696_1000177 3300025711 Bacteria 100134
193 Ga0207696_1000348 3300025711 Bacteria 47596
194 Ga0207655_1000006 3300025728 Bacteria 861092
195 Ga0207655_1000137 3300025728 Bacteria 140084
196 Ga0207655_1000171 3300025728 Bacteria 118865
197 Ga0207655_1000628 3300025728 Bacteria 42395
198 Ga0207655_1002225 3300025728 Bacteria 16067
199 Ga0207655_1002878 3300025728 Bacteria 13293
200 Ga0207655_1033103 3300025728 Bacteria 2349
201 Ga0207655_1048410 3300025728 Bacteria 1745
202 Ga0207713_1000001 3300025735 Bacteria 2295391
203 Ga0207713_1000716 3300025735 Bacteria 30986
204 Ga0207713_1004703 3300025735 Bacteria 8791
205 Ga0207713_1006091 3300025735 Bacteria 7426
206 Ga0207713_1048709 3300025735 Bacteria 1704
207 Ga0207682_10003822 3300025893 Bacteria 6463
208 Ga0207647_10015111 3300025904 Bacteria 5303
209 Ga0207647_10159390 3300025904 Bacteria 1317
210 Ga0207645_10019998 3300025907 Bacteria 4383
211 Ga0207705_10000545 3300025909 Bacteria 31747
212 Ga0207695_10000625 3300025913 Bacteria 70978
213 Ga0207671_10000261 3300025914 Bacteria 79200
214 Ga0207671_10032044 3300025914 Bacteria 3914
215 Ga0207657_10000001 3300025919 Bacteria 458536
216 Ga0207649_10000207 3300025920 Bacteria 49166
217 Ga0207681_10012408 3300025923 Bacteria 5259
218 Ga0207650_10000145 3300025925 Bacteria 85892
219 Ga0207650_10001015 3300025925 Bacteria 21083
220 Ga0207650_10001027 3300025925 Bacteria 20954
221 Ga0207659_10001133 3300025926 Bacteria 15808
222 Ga0207644_10021910 3300025931 Bacteria 4358
223 Ga0207690_10000072 3300025932 Bacteria 88241
224 Ga0207706_10002953 3300025933 Bacteria 16416
225 Ga0207686_10008721 3300025934 Bacteria 5477
226 Ga0207709_10000004 3300025935 Bacteria 825156
227 Ga0207709_10000138 3300025935 Bacteria 104006
228 Ga0207669_10106232 3300025937 Bacteria 1869
229 Ga0207691_10001104 3300025940 Bacteria 26843
230 Ga0207679_10000045 3300025945 Bacteria 121851
231 Ga0207667_10001276 3300025949 Bacteria 31586
232 Ga0207651_10003576 3300025960 Bacteria 7641
233 Ga0207668_10187802 3300025972 Bacteria 1635
234 Ga0207639_10027034 3300026041 Bacteria 4175
235 Ga0207678_10001622 3300026067 Bacteria 20679
236 Ga0207683_10004624 3300026121 Bacteria 11862
237 Ga0209281_1000005 3300027111 Bacteria 1242284
238 Ga0209371_1000084 3300027312 Bacteria 180842
239 Ga0209371_1000127 3300027312 Bacteria 127069
240 Ga0209371_1000186 3300027312 Bacteria 90597
241 Ga0209371_1000190 3300027312 Bacteria 89981
242 Ga0209371_1000258 3300027312 Bacteria 64241
243 Ga0209371_1000457 3300027312 Bacteria 40260
244 Ga0209371_1001415 3300027312 Bacteria 16436
245 Ga0209371_1007034 3300027312 Bacteria 4015
246 Ga0209371_1008131 3300027312 Bacteria 3534
247 Ga0207428_10012907 3300027907 Bacteria 7324
248 Ga0268266_10183440 3300028379 Bacteria 1907
249 Ga0265338_10000437 3300028800 Bacteria 74941
250 Ga0268256_1000069 3300030500 Bacteria 195391
251 Ga0268256_1000075 3300030500 Bacteria 180814
252 Ga0268256_1000104 3300030500 Bacteria 127069
253 Ga0268256_1000215 3300030500 Bacteria 64669
254 Ga0268256_1000439 3300030500 Bacteria 37097
255 Ga0268256_1001212 3300030500 Bacteria 16436
256 Ga0268256_1004606 3300030500 Bacteria 5655
257 Ga0268256_1008907 3300030500 Bacteria 3390
258 Ga0307511_10000406 3300030521 Bacteria 45893
259 Ga0307408_100123246 3300031548 Bacteria 2011
260 Ga0307405_10000073 3300031731 Bacteria 44879
261 Ga0307405_10012594 3300031731 Bacteria 4485
262 Ga0307412_10000008 3300031911 Bacteria 461034
263 Ga0307416_100163487 3300032002 Bacteria 2061
264 Ga0373924_0002525 3300035410 Bacteria 6167
265 Ga0395901_0000011 3300038443 Bacteria 400724
266 Ga0400484_35478 3300038725 Bacteria 1485
267 Ga0400490_35226 3300038726 Bacteria 5129
268 Ga0400483_099993 3300039062 Bacteria 19421
269 Ga0400483_229956 3300039062 Bacteria 24419
270 Ga0400487_02139 3300039110 Bacteria 2134
271 Ga0436361_0296121 3300039447 Bacteria 160237
272 Ga0436361_0865024 3300039447 Bacteria 19252
273 Ga0439436_0016981 3300041404 Bacteria 2179
274 Ga0439447_040104 3300041407 Bacteria 1144
275 Ga0439465_0009313 3300041413 Bacteria 3094
276 Ga0439433_0000364 3300041999 Bacteria 8025
277 Ga0439445_0002315 3300042004 Bacteria 4226
278 Ga0439432_004301 3300042006 Bacteria 5206
279 Ga0439449_0006098 3300042007 Bacteria 4606
280 Ga0439452_000015 3300042010 Bacteria 342948
281 Ga0439452_000914 3300042010 Bacteria 13457
282 Ga0439462_0025859 3300042015 Bacteria 1546
283 Ga0450907_000104 3300042146 Bacteria 32519
284 Ga0439464_0016940 3300042439 Bacteria 1973
285 Ga0439464_0029536 3300042439 Bacteria 1532
286 Ga0451577_0038179 3300042876 Bacteria 4319
287 Ga0466965_0023874 3300044683 Bacteria 2955
288 Ga0466966_0000002 3300044684 Bacteria 370962
289 Ga0466961_0002576 3300044693 Bacteria 11238
290 Ga0466961_0111305 3300044693 Bacteria 1722
291 Ga0466963_0007401 3300044694 Bacteria 6542
292 Ga0466963_0204480 3300044694 Bacteria 1381
293 Ga0453684_0009647 3300044712 Bacteria 16822
294 Ga0453684_0061215 3300044712 Bacteria 4834
295 Ga0466971_0004081 3300044719 Bacteria 6286
296 Ga0466957_0130658 3300044842 Bacteria 1608
297 Ga0466957_0198140 3300044842 Bacteria 1318
298 Ga0466959_0040833 3300045049 Bacteria 3426
