F477019
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 446 | 1430 | 340 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2501025504|2501410484 |
| Length | 396 |
| Sequence | PAFAGPLSLVPVRAALRALAAPVRRLTRLTRLTRLTRLTRLTRLTRLTRLTRLPRLTRFSHALPLAAGAAALVAGLAAPLAAQADQTAICYNCPPEWADWASQIQAIQKETGIRVPFDNKNSGQSIAQLMAEQKSPVADVVYLGVSSAFQAKDKGVITPYKPAHWNDIPADLKDPQGYWFAIHSGTLGFFVNKDALEGKPVPHSWADLLKPEYKGMVGYLDPSSAFVGYAGAVAVNLALGGTLDNFQPAFEWFGKLKANQPIVPKQTAYARVLSGEIPILLDYDFDAYRAKYKDHANVEFVIPKEGTISVPYVMSLVKNGPHEANGKKVLDFVLSDEGQKLWANAYLRPVRASALSPEAASKFLPASDYARAKPVDFAKMAAQQQAFGERYLQIMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 140 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 141 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 142 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 143 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 144 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 145 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 146 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 147 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 148 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 149 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 150 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 151 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 152 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 153 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 154 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 161 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 162 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 266 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 267 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 268 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 269 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 270 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 271 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 272 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 273 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 274 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 275 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 276 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 277 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 278 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 279 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 280 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 281 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 282 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 283 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 284 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 285 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 286 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 287 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 288 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 289 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 290 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 291 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 292 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 293 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 294 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 295 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 296 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 297 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 298 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 299 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 300 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 301 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 302 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 303 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 304 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 305 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 306 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 307 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 308 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 309 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 310 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 311 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 312 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 313 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 314 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 315 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 316 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 317 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 318 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 319 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 320 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 321 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 322 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 323 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 324 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 325 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 326 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 327 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 328 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 329 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 330 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 331 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 332 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 333 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 334 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 335 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 336 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 337 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 338 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 339 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 340 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 341 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 342 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 343 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 344 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 345 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 346 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 347 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 348 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 349 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 350 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 351 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 352 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 353 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 354 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 355 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 356 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 357 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 358 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 359 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 360 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 361 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 362 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 363 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 364 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 365 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 366 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 367 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 368 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 369 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 370 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 371 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 372 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 373 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 374 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 375 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 376 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 377 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 378 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 379 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 380 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 381 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 382 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 383 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 384 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 385 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 386 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 387 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 388 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 389 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 390 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 391 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 392 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 393 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 394 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 395 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 396 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 397 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 398 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 399 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 400 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 401 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 402 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 403 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 404 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 405 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 406 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 407 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 408 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 409 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 410 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 411 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 412 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 413 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 414 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 415 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 416 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 417 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 418 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 419 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 420 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 421 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 422 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 423 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 424 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 425 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 426 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 427 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 428 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 429 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 430 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 431 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 432 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 433 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 434 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 435 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 436 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 437 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 438 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 439 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 440 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 441 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 442 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 443 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 444 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 445 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 446 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.83 |
| Metatranscriptomes | 0 |
| Isolates | 25.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.56 |
| Bulb | 0 |
| Endosphere | 8.39 |
| Nodule | 3.36 |
| Rhizoplane | 6.29 |
| Rhizosphere | 60.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6865 | 2124908027 | Bacteria | 2759 |
| 2 | MRS1b_contig_1130785 | 2162886011 | Bacteria | 1481 |
| 3 | JGI24740J21852_10003531 | 3300001979 | Bacteria | 6850 |
| 4 | JGI24740J21852_10044095 | 3300001979 | Bacteria | 1326 |
| 5 | JGI24739J22299_10000111 | 3300001989 | Bacteria | 25218 |
| 6 | JGI24739J22299_10009313 | 3300001989 | Bacteria | 3663 |
| 7 | JGI24739J22299_10009453 | 3300001989 | Bacteria | 3633 |
| 8 | JGI24735J21928_10000087 | 3300002067 | Bacteria | 35083 |
| 9 | JGI24738J21930_10002901 | 3300002075 | Bacteria | 4390 |
| 10 | JGI25156J39149_1000429 | 3300002705 | Bacteria | 26030 |
| 11 | JGI25156J39149_1002844 | 3300002705 | Bacteria | 5955 |
| 12 | JGI25156J39149_1017479 | 3300002705 | Bacteria | 1357 |
| 13 | JGI25162J39368_1004043 | 3300002737 | Bacteria | 3672 |
| 14 | JGI25165J46597_1000886 | 3300003214 | Bacteria | 21064 |
| 15 | rootL2_10038977 | 3300003322 | Bacteria | 5679 |
| 16 | rootL2_10137897 | 3300003322 | Bacteria | 2831 |
| 17 | JGI25160J50197_1001438 | 3300003354 | Bacteria | 11911 |
| 18 | Ga0055533_1000253 | 3300003756 | Bacteria | 32721 |
| 19 | Ga0055533_1000303 | 3300003756 | Bacteria | 24530 |
| 20 | Ga0055533_1001847 | 3300003756 | Bacteria | 5300 |
| 21 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 22 | Ga0055532_1002855 | 3300003758 | Bacteria | 3304 |
| 23 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 24 | Ga0055527_1000564 | 3300003760 | Bacteria | 12217 |
| 25 | Ga0055527_1000600 | 3300003760 | Bacteria | 11625 |
| 26 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 27 | Ga0055535_1001424 | 3300003761 | Bacteria | 12217 |
| 28 | Ga0055535_1001498 | 3300003761 | Bacteria | 11625 |
| 29 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 30 | Ga0055542_1001400 | 3300003762 | Bacteria | 12217 |
| 31 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 32 | Ga0055529_1000418 | 3300003763 | Bacteria | 43789 |
| 33 | Ga0055530_10000016 | 3300003791 | Bacteria | 146874 |
| 34 | Ga0055540_1000048 | 3300003792 | Bacteria | 146874 |
| 35 | Ga0058692_1000510 | 3300003856 | Bacteria | 17182 |
| 36 | Ga0058692_1000633 | 3300003856 | Bacteria | 14532 |
| 37 | Ga0058692_1000833 | 3300003856 | Bacteria | 12218 |
| 38 | Ga0058692_1002146 | 3300003856 | Bacteria | 6783 |
| 39 | Ga0065165_1002944 | 3300005262 | Bacteria | 12976 |
| 40 | Ga0065714_10003520 | 3300005288 | Bacteria | 9242 |
| 41 | Ga0065714_10066603 | 3300005288 | Bacteria | 6571 |
| 42 | Ga0065704_10015303 | 3300005289 | Bacteria | 3570 |
| 43 | Ga0065712_10000124 | 3300005290 | Bacteria | 105429 |
| 44 | Ga0065712_10171664 | 3300005290 | Bacteria | 1240 |
| 45 | Ga0070658_10008756 | 3300005327 | Bacteria | 8130 |