299 Ga0466958_0002465 3300045836 Bacteria 9300
300 Ga0495627_000023 3300046453 Bacteria 251113
301 Ga0495592_0000085 3300046454 Bacteria 82502
302 Ga0495592_0026430 3300046454 Bacteria 4401
303 Ga0495603_0009018 3300046455 Bacteria 6034
304 Ga0495603_0012089 3300046455 Bacteria 5226
305 Ga0495590_0001854 3300046457 Bacteria 8939
306 Ga0495590_0007039 3300046457 Bacteria 4359
307 Ga0495590_0026329 3300046457 Bacteria 2042
308 Ga0495591_000025 3300046458 Bacteria 189897
309 Ga0495591_009570 3300046458 Bacteria 3835
310 Ga0495629_0000022 3300046459 Bacteria 151761
311 Ga0495629_0001615 3300046459 Bacteria 17706
312 Ga0495629_0003716 3300046459 Bacteria 11502
313 Ga0495641_0013663 3300046461 Bacteria 4447
314 Ga0495641_0031135 3300046461 Bacteria 2551
315 Ga0495651_0123433 3300046462 Bacteria 1899
316 Ga0495653_0001160 3300046463 Bacteria 20299
317 Ga0495653_0007937 3300046463 Bacteria 8688
318 Ga0495653_0009844 3300046463 Bacteria 7817
319 Ga0495653_0077557 3300046463 Bacteria 2466
320 Ga0495650_0000149 3300046471 Bacteria 159524
321 Ga0495650_0001500 3300046471 Bacteria 22243
322 Ga0495650_0007453 3300046471 Bacteria 6569
323 Ga0495650_0020989 3300046471 Bacteria 3170
324 Ga0495580_0000047 3300046472 Bacteria 68842
325 Ga0495580_0001313 3300046472 Bacteria 21956
326 Ga0495580_0003496 3300046472 Bacteria 13367
327 Ga0495580_0070679 3300046472 Bacteria 2438
328 Ga0495580_0189525 3300046472 Bacteria 1418
329 Ga0495580_0189530 3300046472 Bacteria 1418
330 Ga0495582_0076613 3300046473 Bacteria 1854
331 Ga0495605_0000848 3300046474 Bacteria 21346
332 Ga0495605_0001095 3300046474 Bacteria 18057
333 Ga0495605_0001468 3300046474 Bacteria 15396
334 Ga0495605_0015260 3300046474 Bacteria 4184
335 Ga0495605_0042865 3300046474 Bacteria 2246
336 Ga0495639_0000049 3300046475 Bacteria 52674
337 Ga0495662_0011151 3300046476 Bacteria 4391
338 Ga0495664_0000200 3300046477 Bacteria 28962
339 Ga0495585_0025767 3300046492 Bacteria 3364
340 Ga0495594_0002273 3300046499 Bacteria 10011
341 Ga0495607_0000069 3300046501 Bacteria 101754
342 Ga0495607_0001068 3300046501 Bacteria 25025
343 Ga0495607_0022294 3300046501 Bacteria 3979
344 Ga0495607_0085198 3300046501 Bacteria 1726
345 Ga0495607_0100113 3300046501 Bacteria 1554
346 Ga0495583_0004214 3300046506 Bacteria 10464
347 Ga0495583_0016067 3300046506 Bacteria 4041
348 Ga0495606_0000155 3300046507 Bacteria 119163
349 Ga0495606_0001836 3300046507 Bacteria 26858
350 Ga0495606_0114438 3300046507 Bacteria 1623
351 Ga0495610_0001890 3300046512 Bacteria 18092
352 Ga0495616_0111828 3300046513 Bacteria 1268
353 Ga0495618_0128142 3300046514 Bacteria 1624
354 Ga0495620_0000110 3300046515 Bacteria 65755
355 Ga0495620_0013063 3300046515 Bacteria 4262
356 Ga0495628_0009213 3300046516 Bacteria 8438
357 Ga0495628_0018011 3300046516 Bacteria 5860
358 Ga0495630_0002611 3300046517 Bacteria 12479
359 Ga0495630_0014467 3300046517 Bacteria 5751
360 Ga0495632_0017180 3300046519 Bacteria 4001
361 Ga0495637_0003528 3300046520 Bacteria 8295
362 Ga0495637_0004992 3300046520 Bacteria 6828
363 Ga0495648_0003948 3300046524 Bacteria 12837
364 Ga0495648_0007625 3300046524 Bacteria 8634
365 Ga0495648_0046319 3300046524 Bacteria 2696
366 Ga0495666_0026417 3300046526 Bacteria 2861
367 Ga0495666_0043158 3300046526 Bacteria 2179
368 Ga0495666_0079012 3300046526 Bacteria 1558
369 Ga0495654_0060710 3300046530 Bacteria 1817
370 Ga0495665_0035541 3300046531 Bacteria 2661
371 Ga0495640_0034914 3300046533 Bacteria 3561
372 Ga0495587_0007840 3300046536 Bacteria 6896
373 Ga0495609_0049658 3300046538 Bacteria 1872
374 Ga0495597_0000068 3300046542 Bacteria 90143
375 Ga0495622_0000139 3300046557 Bacteria 62387
376 Ga0495622_0000528 3300046557 Bacteria 23093
377 Ga0495633_0000020 3300046558 Bacteria 227180
378 Ga0495667_0101079 3300046559 Bacteria 1866
379 Ga0495634_0026852 3300046642 Bacteria 4014
380 Ga0495611_0076242 3300046648 Bacteria 1537
381 Ga0495625_0017360 3300046660 Bacteria 5636
382 Ga0495635_0031160 3300046663 Bacteria 3704
383 Ga0495659_0000448 3300046664 Bacteria 15410
384 Ga0495661_0000009 3300046665 Bacteria 291327
385 Ga0495661_0000093 3300046665 Bacteria 109808
386 Ga0495661_0000100 3300046665 Bacteria 104957
387 Ga0495661_0001422 3300046665 Bacteria 20072
388 Ga0495661_0012289 3300046665 Bacteria 5783
389 Ga0495661_0013579 3300046665 Bacteria 5467
390 Ga0495599_0003484 3300046678 Bacteria 9208
391 Ga0495623_0038986 3300046679 Bacteria 3037
392 Ga0495623_0245793 3300046679 Bacteria 1008
393 Ga0495646_0049968 3300046680 Bacteria 2536
394 Ga0495646_0055390 3300046680 Bacteria 2381
395 Ga0495669_0070243 3300046684 Bacteria 1595
396 Ga0495613_0005055 3300046689 Bacteria 9888
397 Ga0495624_0001495 3300046690 Bacteria 18147
398 Ga0495624_0010050 3300046690 Bacteria 6530
399 Ga0495624_0055117 3300046690 Bacteria 2505
400 Ga0495624_0144421 3300046690 Bacteria 1456
401 Ga0495671_0042657 3300046692 Bacteria 2279
402 Ga0495649_0000336 3300046694 Bacteria 40372
403 Ga0495649_0002361 3300046694 Bacteria 13349
404 Ga0495649_0087709 3300046694 Bacteria 1660
405 Ga0495649_0136387 3300046694 Bacteria 1293
406 Ga0495589_0002872 3300046794 Bacteria 9536