| 46 | Ga0070658_10120180 | 3300005327 | Bacteria | 2183 |
| 47 | Ga0070676_10062871 | 3300005328 | Bacteria | 2210 |
| 48 | Ga0070670_100003668 | 3300005331 | Bacteria | 12797 |
| 49 | Ga0070670_100004735 | 3300005331 | Bacteria | 11419 |
| 50 | Ga0070670_100006345 | 3300005331 | Bacteria | 10007 |
| 51 | Ga0070677_10002183 | 3300005333 | Bacteria | 6252 |
| 52 | Ga0070660_100000028 | 3300005339 | Bacteria | 88388 |
| 53 | Ga0070661_100000025 | 3300005344 | Bacteria | 121698 |
| 54 | Ga0070661_100109132 | 3300005344 | Bacteria | 2065 |
| 55 | Ga0070668_100008307 | 3300005347 | Bacteria | 7706 |
| 56 | Ga0070669_100002340 | 3300005353 | Bacteria | 13700 |
| 57 | Ga0070669_100101741 | 3300005353 | Bacteria | 2169 |
| 58 | Ga0070675_100002569 | 3300005354 | Bacteria | 13593 |
| 59 | Ga0070671_100018623 | 3300005355 | Bacteria | 5641 |
| 60 | Ga0070674_100001349 | 3300005356 | Bacteria | 12937 |
| 61 | Ga0070659_100000152 | 3300005366 | Bacteria | 52790 |
| 62 | Ga0070667_100157580 | 3300005367 | Bacteria | 1998 |
| 63 | Ga0070694_100219837 | 3300005444 | Bacteria | 1424 |
| 64 | Ga0070663_100002650 | 3300005455 | Bacteria | 10129 |
| 65 | Ga0070678_100014570 | 3300005456 | Bacteria | 4967 |
| 66 | Ga0070662_100004610 | 3300005457 | Bacteria | 8732 |
| 67 | Ga0070662_100007483 | 3300005457 | Bacteria | 7081 |
| 68 | Ga0070685_10179210 | 3300005466 | Bacteria | 1363 |
| 69 | Ga0068853_100131074 | 3300005539 | Bacteria | 2244 |
| 70 | Ga0070672_100005395 | 3300005543 | Bacteria | 8468 |
| 71 | Ga0068855_100077059 | 3300005563 | Bacteria | 3868 |
| 72 | Ga0068855_100136676 | 3300005563 | Bacteria | 2796 |
| 73 | Ga0070664_100000019 | 3300005564 | Bacteria | 121708 |
| 74 | Ga0068851_10000170 | 3300005834 | Bacteria | 33347 |
| 75 | Ga0068851_10061925 | 3300005834 | Bacteria | 1919 |
| 76 | Ga0075364_10006083 | 3300006051 | Bacteria | 7071 |
| 77 | Ga0075364_10029261 | 3300006051 | Bacteria | 3532 |
| 78 | Ga0075432_10001128 | 3300006058 | Bacteria | 8551 |
| 79 | Ga0075366_10044050 | 3300006195 | Bacteria | 2644 |
| 80 | Ga0097621_100048533 | 3300006237 | Bacteria | 3444 |
| 81 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 82 | Ga0105251_10000164 | 3300009011 | Bacteria | 68693 |
| 83 | Ga0105251_10000870 | 3300009011 | Bacteria | 27091 |
| 84 | Ga0105251_10004080 | 3300009011 | Bacteria | 10241 |
| 85 | Ga0105251_10005616 | 3300009011 | Bacteria | 8157 |
| 86 | Ga0105251_10005977 | 3300009011 | Bacteria | 7854 |
| 87 | Ga0105251_10019299 | 3300009011 | Bacteria | 3605 |
| 88 | Ga0105251_10020137 | 3300009011 | Bacteria | 3509 |
| 89 | Ga0105251_10025501 | 3300009011 | Bacteria | 3023 |
| 90 | Ga0105251_10071664 | 3300009011 | Bacteria | 1612 |
| 91 | Ga0105244_10000327 | 3300009036 | Bacteria | 45346 |
| 92 | Ga0105244_10001910 | 3300009036 | Bacteria | 16181 |
| 93 | Ga0105244_10001938 | 3300009036 | Bacteria | 16083 |
| 94 | Ga0105244_10002043 | 3300009036 | Bacteria | 15550 |
| 95 | Ga0105244_10002430 | 3300009036 | Bacteria | 14052 |
| 96 | Ga0105244_10004588 | 3300009036 | Bacteria | 9455 |
| 97 | Ga0105244_10020953 | 3300009036 | Bacteria | 3622 |
| 98 | Ga0105250_10000337 | 3300009092 | Bacteria | 36160 |
| 99 | Ga0105250_10003445 | 3300009092 | Bacteria | 7496 |
| 100 | Ga0105250_10018785 | 3300009092 | Bacteria | 2797 |
| 101 | Ga0105243_10000067 | 3300009148 | Bacteria | 123656 |
| 102 | Ga0105243_10002650 | 3300009148 | Bacteria | 14865 |
| 103 | Ga0105242_10002802 | 3300009176 | Bacteria | 13656 |
| 104 | Ga0105242_10442567 | 3300009176 | Bacteria | 1223 |
| 105 | Ga0105248_10097045 | 3300009177 | Bacteria | 3321 |
| 106 | Ga0105248_10129630 | 3300009177 | Bacteria | 2845 |
| 107 | Ga0105237_10000093 | 3300009545 | Bacteria | 122006 |
| 108 | Ga0105237_10229880 | 3300009545 | Bacteria | 1855 |
| 109 | Ga0105238_10018266 | 3300009551 | Bacteria | 7133 |
| 110 | Ga0105246_10002024 | 3300011119 | Bacteria | 12250 |
| 111 | Ga0105246_10008857 | 3300011119 | Bacteria | 6193 |
| 112 | Ga0105246_10009427 | 3300011119 | Bacteria | 6017 |
| 113 | Ga0105246_10018354 | 3300011119 | Bacteria | 4458 |
| 114 | Ga0157373_10000739 | 3300013100 | Bacteria | 25327 |
| 115 | Ga0157373_10047786 | 3300013100 | Bacteria | 3052 |
| 116 | Ga0157373_10087852 | 3300013100 | Bacteria | 2190 |
| 117 | Ga0157373_10103295 | 3300013100 | Bacteria | 2005 |
| 118 | Ga0157373_10131437 | 3300013100 | Bacteria | 1760 |
| 119 | Ga0157371_10000780 | 3300013102 | Bacteria | 36631 |
| 120 | Ga0157371_10013564 | 3300013102 | Bacteria | 6187 |
| 121 | Ga0157371_10020225 | 3300013102 | Bacteria | 4899 |
| 122 | Ga0157370_10000053 | 3300013104 | Bacteria | 119285 |
| 123 | Ga0157370_10001977 | 3300013104 | Bacteria | 25193 |
| 124 | Ga0157370_10037342 | 3300013104 | Bacteria | 4709 |
| 125 | Ga0157370_10284624 | 3300013104 | Bacteria | 1527 |
| 126 | Ga0157370_10285909 | 3300013104 | Bacteria | 1523 |
| 127 | Ga0157369_10002960 | 3300013105 | Bacteria | 20309 |
| 128 | Ga0157369_10011611 | 3300013105 | Bacteria | 10001 |