407 Ga0495589_0005686 3300046794 Bacteria 6573
408 Ga0495589_0006461 3300046794 Bacteria 6180
409 Ga0495600_0013615 3300046809 Bacteria 5116
410 Ga0495660_0000761 3300046810 Bacteria 24239
411 Ga0495581_0019145 3300047315 Bacteria 3973
412 Ga0495674_0000750 3300047319 Bacteria 30755
413 Ga0495674_0008469 3300047319 Bacteria 9795
414 Ga0495674_0026003 3300047319 Bacteria 5356
415 Ga0495672_0000001 3300047320 Bacteria 1458820
416 Ga0495672_0000052 3300047320 Bacteria 236266
417 Ga0495672_0031408 3300047320 Bacteria 3315
418 Ga0495676_0000804 3300047321 Bacteria 26197
419 Ga0495676_0055845 3300047321 Bacteria 3127
420 Ga0495676_0059017 3300047321 Bacteria 3015
421 Ga0495676_0140118 3300047321 Bacteria 1734
422 Ga0495680_0005110 3300047322 Bacteria 12389
423 Ga0495680_0053008 3300047322 Bacteria 3159
424 Ga0495683_0000254 3300047323 Bacteria 48222
425 Ga0495683_0001678 3300047323 Bacteria 14099
426 Ga0495683_0003858 3300047323 Bacteria 8636
427 Ga0495683_0018026 3300047323 Bacteria 3654
428 Ga0495683_0102893 3300047323 Bacteria 1371
429 Ga0495687_003713 3300047443 Bacteria 10844
430 Ga0495687_039789 3300047443 Bacteria 2077
431 Ga0495675_0027315 3300047444 Bacteria 3636
432 Ga0495675_0106586 3300047444 Bacteria 1751
433 Ga0495675_0133940 3300047444 Bacteria 1539
434 Ga0495679_000033 3300047446 Bacteria 166523
435 Ga0495679_001055 3300047446 Bacteria 16754
436 Ga0495679_034159 3300047446 Bacteria 1620
437 Ga0495673_0000972 3300047469 Bacteria 25751
438 Ga0495673_0013456 3300047469 Bacteria 4293
439 Ga0495681_0022553 3300047470 Bacteria 3366
440 Ga0495684_0184129 3300047471 Bacteria 1547
441 Ga0495686_0000080 3300047472 Bacteria 201665
442 Ga0495686_0034170 3300047472 Bacteria 3277
443 Ga0495593_0009310 3300047673 Bacteria 5702
444 Ga0495593_0019388 3300047673 Bacteria 3813
445 Ga0495593_0032560 3300047673 Bacteria 2841
446 Ga0495593_0032665 3300047673 Bacteria 2835
447 Ga0495602_0052023 3300048088 Bacteria 3641
448 Ga0496100_0007475 3300048903 Bacteria 6030
449 Ga0496100_0032485 3300048903 Bacteria 3256
450 Ga0496100_0089522 3300048903 Bacteria 2097
451 Ga0496101_0000365 3300048904 Bacteria 30062
452 Ga0496101_0006013 3300048904 Bacteria 7782
453 Ga0496101_0196727 3300048904 Bacteria 1557
454 Ga0496102_0003703 3300048905 Bacteria 12922
455 Ga0496102_0012212 3300048905 Bacteria 7426
456 Ga0496102_0053540 3300048905 Bacteria 3678
457 Ga0496102_0094026 3300048905 Bacteria 2777
458 Ga0496103_0000509 3300048906 Bacteria 32057
459 Ga0496104_0154070 3300048907 Bacteria 2206
460 Ga0496105_0007423 3300048908 Bacteria 8483
461 Ga0496105_0058288 3300048908 Bacteria 3188
462 Ga0496106_0031483 3300048909 Bacteria 3953
463 Ga0496106_0341149 3300048909 Bacteria 1203
464 Ga0496112_0030464 3300048915 Bacteria 5222
465 Ga0496113_0195220 3300048916 Bacteria 1608
466 Ga0496115_0137368 3300048918 Bacteria 2016
467 Ga0496116_0000237 3300048919 Bacteria 100835
468 Ga0496116_0002504 3300048919 Bacteria 19234
469 Ga0496116_0009238 3300048919 Bacteria 8436
470 Ga0496116_0054330 3300048919 Bacteria 2640
471 Ga0496117_0000073 3300048920 Bacteria 236223
472 Ga0496117_0000294 3300048920 Bacteria 89536
473 Ga0496117_0000359 3300048920 Bacteria 79857
474 Ga0496117_0001052 3300048920 Bacteria 42055
475 Ga0496117_0001351 3300048920 Bacteria 35913
476 Ga0496117_0001750 3300048920 Bacteria 29891
477 Ga0496117_0018487 3300048920 Bacteria 5767
478 Ga0496117_0024383 3300048920 Bacteria 4787
479 Ga0496117_0028205 3300048920 Bacteria 4351
480 Ga0496117_0029299 3300048920 Bacteria 4247
481 Ga0496117_0115293 3300048920 Bacteria 1663
482 Ga0496118_0000449 3300048921 Bacteria 68182
483 Ga0496118_0000508 3300048921 Bacteria 64418
484 Ga0496118_0002694 3300048921 Bacteria 23398
485 Ga0496118_0004769 3300048921 Bacteria 15859
486 Ga0496118_0013377 3300048921 Bacteria 7768
487 Ga0496118_0047406 3300048921 Bacteria 3330
488 Ga0496118_0158919 3300048921 Bacteria 1401
489 Ga0496119_0000400 3300048922 Bacteria 59582
490 Ga0496119_0000523 3300048922 Bacteria 52176
491 Ga0496119_0002263 3300048922 Bacteria 21397
492 Ga0496119_0044806 3300048922 Bacteria 2780
493 Ga0496120_0000524 3300048923 Bacteria 59374
494 Ga0496120_0000728 3300048923 Bacteria 48229
495 Ga0496120_0002026 3300048923 Bacteria 22033
496 Ga0496120_0022124 3300048923 Bacteria 4003
497 Ga0496121_0000626 3300048924 Bacteria 65892
498 Ga0496121_0001053 3300048924 Bacteria 48912
499 Ga0496121_0017234 3300048924 Bacteria 7395
500 Ga0496121_0039538 3300048924 Bacteria 4153
501 Ga0496121_0062041 3300048924 Bacteria 3064
502 Ga0496121_0091262 3300048924 Bacteria 2379
503 Ga0496122_0003103 3300048925 Bacteria 22321
504 Ga0496122_0010612 3300048925 Bacteria 9461
505 Ga0496122_0020704 3300048925 Bacteria 5925
506 Ga0496122_0029999 3300048925 Bacteria 4568
507 Ga0496123_0004591 3300048926 Bacteria 14379
508 Ga0496123_0020411 3300048926 Bacteria 5183
509 Ga0496123_0045540 3300048926 Bacteria 2987
510 Ga0496124_0000004 3300048927 Bacteria 976131
511 Ga0496124_0000309 3300048927 Bacteria 90452
512 Ga0496124_0000600 3300048927 Bacteria 60608
513 Ga0496124_0062338 3300048927 Bacteria 3121
514 Ga0496124_0082211 3300048927 Bacteria 2644
515 Ga0496124_0102660 3300048927 Bacteria 2314
516 Ga0496124_0148430 3300048927 Bacteria 1842
517 Ga0496125_0003909 3300048928 Bacteria 17584
518 Ga0496125_0006719 3300048928 Bacteria 12368
519 Ga0496126_0000098 3300048929 Bacteria 205129
520 Ga0496126_0001174 3300048929 Bacteria 43118
521 Ga0496126_0004745 3300048929 Bacteria 16024
522 Ga0496126_0053113 3300048929 Bacteria 3678
523 Ga0496126_0055817 3300048929 Bacteria 3572
524 Ga0496126_0173714 3300048929 Bacteria 1834
525 Ga0495678_000007 3300049459 Bacteria 448039
526 Ga0495682_0000011 3300049460 Bacteria 278474
527 Ga0501039_0089634 3300049575 Bacteria 2397
528 Ga0501070_0102486 3300049586 Bacteria 2367
529 Ga0501074_0150753 3300049590 Bacteria 1662
530 Ga0501045_0069718 3300049824 Bacteria 2585
531 nmdc:mga00v17_174512_c1 3300050491 Bacteria 1386
532 nmdc:mga00v17_449_c1 3300050491 Bacteria 23134
533 nmdc:mga00v17_83107_c1 3300050491 Bacteria 2002
534 nmdc:mga0sz30_3595_c2 3300050516 Bacteria 4771
535 Ga0500618_004950 3300053125 Bacteria 4133
536 2501410484 2501025504 Bacteria 8008976
537 2501072600 2501025501 Bacteria 7768574
538 2501083343 2501025502 Bacteria 9641094
539 2510251567 2510065045 Bacteria 7761063
540 2510281912 2510065053 Bacteria 5005518
541 2510291926 2510065055 Bacteria 5037935
542 2510310060 2510065058 Bacteria 5005894
543 2511087081 2510917013 Bacteria 9951648
544 2511097050 2510917014 Bacteria 8296963
545 2511103860 2510917015 Bacteria 7950052
546 2511381697 2511231025 Bacteria 5324661
547 2512345456 2512047030 Bacteria 9031815
548 2513552290 2513237082 Bacteria 8640282
549 2513561078 2513237083 Bacteria 8410967
550 2513960162 2513237151 Bacteria 6309801
551 2514048933 2513237166 Bacteria 10373764
552 2515680701 2515154122 Bacteria 8609520
553 2516019524 2515154189 Bacteria 9629850
554 2519458369 2519103095 Bacteria 6629912
555 2527075602 2526164713 Bacteria 6780608
556 2563058881 2562617112 Bacteria 10918404
557 2585292756 2582581311 Bacteria 6763856
558 2599397559 2599185167 Bacteria 6353609
559 2599452004 2599185179 Bacteria 6611171
560 2599500771 2599185188 Bacteria 6164180
561 2599513614 2599185190 Bacteria 6285678
562 2599517886 2599185191 Bacteria 6297582
563 2599612508 2599185212 Bacteria 6765997
564 2599738233 2599185239 Bacteria 8686614
565 2599742396 2599185240 Bacteria 7968121
566 2599880662 2599185288 Bacteria 6666191
567 2599892291 2599185290 Bacteria 6289611
568 2599926707 2599185299 Bacteria 4854625
569 2599932437 2599185300 Bacteria 6062622
570 2599952037 2599185303 Bacteria 6512725
571 2600022113 2599185316 Bacteria 6320029
572 2600028379 2599185317 Bacteria 6435722
573 2600040760 2599185319 Bacteria 6637840
574 2600059375 2599185322 Bacteria 6763055
575 2600063097 2599185323 Bacteria 6688755
576 2600075387 2599185325 Bacteria 6324919
577 2600204514 2599185355 Bacteria 7968906
578 2600357546 2600254930 Bacteria 6431253
579 2600812210 2600255067 Bacteria 6795583
580 2608670176 2608642108 Bacteria 4104624
581 2621300165 2619619299 Bacteria 6649820
582 2624493096 2623620446 Bacteria 6500345
583 2644059588 2643221609 Bacteria 6756331
584 2644074730 2643221611 Bacteria 6820941
585 2644284468 2643221650 Bacteria 7029547
586 2650895951 2648501693 Bacteria 5069560
587 2671126466 2667528176 Bacteria 6724917
588 2676741499 2675903129 Bacteria 7964495
589 2677901191 2675903420 Bacteria 6247433
590 2678265453 2675903515 Bacteria 6580491
591 2686356077 2684622997 Bacteria 4624240
592 2713480069 2711768613 Bacteria 11048459
593 2719640681 2718217991 Bacteria 7829542
594 2722884250 2721755523 Bacteria 6430384
595 2723877538 2721755763 Bacteria 4464185
596 2738675138 2738541265 Bacteria 6594665
597 2738753428 2738541282 Bacteria 6593925
598 2738806217 2738541294 Bacteria 6925949
599 2738818742 2738541296 Bacteria 7285013
600 2738831102 2738541298 Bacteria 7286732
601 2738862340 2738541303 Bacteria 6591772
602 2738872629 2738541306 Bacteria 7284992
603 2738893577 2738541309 Bacteria 6926455
604 2739184259 2738543002 Bacteria 7284546
605 2739219229 2738543008 Bacteria 7282815
606 2739241118 2738543012 Bacteria 7115078
607 2745005904 2744054620 Bacteria 6551379
608 2746089767 2744054900 Bacteria 8399525
609 2746094414 2744054901 Bacteria 8397047
610 2753567127 2751185846 Bacteria 7242164
611 2774129917 2773857672 Bacteria 4993178
612 2792836167 2791355137 Bacteria 9654227
613 2794597284 2791355520 Bacteria 5948615
614 2808959050 2808606382 Bacteria 6841132
615 2808980348 2808606385 Bacteria 6711065
616 2808996069 2808606388 Bacteria 6706662
617 2809125412 2808606414 Bacteria 4917181
618 2816471804 2816332133 Bacteria 7249298
619 2817260513 2816332253 Bacteria 6764532
620 2817278200 2816332256 Bacteria 6891714
621 2817452561 2816332286 Bacteria 6853759
622 2817491511 2816332298 Bacteria 6852809
623 2819624667 2818991450 Bacteria 6962147
624 2819633057 2818991452 Bacteria 8442785
625 2826582029 2826581358 Bacteria 5963467
626 2834033428 2834028612 Bacteria 6354979
627 2838055577 2838054893 Bacteria 7451788
628 2842328535 2842324504 Bacteria 9364110
629 2842352851 2842348783 Bacteria 9002918
630 2842458794 2842454564 Bacteria 8730687