| 129 | Ga0157369_10012325 | 3300013105 | Bacteria | 9711 |
| 130 | Ga0171462_1023 | 3300013250 | Bacteria | 136797 |
| 131 | Ga0157378_10205415 | 3300013297 | Bacteria | 1865 |
| 132 | Ga0163162_10065393 | 3300013306 | Bacteria | 3683 |
| 133 | Ga0163162_10242625 | 3300013306 | Bacteria | 1933 |
| 134 | Ga0163162_10257219 | 3300013306 | Bacteria | 1878 |
| 135 | Ga0163162_10472826 | 3300013306 | Bacteria | 1385 |
| 136 | Ga0157372_10027933 | 3300013307 | Bacteria | 6150 |
| 137 | Ga0157375_10001719 | 3300013308 | Bacteria | 18803 |
| 138 | Ga0157375_10052240 | 3300013308 | Bacteria | 4017 |
| 139 | Ga0157375_10070605 | 3300013308 | Bacteria | 3503 |
| 140 | Ga0182008_10009313 | 3300014497 | Bacteria | 5307 |
| 141 | Ga0182008_10059835 | 3300014497 | Bacteria | 1879 |
| 142 | Ga0182008_10089892 | 3300014497 | Bacteria | 1513 |
| 143 | Ga0157376_10152552 | 3300014969 | Bacteria | 2085 |
| 144 | Ga0182006_1006542 | 3300015261 | Bacteria | 5407 |
| 145 | Ga0182007_10002335 | 3300015262 | Bacteria | 9499 |
| 146 | Ga0182007_10008173 | 3300015262 | Bacteria | 4315 |
| 147 | Ga0182007_10009615 | 3300015262 | Bacteria | 3882 |
| 148 | Ga0182007_10034779 | 3300015262 | Bacteria | 1700 |
| 149 | Ga0182005_1011725 | 3300015265 | Bacteria | 2491 |
| 150 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 151 | Ga0163161_10004415 | 3300017792 | Bacteria | 9809 |
| 152 | Ga0213872_10045946 | 3300021361 | Bacteria | 1987 |
| 153 | Ga0209566_100276 | 3300025225 | Bacteria | 47894 |
| 154 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 155 | Ga0209674_100146 | 3300025226 | Bacteria | 98804 |
| 156 | Ga0209674_103030 | 3300025226 | Bacteria | 3239 |
| 157 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 158 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 159 | Ga0209672_100069 | 3300025228 | Bacteria | 174956 |
| 160 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 161 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 162 | Ga0209147_100044 | 3300025229 | Bacteria | 300330 |
| 163 | Ga0209147_100128 | 3300025229 | Bacteria | 122259 |
| 164 | Ga0209563_104186 | 3300025230 | Bacteria | 2804 |
| 165 | Ga0209437_100115 | 3300025233 | Bacteria | 209911 |
| 166 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 167 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 168 | Ga0209258_100079 | 3300025242 | Bacteria | 263132 |
| 169 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 170 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 171 | Ga0209148_1001002 | 3300025254 | Bacteria | 17931 |
| 172 | Ga0209759_1000079 | 3300025256 | Bacteria | 174354 |
| 173 | Ga0209759_1000088 | 3300025256 | Bacteria | 165748 |
| 174 | Ga0209759_1007984 | 3300025256 | Bacteria | 3343 |
| 175 | Ga0209759_1019292 | 3300025256 | Bacteria | 1622 |
| 176 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 177 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 178 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 179 | Ga0209455_1000421 | 3300025272 | Bacteria | 33292 |
| 180 | Ga0209673_1000059 | 3300025273 | Bacteria | 268892 |
| 181 | Ga0209676_1003489 | 3300025292 | Bacteria | 9630 |
| 182 | Ga0209025_1002963 | 3300025294 | Bacteria | 16867 |
| 183 | Ga0209564_1001947 | 3300025295 | Bacteria | 18289 |
| 184 | Ga0209564_1011838 | 3300025295 | Bacteria | 3868 |
| 185 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 186 | Ga0207426_1000245 | 3300025302 | Bacteria | 120041 |
| 187 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 188 | Ga0207656_10042641 | 3300025321 | Bacteria | 1932 |
| 189 | Ga0207696_1000035 | 3300025711 | Bacteria | 339626 |
| 190 | Ga0207696_1000090 | 3300025711 | Bacteria | 188474 |
| 191 | Ga0207696_1000176 | 3300025711 | Bacteria | 100134 |
| 192 | Ga0207696_1000177 | 3300025711 | Bacteria | 100134 |
| 193 | Ga0207696_1000348 | 3300025711 | Bacteria | 47596 |
| 194 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 195 | Ga0207655_1000137 | 3300025728 | Bacteria | 140084 |
| 196 | Ga0207655_1000171 | 3300025728 | Bacteria | 118865 |
| 197 | Ga0207655_1000628 | 3300025728 | Bacteria | 42395 |
| 198 | Ga0207655_1002225 | 3300025728 | Bacteria | 16067 |
| 199 | Ga0207655_1002878 | 3300025728 | Bacteria | 13293 |
| 200 | Ga0207655_1033103 | 3300025728 | Bacteria | 2349 |
| 201 | Ga0207655_1048410 | 3300025728 | Bacteria | 1745 |
| 202 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 203 | Ga0207713_1000716 | 3300025735 | Bacteria | 30986 |
| 204 | Ga0207713_1004703 | 3300025735 | Bacteria | 8791 |
| 205 | Ga0207713_1006091 | 3300025735 | Bacteria | 7426 |
| 206 | Ga0207713_1048709 | 3300025735 | Bacteria | 1704 |
| 207 | Ga0207682_10003822 | 3300025893 | Bacteria | 6463 |
| 208 | Ga0207647_10015111 | 3300025904 | Bacteria | 5303 |
| 209 | Ga0207647_10159390 | 3300025904 | Bacteria | 1317 |
| 210 | Ga0207645_10019998 | 3300025907 | Bacteria | 4383 |
| 211 | Ga0207705_10000545 | 3300025909 | Bacteria | 31747 |
| 212 | Ga0207695_10000625 | 3300025913 | Bacteria | 70978 |