631 2842819388 2842815866 Bacteria 5947510
632 2842852364 2842849001 Bacteria 5924277
633 2844529305 2844528606 Bacteria 4733806
634 2847798768 2847797336 Bacteria 5176640
635 2852613950 2852612431 Bacteria 6885235
636 2852668313 2852667396 Bacteria 6885555
637 2855732769 2855730933 Bacteria 7047938
638 2855771521 2855767633 Bacteria 7049357
639 2856294155 2856287931 Bacteria 7223934
640 2857367409 2857357740 Bacteria 9937880
641 2857546196 2857542790 Bacteria 5326616
642 2860344324 2860339153 Bacteria 6846989
643 2860870024 2860867994 Bacteria 5645326
644 2863422064 2863421361 Bacteria 7300805
645 2865017115 2865014394 Bacteria 4764573
646 2870071996 2870068957 Bacteria 8925310
647 2876603099 2876601092 Bacteria 5114497
648 2881415565 2881412998 Bacteria 6492157
649 2883093118 2883087390 Bacteria 9532701
650 2885194738 2885192300 Bacteria 5882526
651 2885275689 2885270888 Bacteria 9831543
652 2902683785 2902682994 Bacteria 8951596
653 2904437534 2904434214 Bacteria 6230908
654 2904484497 2904483920 Bacteria 7545285
655 2904566227 2904564687 Bacteria 7609577
656 2904573271 2904571731 Bacteria 7608790
657 2904617335 2904615490 Bacteria 10047340
658 2913039851 2913036834 Bacteria 6704877
659 2917832682 2917832318 Bacteria 5346010
660 2919125471 2919125081 Bacteria 5385106
661 2919484890 2919481497 Bacteria 6907839
662 2919502000 2919501602 Bacteria 5286340
663 2919531539 2919527303 Bacteria 7718827
664 2921654174 2921643360 Bacteria 11448031
665 2923588683 2923586266 Bacteria 6565975
666 2926063673 2926063275 Bacteria 5285848
667 2928110643 2928108538 Bacteria 7360024
668 2928120447 2928115317 Bacteria 6477646
669 2928140159 2928135762 Bacteria 7259641
670 2928159352 2928157003 Bacteria 7522202
671 2928164587 2928163908 Bacteria 7561269
672 2928177288 2928170801 Bacteria 8785406
673 2928538207 2928536128 Bacteria 7657547
674 2929161767 2929160207 Bacteria 9075316
675 2931375392 2931369376 Bacteria 6847892
676 2931393486 2931390751 Bacteria 6273349
677 2939604390 2939602548 Bacteria 4950493
678 2945933000 2945928738 Bacteria 6053221
679 2945937442 2945934425 Bacteria 7444609
680 2945952021 2945951305 Bacteria 4918162
681 2952255948 2952252522 Bacteria 4171745
682 2974300294 2974298342 Bacteria 4840922
683 2978978513 2978975091 Bacteria 4704313
684 2981993783 2981990288 Bacteria 7590678
685 2984497733 2984494565 Bacteria 5000175
686 2984502714 2984499530 Bacteria 5020881
687 2984508674 2984504281 Bacteria 5262371
688 2990261678 2990261002 Bacteria 4919493
689 2990705862 2990703756 Bacteria 7715990
690 3007320426 3007315729 Bacteria 5076637
691 3007422335 3007419365 Bacteria 7026924
692 642426786 641736151 Bacteria 7477263
693 642416404 641736154 Bacteria 7689995
694 642593285 642555112 Bacteria 8676562
695 646814399 646564506 Bacteria 3192235
696 8003955649 8003955200 Bacteria 8601927
697 8016729050 8016728285 Bacteria 5263933
698 8016734896 8016733728 Bacteria 5274317
699 8018850545 8018845410 Bacteria 8933938
700 8019501618 8019499862 Bacteria 5169538
701 8020812046 8020807995 Bacteria 6801506
702 8020944399 8020938398 Bacteria 7472757
703 8020947075 8020945358 Bacteria 8467355
704 8020960097 8020953355 Bacteria 7439080
705 8021122957 8021120328 Bacteria 8782274
706 8039104211 8039098773 Bacteria 6602928
707 8040169172 8040167225 Bacteria 6542727
708 8040177847 8040173305 Bacteria 6827067
709 8054287570 8054285046 Bacteria 6919322
710 8054506783 8054503363 Bacteria 6101651
711 8055269024 8055266321 Bacteria 7999742
712 8055301989 8055301274 Bacteria 8587385
713 8055821556 8055817908 Bacteria 6609162
714 8056135225 8056131705 Bacteria 6107031
715 8056165646 8056161164 Bacteria 6106669
716 MRS2a_Contig_6865
717 MRS1b_contig_1130785
718 JGI24740J21852_10003531
719 JGI24740J21852_10044095
720 JGI24739J22299_10000111
721 JGI24739J22299_10009313
722 JGI24739J22299_10009453
723 JGI24735J21928_10000087
724 JGI24738J21930_10002901
725 JGI25156J39149_1000429
726 JGI25156J39149_1002844
727 JGI25156J39149_1017479
728 JGI25162J39368_1004043
729 JGI25165J46597_1000886
730 rootL2_10038977
731 rootL2_10137897
732 JGI25160J50197_1001438
733 Ga0055533_1000253
734 Ga0055533_1000303
735 Ga0055533_1001847
736 Ga0055532_1000001
737 Ga0055532_1002855
738 Ga0055527_1000002
739 Ga0055527_1000564
740 Ga0055527_1000600
741 Ga0055535_1000001
742 Ga0055535_1001424
743 Ga0055535_1001498
744 Ga0055542_1000001
745 Ga0055542_1001400
746 Ga0055529_1000001
747 Ga0055529_1000418
748 Ga0055530_10000016
749 Ga0055540_1000048
750 Ga0058692_1000510
751 Ga0058692_1000633
752 Ga0058692_1000833
753 Ga0058692_1002146
754 Ga0065165_1002944
755 Ga0065714_10003520
756 Ga0065714_10066603
757 Ga0065704_10015303
758 Ga0065712_10000124
759 Ga0065712_10171664
760 Ga0070658_10008756
761 Ga0070658_10120180
762 Ga0070676_10062871
763 Ga0070670_100003668
764 Ga0070670_100004735
765 Ga0070670_100006345
766 Ga0070677_10002183
767 Ga0070660_100000028
768 Ga0070661_100000025
769 Ga0070661_100109132
770 Ga0070668_100008307
771 Ga0070669_100002340
772 Ga0070669_100101741
773 Ga0070675_100002569
774 Ga0070671_100018623
775 Ga0070674_100001349
776 Ga0070659_100000152
777 Ga0070667_100157580
778 Ga0070694_100219837
779 Ga0070663_100002650
780 Ga0070678_100014570
781 Ga0070662_100004610
782 Ga0070662_100007483
783 Ga0070685_10179210
784 Ga0068853_100131074
785 Ga0070672_100005395
786 Ga0068855_100077059
787 Ga0068855_100136676
788 Ga0070664_100000019
789 Ga0068851_10000170
790 Ga0068851_10061925
791 Ga0075364_10006083
792 Ga0075364_10029261
793 Ga0075432_10001128
794 Ga0075366_10044050
795 Ga0097621_100048533
796 Ga0079104_1000004
797 Ga0105251_10000164
798 Ga0105251_10000870
799 Ga0105251_10004080
800 Ga0105251_10005616
801 Ga0105251_10005977
802 Ga0105251_10019299
803 Ga0105251_10020137
804 Ga0105251_10025501
805 Ga0105251_10071664
806 Ga0105244_10000327
807 Ga0105244_10001910
808 Ga0105244_10001938
809 Ga0105244_10002043
810 Ga0105244_10002430
811 Ga0105244_10004588
812 Ga0105244_10020953
813 Ga0105250_10000337
814 Ga0105250_10003445
815 Ga0105250_10018785
816 Ga0105243_10000067
817 Ga0105243_10002650
818 Ga0105242_10002802
819 Ga0105242_10442567
820 Ga0105248_10097045
821 Ga0105248_10129630
822 Ga0105237_10000093
823 Ga0105237_10229880
824 Ga0105238_10018266
825 Ga0105246_10002024
826 Ga0105246_10008857
827 Ga0105246_10009427
828 Ga0105246_10018354
829 Ga0157373_10000739
830 Ga0157373_10047786
831 Ga0157373_10087852
832 Ga0157373_10103295
833 Ga0157373_10131437
834 Ga0157371_10000780
835 Ga0157371_10013564
836 Ga0157371_10020225
837 Ga0157370_10000053
838 Ga0157370_10001977
839 Ga0157370_10037342
840 Ga0157370_10284624
841 Ga0157370_10285909
842 Ga0157369_10002960
843 Ga0157369_10011611
844 Ga0157369_10012325
845 Ga0171462_1023
846 Ga0157378_10205415
847 Ga0163162_10065393
848 Ga0163162_10242625
849 Ga0163162_10257219
850 Ga0163162_10472826
851 Ga0157372_10027933
852 Ga0157375_10001719
853 Ga0157375_10052240
854 Ga0157375_10070605
855 Ga0182008_10009313
856 Ga0182008_10059835
857 Ga0182008_10089892
858 Ga0157376_10152552
859 Ga0182006_1006542
860 Ga0182007_10002335
861 Ga0182007_10008173
862 Ga0182007_10009615
863 Ga0182007_10034779
864 Ga0182005_1011725
865 Ga0183361_10006
866 Ga0163161_10004415
867 Ga0213872_10045946
868 Ga0209566_100276
869 Ga0209674_100005
870 Ga0209674_100146
871 Ga0209674_103030
872 Ga0209672_100001
873 Ga0209672_100019
874 Ga0209672_100069
875 Ga0209147_100001
876 Ga0209147_100026
877 Ga0209147_100044
878 Ga0209147_100128
879 Ga0209563_104186
880 Ga0209437_100115
881 Ga0209258_100001
882 Ga0209258_100031
883 Ga0209258_100079
884 Ga0209148_1000003
885 Ga0209148_1000027
886 Ga0209148_1001002
887 Ga0209759_1000079
888 Ga0209759_1000088
889 Ga0209759_1007984
890 Ga0209759_1019292
891 Ga0209233_1000016
892 Ga0209455_1000001
893 Ga0209455_1000058
894 Ga0209455_1000421
895 Ga0209673_1000059
896 Ga0209676_1003489
897 Ga0209025_1002963
898 Ga0209564_1001947
899 Ga0209564_1011838
900 Ga0209050_1000013
901 Ga0207426_1000245
902 Ga0209051_1000007
903 Ga0207656_10042641
904 Ga0207696_1000035
905 Ga0207696_1000090
906 Ga0207696_1000176
907 Ga0207696_1000177
908 Ga0207696_1000348
909 Ga0207655_1000006
910 Ga0207655_1000137
911 Ga0207655_1000171
912 Ga0207655_1000628
913 Ga0207655_1002225
914 Ga0207655_1002878
915 Ga0207655_1033103
916 Ga0207655_1048410
917 Ga0207713_1000001
918 Ga0207713_1000716
919 Ga0207713_1004703
920 Ga0207713_1006091
921 Ga0207713_1048709
922 Ga0207682_10003822
923 Ga0207647_10015111
924 Ga0207647_10159390
925 Ga0207645_10019998
926 Ga0207705_10000545
927 Ga0207695_10000625
928 Ga0207671_10000261
929 Ga0207671_10032044
930 Ga0207657_10000001
931 Ga0207649_10000207
932 Ga0207681_10012408
933 Ga0207650_10000145
934 Ga0207650_10001015
935 Ga0207650_10001027
936 Ga0207659_10001133
937 Ga0207644_10021910
938 Ga0207690_10000072
939 Ga0207706_10002953
940 Ga0207686_10008721
941 Ga0207709_10000004
942 Ga0207709_10000138
943 Ga0207669_10106232
944 Ga0207691_10001104
945 Ga0207679_10000045
946 Ga0207667_10001276
947 Ga0207651_10003576
948 Ga0207668_10187802
949 Ga0207639_10027034
950 Ga0207678_10001622
951 Ga0207683_10004624
952 Ga0209281_1000005
953 Ga0209371_1000084
954 Ga0209371_1000127
955 Ga0209371_1000186
956 Ga0209371_1000190
957 Ga0209371_1000258
958 Ga0209371_1000457
959 Ga0209371_1001415
960 Ga0209371_1007034
961 Ga0209371_1008131
962 Ga0207428_10012907
963 Ga0268266_10183440
964 Ga0265338_10000437
965 Ga0268256_1000069
966 Ga0268256_1000075
967 Ga0268256_1000104
968 Ga0268256_1000215
969 Ga0268256_1000439
970 Ga0268256_1001212
971 Ga0268256_1004606
972 Ga0268256_1008907
973 Ga0307511_10000406
974 Ga0307408_100123246
975 Ga0307405_10000073
976 Ga0307405_10012594
977 Ga0307412_10000008
978 Ga0307416_100163487
979 Ga0373924_0002525
980 Ga0395901_0000011
981 Ga0400484_35478
982 Ga0400490_35226
983 Ga0400483_099993
984 Ga0400483_229956
985 Ga0400487_02139
986 Ga0436361_0296121
987 Ga0436361_0865024
988 Ga0439436_0016981
989 Ga0439447_040104
990 Ga0439465_0009313
991 Ga0439433_0000364
992 Ga0439445_0002315
993 Ga0439432_004301
994 Ga0439449_0006098
995 Ga0439452_000015
996 Ga0439452_000914
997 Ga0439462_0025859
998 Ga0450907_000104
999 Ga0439464_0016940
1000 Ga0439464_0029536
1001 Ga0451577_0038179
1002 Ga0466965_0023874
1003 Ga0466966_0000002