| 213 | Ga0207671_10000261 | 3300025914 | Bacteria | 79200 |
| 214 | Ga0207671_10032044 | 3300025914 | Bacteria | 3914 |
| 215 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 216 | Ga0207649_10000207 | 3300025920 | Bacteria | 49166 |
| 217 | Ga0207681_10012408 | 3300025923 | Bacteria | 5259 |
| 218 | Ga0207650_10000145 | 3300025925 | Bacteria | 85892 |
| 219 | Ga0207650_10001015 | 3300025925 | Bacteria | 21083 |
| 220 | Ga0207650_10001027 | 3300025925 | Bacteria | 20954 |
| 221 | Ga0207659_10001133 | 3300025926 | Bacteria | 15808 |
| 222 | Ga0207644_10021910 | 3300025931 | Bacteria | 4358 |
| 223 | Ga0207690_10000072 | 3300025932 | Bacteria | 88241 |
| 224 | Ga0207706_10002953 | 3300025933 | Bacteria | 16416 |
| 225 | Ga0207686_10008721 | 3300025934 | Bacteria | 5477 |
| 226 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 227 | Ga0207709_10000138 | 3300025935 | Bacteria | 104006 |
| 228 | Ga0207669_10106232 | 3300025937 | Bacteria | 1869 |
| 229 | Ga0207691_10001104 | 3300025940 | Bacteria | 26843 |
| 230 | Ga0207679_10000045 | 3300025945 | Bacteria | 121851 |
| 231 | Ga0207667_10001276 | 3300025949 | Bacteria | 31586 |
| 232 | Ga0207651_10003576 | 3300025960 | Bacteria | 7641 |
| 233 | Ga0207668_10187802 | 3300025972 | Bacteria | 1635 |
| 234 | Ga0207639_10027034 | 3300026041 | Bacteria | 4175 |
| 235 | Ga0207678_10001622 | 3300026067 | Bacteria | 20679 |
| 236 | Ga0207683_10004624 | 3300026121 | Bacteria | 11862 |
| 237 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 238 | Ga0209371_1000084 | 3300027312 | Bacteria | 180842 |
| 239 | Ga0209371_1000127 | 3300027312 | Bacteria | 127069 |
| 240 | Ga0209371_1000186 | 3300027312 | Bacteria | 90597 |
| 241 | Ga0209371_1000190 | 3300027312 | Bacteria | 89981 |
| 242 | Ga0209371_1000258 | 3300027312 | Bacteria | 64241 |
| 243 | Ga0209371_1000457 | 3300027312 | Bacteria | 40260 |
| 244 | Ga0209371_1001415 | 3300027312 | Bacteria | 16436 |
| 245 | Ga0209371_1007034 | 3300027312 | Bacteria | 4015 |
| 246 | Ga0209371_1008131 | 3300027312 | Bacteria | 3534 |
| 247 | Ga0207428_10012907 | 3300027907 | Bacteria | 7324 |
| 248 | Ga0268266_10183440 | 3300028379 | Bacteria | 1907 |
| 249 | Ga0265338_10000437 | 3300028800 | Bacteria | 74941 |
| 250 | Ga0268256_1000069 | 3300030500 | Bacteria | 195391 |
| 251 | Ga0268256_1000075 | 3300030500 | Bacteria | 180814 |
| 252 | Ga0268256_1000104 | 3300030500 | Bacteria | 127069 |
| 253 | Ga0268256_1000215 | 3300030500 | Bacteria | 64669 |
| 254 | Ga0268256_1000439 | 3300030500 | Bacteria | 37097 |
| 255 | Ga0268256_1001212 | 3300030500 | Bacteria | 16436 |
| 256 | Ga0268256_1004606 | 3300030500 | Bacteria | 5655 |
| 257 | Ga0268256_1008907 | 3300030500 | Bacteria | 3390 |
| 258 | Ga0307511_10000406 | 3300030521 | Bacteria | 45893 |
| 259 | Ga0307408_100123246 | 3300031548 | Bacteria | 2011 |
| 260 | Ga0307405_10000073 | 3300031731 | Bacteria | 44879 |
| 261 | Ga0307405_10012594 | 3300031731 | Bacteria | 4485 |
| 262 | Ga0307412_10000008 | 3300031911 | Bacteria | 461034 |
| 263 | Ga0307416_100163487 | 3300032002 | Bacteria | 2061 |
| 264 | Ga0373924_0002525 | 3300035410 | Bacteria | 6167 |
| 265 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 266 | Ga0400484_35478 | 3300038725 | Bacteria | 1485 |
| 267 | Ga0400490_35226 | 3300038726 | Bacteria | 5129 |
| 268 | Ga0400483_099993 | 3300039062 | Bacteria | 19421 |
| 269 | Ga0400483_229956 | 3300039062 | Bacteria | 24419 |
| 270 | Ga0400487_02139 | 3300039110 | Bacteria | 2134 |
| 271 | Ga0436361_0296121 | 3300039447 | Bacteria | 160237 |
| 272 | Ga0436361_0865024 | 3300039447 | Bacteria | 19252 |
| 273 | Ga0439436_0016981 | 3300041404 | Bacteria | 2179 |
| 274 | Ga0439447_040104 | 3300041407 | Bacteria | 1144 |
| 275 | Ga0439465_0009313 | 3300041413 | Bacteria | 3094 |
| 276 | Ga0439433_0000364 | 3300041999 | Bacteria | 8025 |
| 277 | Ga0439445_0002315 | 3300042004 | Bacteria | 4226 |
| 278 | Ga0439432_004301 | 3300042006 | Bacteria | 5206 |
| 279 | Ga0439449_0006098 | 3300042007 | Bacteria | 4606 |
| 280 | Ga0439452_000015 | 3300042010 | Bacteria | 342948 |
| 281 | Ga0439452_000914 | 3300042010 | Bacteria | 13457 |
| 282 | Ga0439462_0025859 | 3300042015 | Bacteria | 1546 |
| 283 | Ga0450907_000104 | 3300042146 | Bacteria | 32519 |
| 284 | Ga0439464_0016940 | 3300042439 | Bacteria | 1973 |
| 285 | Ga0439464_0029536 | 3300042439 | Bacteria | 1532 |
| 286 | Ga0451577_0038179 | 3300042876 | Bacteria | 4319 |
| 287 | Ga0466965_0023874 | 3300044683 | Bacteria | 2955 |
| 288 | Ga0466966_0000002 | 3300044684 | Bacteria | 370962 |
| 289 | Ga0466961_0002576 | 3300044693 | Bacteria | 11238 |
| 290 | Ga0466961_0111305 | 3300044693 | Bacteria | 1722 |
| 291 | Ga0466963_0007401 | 3300044694 | Bacteria | 6542 |
| 292 | Ga0466963_0204480 | 3300044694 | Bacteria | 1381 |
| 293 | Ga0453684_0009647 | 3300044712 | Bacteria | 16822 |
| 294 | Ga0453684_0061215 | 3300044712 | Bacteria | 4834 |
| 295 | Ga0466971_0004081 | 3300044719 | Bacteria | 6286 |
| 296 | Ga0466957_0130658 | 3300044842 | Bacteria | 1608 |