1004 Ga0466961_0002576
1005 Ga0466961_0111305
1006 Ga0466963_0007401
1007 Ga0466963_0204480
1008 Ga0453684_0009647
1009 Ga0453684_0061215
1010 Ga0466971_0004081
1011 Ga0466957_0130658
1012 Ga0466957_0198140
1013 Ga0466959_0040833
1014 Ga0466958_0002465
1015 Ga0495627_000023
1016 Ga0495592_0000085
1017 Ga0495592_0026430
1018 Ga0495603_0009018
1019 Ga0495603_0012089
1020 Ga0495590_0001854
1021 Ga0495590_0007039
1022 Ga0495590_0026329
1023 Ga0495591_000025
1024 Ga0495591_009570
1025 Ga0495629_0000022
1026 Ga0495629_0001615
1027 Ga0495629_0003716
1028 Ga0495641_0013663
1029 Ga0495641_0031135
1030 Ga0495651_0123433
1031 Ga0495653_0001160
1032 Ga0495653_0007937
1033 Ga0495653_0009844
1034 Ga0495653_0077557
1035 Ga0495650_0000149
1036 Ga0495650_0001500
1037 Ga0495650_0007453
1038 Ga0495650_0020989
1039 Ga0495580_0000047
1040 Ga0495580_0001313
1041 Ga0495580_0003496
1042 Ga0495580_0070679
1043 Ga0495580_0189525
1044 Ga0495580_0189530
1045 Ga0495582_0076613
1046 Ga0495605_0000848
1047 Ga0495605_0001095
1048 Ga0495605_0001468
1049 Ga0495605_0015260
1050 Ga0495605_0042865
1051 Ga0495639_0000049
1052 Ga0495662_0011151
1053 Ga0495664_0000200
1054 Ga0495585_0025767
1055 Ga0495594_0002273
1056 Ga0495607_0000069
1057 Ga0495607_0001068
1058 Ga0495607_0022294
1059 Ga0495607_0085198
1060 Ga0495607_0100113
1061 Ga0495583_0004214
1062 Ga0495583_0016067
1063 Ga0495606_0000155
1064 Ga0495606_0001836
1065 Ga0495606_0114438
1066 Ga0495610_0001890
1067 Ga0495616_0111828
1068 Ga0495618_0128142
1069 Ga0495620_0000110
1070 Ga0495620_0013063
1071 Ga0495628_0009213
1072 Ga0495628_0018011
1073 Ga0495630_0002611
1074 Ga0495630_0014467
1075 Ga0495632_0017180
1076 Ga0495637_0003528
1077 Ga0495637_0004992
1078 Ga0495648_0003948
1079 Ga0495648_0007625
1080 Ga0495648_0046319
1081 Ga0495666_0026417
1082 Ga0495666_0043158
1083 Ga0495666_0079012
1084 Ga0495654_0060710
1085 Ga0495665_0035541
1086 Ga0495640_0034914
1087 Ga0495587_0007840
1088 Ga0495609_0049658
1089 Ga0495597_0000068
1090 Ga0495622_0000139
1091 Ga0495622_0000528
1092 Ga0495633_0000020
1093 Ga0495667_0101079
1094 Ga0495634_0026852
1095 Ga0495611_0076242
1096 Ga0495625_0017360
1097 Ga0495635_0031160
1098 Ga0495659_0000448
1099 Ga0495661_0000009
1100 Ga0495661_0000093
1101 Ga0495661_0000100
1102 Ga0495661_0001422
1103 Ga0495661_0012289
1104 Ga0495661_0013579
1105 Ga0495599_0003484
1106 Ga0495623_0038986
1107 Ga0495623_0245793
1108 Ga0495646_0049968
1109 Ga0495646_0055390
1110 Ga0495669_0070243
1111 Ga0495613_0005055
1112 Ga0495624_0001495
1113 Ga0495624_0010050
1114 Ga0495624_0055117
1115 Ga0495624_0144421
1116 Ga0495671_0042657
1117 Ga0495649_0000336
1118 Ga0495649_0002361
1119 Ga0495649_0087709
1120 Ga0495649_0136387
1121 Ga0495589_0002872
1122 Ga0495589_0005686
1123 Ga0495589_0006461
1124 Ga0495600_0013615
1125 Ga0495660_0000761
1126 Ga0495581_0019145
1127 Ga0495674_0000750
1128 Ga0495674_0008469
1129 Ga0495674_0026003
1130 Ga0495672_0000001
1131 Ga0495672_0000052
1132 Ga0495672_0031408
1133 Ga0495676_0000804
1134 Ga0495676_0055845
1135 Ga0495676_0059017
1136 Ga0495676_0140118
1137 Ga0495680_0005110
1138 Ga0495680_0053008
1139 Ga0495683_0000254
1140 Ga0495683_0001678
1141 Ga0495683_0003858
1142 Ga0495683_0018026
1143 Ga0495683_0102893
1144 Ga0495687_003713
1145 Ga0495687_039789
1146 Ga0495675_0027315
1147 Ga0495675_0106586
1148 Ga0495675_0133940
1149 Ga0495679_000033
1150 Ga0495679_001055
1151 Ga0495679_034159
1152 Ga0495673_0000972
1153 Ga0495673_0013456
1154 Ga0495681_0022553
1155 Ga0495684_0184129
1156 Ga0495686_0000080
1157 Ga0495686_0034170
1158 Ga0495593_0009310
1159 Ga0495593_0019388
1160 Ga0495593_0032560
1161 Ga0495593_0032665
1162 Ga0495602_0052023
1163 Ga0496100_0007475
1164 Ga0496100_0032485
1165 Ga0496100_0089522
1166 Ga0496101_0000365
1167 Ga0496101_0006013
1168 Ga0496101_0196727
1169 Ga0496102_0003703
1170 Ga0496102_0012212
1171 Ga0496102_0053540
1172 Ga0496102_0094026
1173 Ga0496103_0000509
1174 Ga0496104_0154070
1175 Ga0496105_0007423
1176 Ga0496105_0058288
1177 Ga0496106_0031483
1178 Ga0496106_0341149
1179 Ga0496112_0030464
1180 Ga0496113_0195220
1181 Ga0496115_0137368
1182 Ga0496116_0000237
1183 Ga0496116_0002504
1184 Ga0496116_0009238
1185 Ga0496116_0054330
1186 Ga0496117_0000073
1187 Ga0496117_0000294
1188 Ga0496117_0000359
1189 Ga0496117_0001052
1190 Ga0496117_0001351
1191 Ga0496117_0001750
1192 Ga0496117_0018487
1193 Ga0496117_0024383
1194 Ga0496117_0028205
1195 Ga0496117_0029299
1196 Ga0496117_0115293
1197 Ga0496118_0000449
1198 Ga0496118_0000508
1199 Ga0496118_0002694
1200 Ga0496118_0004769
1201 Ga0496118_0013377
1202 Ga0496118_0047406
1203 Ga0496118_0158919
1204 Ga0496119_0000400
1205 Ga0496119_0000523
1206 Ga0496119_0002263
1207 Ga0496119_0044806
1208 Ga0496120_0000524
1209 Ga0496120_0000728
1210 Ga0496120_0002026
1211 Ga0496120_0022124
1212 Ga0496121_0000626
1213 Ga0496121_0001053
1214 Ga0496121_0017234
1215 Ga0496121_0039538
1216 Ga0496121_0062041
1217 Ga0496121_0091262
1218 Ga0496122_0003103
1219 Ga0496122_0010612
1220 Ga0496122_0020704
1221 Ga0496122_0029999
1222 Ga0496123_0004591
1223 Ga0496123_0020411
1224 Ga0496123_0045540
1225 Ga0496124_0000004
1226 Ga0496124_0000309