| 297 | Ga0466957_0198140 | 3300044842 | Bacteria | 1318 |
| 298 | Ga0466959_0040833 | 3300045049 | Bacteria | 3426 |
| 299 | Ga0466958_0002465 | 3300045836 | Bacteria | 9300 |
| 300 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 301 | Ga0495592_0000085 | 3300046454 | Bacteria | 82502 |
| 302 | Ga0495592_0026430 | 3300046454 | Bacteria | 4401 |
| 303 | Ga0495603_0009018 | 3300046455 | Bacteria | 6034 |
| 304 | Ga0495603_0012089 | 3300046455 | Bacteria | 5226 |
| 305 | Ga0495590_0001854 | 3300046457 | Bacteria | 8939 |
| 306 | Ga0495590_0007039 | 3300046457 | Bacteria | 4359 |
| 307 | Ga0495590_0026329 | 3300046457 | Bacteria | 2042 |
| 308 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 309 | Ga0495591_009570 | 3300046458 | Bacteria | 3835 |
| 310 | Ga0495629_0000022 | 3300046459 | Bacteria | 151761 |
| 311 | Ga0495629_0001615 | 3300046459 | Bacteria | 17706 |
| 312 | Ga0495629_0003716 | 3300046459 | Bacteria | 11502 |
| 313 | Ga0495641_0013663 | 3300046461 | Bacteria | 4447 |
| 314 | Ga0495641_0031135 | 3300046461 | Bacteria | 2551 |
| 315 | Ga0495651_0123433 | 3300046462 | Bacteria | 1899 |
| 316 | Ga0495653_0001160 | 3300046463 | Bacteria | 20299 |
| 317 | Ga0495653_0007937 | 3300046463 | Bacteria | 8688 |
| 318 | Ga0495653_0009844 | 3300046463 | Bacteria | 7817 |
| 319 | Ga0495653_0077557 | 3300046463 | Bacteria | 2466 |
| 320 | Ga0495650_0000149 | 3300046471 | Bacteria | 159524 |
| 321 | Ga0495650_0001500 | 3300046471 | Bacteria | 22243 |
| 322 | Ga0495650_0007453 | 3300046471 | Bacteria | 6569 |
| 323 | Ga0495650_0020989 | 3300046471 | Bacteria | 3170 |
| 324 | Ga0495580_0000047 | 3300046472 | Bacteria | 68842 |
| 325 | Ga0495580_0001313 | 3300046472 | Bacteria | 21956 |
| 326 | Ga0495580_0003496 | 3300046472 | Bacteria | 13367 |
| 327 | Ga0495580_0070679 | 3300046472 | Bacteria | 2438 |
| 328 | Ga0495580_0189525 | 3300046472 | Bacteria | 1418 |
| 329 | Ga0495580_0189530 | 3300046472 | Bacteria | 1418 |
| 330 | Ga0495582_0076613 | 3300046473 | Bacteria | 1854 |
| 331 | Ga0495605_0000848 | 3300046474 | Bacteria | 21346 |
| 332 | Ga0495605_0001095 | 3300046474 | Bacteria | 18057 |
| 333 | Ga0495605_0001468 | 3300046474 | Bacteria | 15396 |
| 334 | Ga0495605_0015260 | 3300046474 | Bacteria | 4184 |
| 335 | Ga0495605_0042865 | 3300046474 | Bacteria | 2246 |
| 336 | Ga0495639_0000049 | 3300046475 | Bacteria | 52674 |
| 337 | Ga0495662_0011151 | 3300046476 | Bacteria | 4391 |
| 338 | Ga0495664_0000200 | 3300046477 | Bacteria | 28962 |
| 339 | Ga0495585_0025767 | 3300046492 | Bacteria | 3364 |
| 340 | Ga0495594_0002273 | 3300046499 | Bacteria | 10011 |
| 341 | Ga0495607_0000069 | 3300046501 | Bacteria | 101754 |
| 342 | Ga0495607_0001068 | 3300046501 | Bacteria | 25025 |
| 343 | Ga0495607_0022294 | 3300046501 | Bacteria | 3979 |
| 344 | Ga0495607_0085198 | 3300046501 | Bacteria | 1726 |
| 345 | Ga0495607_0100113 | 3300046501 | Bacteria | 1554 |
| 346 | Ga0495583_0004214 | 3300046506 | Bacteria | 10464 |
| 347 | Ga0495583_0016067 | 3300046506 | Bacteria | 4041 |
| 348 | Ga0495606_0000155 | 3300046507 | Bacteria | 119163 |
| 349 | Ga0495606_0001836 | 3300046507 | Bacteria | 26858 |
| 350 | Ga0495606_0114438 | 3300046507 | Bacteria | 1623 |
| 351 | Ga0495610_0001890 | 3300046512 | Bacteria | 18092 |
| 352 | Ga0495616_0111828 | 3300046513 | Bacteria | 1268 |
| 353 | Ga0495618_0128142 | 3300046514 | Bacteria | 1624 |
| 354 | Ga0495620_0000110 | 3300046515 | Bacteria | 65755 |
| 355 | Ga0495620_0013063 | 3300046515 | Bacteria | 4262 |
| 356 | Ga0495628_0009213 | 3300046516 | Bacteria | 8438 |
| 357 | Ga0495628_0018011 | 3300046516 | Bacteria | 5860 |
| 358 | Ga0495630_0002611 | 3300046517 | Bacteria | 12479 |
| 359 | Ga0495630_0014467 | 3300046517 | Bacteria | 5751 |
| 360 | Ga0495632_0017180 | 3300046519 | Bacteria | 4001 |
| 361 | Ga0495637_0003528 | 3300046520 | Bacteria | 8295 |
| 362 | Ga0495637_0004992 | 3300046520 | Bacteria | 6828 |
| 363 | Ga0495648_0003948 | 3300046524 | Bacteria | 12837 |
| 364 | Ga0495648_0007625 | 3300046524 | Bacteria | 8634 |
| 365 | Ga0495648_0046319 | 3300046524 | Bacteria | 2696 |
| 366 | Ga0495666_0026417 | 3300046526 | Bacteria | 2861 |
| 367 | Ga0495666_0043158 | 3300046526 | Bacteria | 2179 |
| 368 | Ga0495666_0079012 | 3300046526 | Bacteria | 1558 |
| 369 | Ga0495654_0060710 | 3300046530 | Bacteria | 1817 |
| 370 | Ga0495665_0035541 | 3300046531 | Bacteria | 2661 |
| 371 | Ga0495640_0034914 | 3300046533 | Bacteria | 3561 |
| 372 | Ga0495587_0007840 | 3300046536 | Bacteria | 6896 |
| 373 | Ga0495609_0049658 | 3300046538 | Bacteria | 1872 |
| 374 | Ga0495597_0000068 | 3300046542 | Bacteria | 90143 |
| 375 | Ga0495622_0000139 | 3300046557 | Bacteria | 62387 |
| 376 | Ga0495622_0000528 | 3300046557 | Bacteria | 23093 |
| 377 | Ga0495633_0000020 | 3300046558 | Bacteria | 227180 |
| 378 | Ga0495667_0101079 | 3300046559 | Bacteria | 1866 |
| 379 | Ga0495634_0026852 | 3300046642 | Bacteria | 4014 |
| 380 | Ga0495611_0076242 | 3300046648 | Bacteria | 1537 |
| 381 | Ga0495625_0017360 | 3300046660 | Bacteria | 5636 |