1227 Ga0496124_0000600
1228 Ga0496124_0062338
1229 Ga0496124_0082211
1230 Ga0496124_0102660
1231 Ga0496124_0148430
1232 Ga0496125_0003909
1233 Ga0496125_0006719
1234 Ga0496126_0000098
1235 Ga0496126_0001174
1236 Ga0496126_0004745
1237 Ga0496126_0053113
1238 Ga0496126_0055817
1239 Ga0496126_0173714
1240 Ga0495678_000007
1241 Ga0495682_0000011
1242 Ga0501039_0089634
1243 Ga0501070_0102486
1244 Ga0501074_0150753
1245 Ga0501045_0069718
1246 nmdc:mga00v17_174512_c1
1247 nmdc:mga00v17_449_c1
1248 nmdc:mga00v17_83107_c1
1249 nmdc:mga0sz30_3595_c2
1250 Ga0500618_004950
1251 2501410484
1252 2501072600
1253 2501083343
1254 2510251567
1255 2510281912
1256 2510291926
1257 2510310060
1258 2511087081
1259 2511097050
1260 2511103860
1261 2511381697
1262 2512345456
1263 2513552290
1264 2513561078
1265 2513960162
1266 2514048933
1267 2515680701
1268 2516019524
1269 2519458369
1270 2527075602
1271 2563058881
1272 2585292756
1273 2599397559
1274 2599452004
1275 2599500771
1276 2599513614
1277 2599517886
1278 2599612508
1279 2599738233
1280 2599742396
1281 2599880662
1282 2599892291
1283 2599926707
1284 2599932437
1285 2599952037
1286 2600022113
1287 2600028379
1288 2600040760
1289 2600059375
1290 2600063097
1291 2600075387
1292 2600204514
1293 2600357546
1294 2600812210
1295 2608670176
1296 2621300165
1297 2624493096
1298 2644059588
1299 2644074730
1300 2644284468
1301 2650895951
1302 2671126466
1303 2676741499
1304 2677901191
1305 2678265453
1306 2686356077
1307 2713480069
1308 2719640681
1309 2722884250
1310 2723877538
1311 2738675138
1312 2738753428
1313 2738806217
1314 2738818742
1315 2738831102
1316 2738862340
1317 2738872629
1318 2738893577
1319 2739184259
1320 2739219229
1321 2739241118
1322 2745005904
1323 2746089767
1324 2746094414
1325 2753567127
1326 2774129917
1327 2792836167
1328 2794597284
1329 2808959050
1330 2808980348
1331 2808996069
1332 2809125412
1333 2816471804
1334 2817260513
1335 2817278200
1336 2817452561
1337 2817491511
1338 2819624667
1339 2819633057
1340 2826582029
1341 2834033428
1342 2838055577
1343 2842328535
1344 2842352851
1345 2842458794
1346 2842819388
1347 2842852364
1348 2844529305
1349 2847798768
1350 2852613950
1351 2852668313
1352 2855732769
1353 2855771521
1354 2856294155
1355 2857367409
1356 2857546196
1357 2860344324
1358 2860870024
1359 2863422064
1360 2865017115
1361 2870071996
1362 2876603099
1363 2881415565
1364 2883093118
1365 2885194738
1366 2885275689
1367 2902683785
1368 2904437534
1369 2904484497
1370 2904566227
1371 2904573271
1372 2904617335
1373 2913039851
1374 2917832682
1375 2919125471
1376 2919484890
1377 2919502000
1378 2919531539
1379 2921654174
1380 2923588683
1381 2926063673
1382 2928110643
1383 2928120447
1384 2928140159
1385 2928159352
1386 2928164587
1387 2928177288
1388 2928538207
1389 2929161767
1390 2931375392
1391 2931393486
1392 2939604390
1393 2945933000
1394 2945937442
1395 2945952021
1396 2952255948
1397 2974300294
1398 2978978513
1399 2981993783
1400 2984497733
1401 2984502714
1402 2984508674
1403 2990261678
1404 2990705862
1405 3007320426
1406 3007422335
1407 642426786
1408 642416404
1409 642593285
1410 646814399
1411 8003955649
1412 8016729050
1413 8016734896
1414 8018850545
1415 8019501618
1416 8020812046
1417 8020944399
1418 8020947075
1419 8020960097
1420 8021122957
1421 8039104211
1422 8040169172
1423 8040177847
1424 8054287570
1425 8054506783
1426 8055269024
1427 8055301989
1428 8055821556
1429 8056135225
1430 8056165646

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

135

383

0.93

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

102

366

0.87

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

100

348

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

95

340

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8465 23 333
5t1p-assembly5.cif.gz_E crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni 0.8405 18 333
6j2s-assembly2.cif.gz_B structure of hita bound to gallium from pseudomonas aeruginosa 0.8382 24 334
7f6r-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (s164a) protein (mcta) of abc transporter in apo state 0.8335 25 333
6j2s-assembly2.cif.gz_B structure of hita bound to gallium from pseudomonas aeruginosa 0.8332 24 334
ID Description Score Start End Superfamily
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8938 26 290 3.40.190.10
1xvyA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8669 26 120 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8594 26 290 3.40.190.10
1q35A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8556 22 292 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.855 23 299 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0K2W9X9-F1-model_v4 deleted 0.951 1 334
AF-A0A2W5PPI8-F1-model_v4 ABC transporter substrate-binding protein 0.9488 110 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A0K2W9X9-F1-model_v4 deleted 0.9455 1 334
AF-A0A7J3XZ67-F1-model_v4 Extracellular solute-binding protein 0.9431 23 333 GO:0015888
GO:0030975
GO:0030976
AF-A0A2W5PPI8-F1-model_v4 ABC transporter substrate-binding protein 0.94 110 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Map