| 382 | Ga0495635_0031160 | 3300046663 | Bacteria | 3704 |
| 383 | Ga0495659_0000448 | 3300046664 | Bacteria | 15410 |
| 384 | Ga0495661_0000009 | 3300046665 | Bacteria | 291327 |
| 385 | Ga0495661_0000093 | 3300046665 | Bacteria | 109808 |
| 386 | Ga0495661_0000100 | 3300046665 | Bacteria | 104957 |
| 387 | Ga0495661_0001422 | 3300046665 | Bacteria | 20072 |
| 388 | Ga0495661_0012289 | 3300046665 | Bacteria | 5783 |
| 389 | Ga0495661_0013579 | 3300046665 | Bacteria | 5467 |
| 390 | Ga0495599_0003484 | 3300046678 | Bacteria | 9208 |
| 391 | Ga0495623_0038986 | 3300046679 | Bacteria | 3037 |
| 392 | Ga0495623_0245793 | 3300046679 | Bacteria | 1008 |
| 393 | Ga0495646_0049968 | 3300046680 | Bacteria | 2536 |
| 394 | Ga0495646_0055390 | 3300046680 | Bacteria | 2381 |
| 395 | Ga0495669_0070243 | 3300046684 | Bacteria | 1595 |
| 396 | Ga0495613_0005055 | 3300046689 | Bacteria | 9888 |
| 397 | Ga0495624_0001495 | 3300046690 | Bacteria | 18147 |
| 398 | Ga0495624_0010050 | 3300046690 | Bacteria | 6530 |
| 399 | Ga0495624_0055117 | 3300046690 | Bacteria | 2505 |
| 400 | Ga0495624_0144421 | 3300046690 | Bacteria | 1456 |
| 401 | Ga0495671_0042657 | 3300046692 | Bacteria | 2279 |
| 402 | Ga0495649_0000336 | 3300046694 | Bacteria | 40372 |
| 403 | Ga0495649_0002361 | 3300046694 | Bacteria | 13349 |
| 404 | Ga0495649_0087709 | 3300046694 | Bacteria | 1660 |
| 405 | Ga0495649_0136387 | 3300046694 | Bacteria | 1293 |
| 406 | Ga0495589_0002872 | 3300046794 | Bacteria | 9536 |
| 407 | Ga0495589_0005686 | 3300046794 | Bacteria | 6573 |
| 408 | Ga0495589_0006461 | 3300046794 | Bacteria | 6180 |
| 409 | Ga0495600_0013615 | 3300046809 | Bacteria | 5116 |
| 410 | Ga0495660_0000761 | 3300046810 | Bacteria | 24239 |
| 411 | Ga0495581_0019145 | 3300047315 | Bacteria | 3973 |
| 412 | Ga0495674_0000750 | 3300047319 | Bacteria | 30755 |
| 413 | Ga0495674_0008469 | 3300047319 | Bacteria | 9795 |
| 414 | Ga0495674_0026003 | 3300047319 | Bacteria | 5356 |
| 415 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 416 | Ga0495672_0000052 | 3300047320 | Bacteria | 236266 |
| 417 | Ga0495672_0031408 | 3300047320 | Bacteria | 3315 |
| 418 | Ga0495676_0000804 | 3300047321 | Bacteria | 26197 |
| 419 | Ga0495676_0055845 | 3300047321 | Bacteria | 3127 |
| 420 | Ga0495676_0059017 | 3300047321 | Bacteria | 3015 |
| 421 | Ga0495676_0140118 | 3300047321 | Bacteria | 1734 |
| 422 | Ga0495680_0005110 | 3300047322 | Bacteria | 12389 |
| 423 | Ga0495680_0053008 | 3300047322 | Bacteria | 3159 |
| 424 | Ga0495683_0000254 | 3300047323 | Bacteria | 48222 |
| 425 | Ga0495683_0001678 | 3300047323 | Bacteria | 14099 |
| 426 | Ga0495683_0003858 | 3300047323 | Bacteria | 8636 |
| 427 | Ga0495683_0018026 | 3300047323 | Bacteria | 3654 |
| 428 | Ga0495683_0102893 | 3300047323 | Bacteria | 1371 |
| 429 | Ga0495687_003713 | 3300047443 | Bacteria | 10844 |
| 430 | Ga0495687_039789 | 3300047443 | Bacteria | 2077 |
| 431 | Ga0495675_0027315 | 3300047444 | Bacteria | 3636 |
| 432 | Ga0495675_0106586 | 3300047444 | Bacteria | 1751 |
| 433 | Ga0495675_0133940 | 3300047444 | Bacteria | 1539 |
| 434 | Ga0495679_000033 | 3300047446 | Bacteria | 166523 |
| 435 | Ga0495679_001055 | 3300047446 | Bacteria | 16754 |
| 436 | Ga0495679_034159 | 3300047446 | Bacteria | 1620 |
| 437 | Ga0495673_0000972 | 3300047469 | Bacteria | 25751 |
| 438 | Ga0495673_0013456 | 3300047469 | Bacteria | 4293 |
| 439 | Ga0495681_0022553 | 3300047470 | Bacteria | 3366 |
| 440 | Ga0495684_0184129 | 3300047471 | Bacteria | 1547 |
| 441 | Ga0495686_0000080 | 3300047472 | Bacteria | 201665 |
| 442 | Ga0495686_0034170 | 3300047472 | Bacteria | 3277 |
| 443 | Ga0495593_0009310 | 3300047673 | Bacteria | 5702 |
| 444 | Ga0495593_0019388 | 3300047673 | Bacteria | 3813 |
| 445 | Ga0495593_0032560 | 3300047673 | Bacteria | 2841 |
| 446 | Ga0495593_0032665 | 3300047673 | Bacteria | 2835 |
| 447 | Ga0495602_0052023 | 3300048088 | Bacteria | 3641 |
| 448 | Ga0496100_0007475 | 3300048903 | Bacteria | 6030 |
| 449 | Ga0496100_0032485 | 3300048903 | Bacteria | 3256 |
| 450 | Ga0496100_0089522 | 3300048903 | Bacteria | 2097 |
| 451 | Ga0496101_0000365 | 3300048904 | Bacteria | 30062 |
| 452 | Ga0496101_0006013 | 3300048904 | Bacteria | 7782 |
| 453 | Ga0496101_0196727 | 3300048904 | Bacteria | 1557 |
| 454 | Ga0496102_0003703 | 3300048905 | Bacteria | 12922 |
| 455 | Ga0496102_0012212 | 3300048905 | Bacteria | 7426 |
| 456 | Ga0496102_0053540 | 3300048905 | Bacteria | 3678 |
| 457 | Ga0496102_0094026 | 3300048905 | Bacteria | 2777 |
| 458 | Ga0496103_0000509 | 3300048906 | Bacteria | 32057 |
| 459 | Ga0496104_0154070 | 3300048907 | Bacteria | 2206 |
| 460 | Ga0496105_0007423 | 3300048908 | Bacteria | 8483 |
| 461 | Ga0496105_0058288 | 3300048908 | Bacteria | 3188 |
| 462 | Ga0496106_0031483 | 3300048909 | Bacteria | 3953 |
| 463 | Ga0496106_0341149 | 3300048909 | Bacteria | 1203 |
| 464 | Ga0496112_0030464 | 3300048915 | Bacteria | 5222 |
| 465 | Ga0496113_0195220 | 3300048916 | Bacteria | 1608 |
| 466 | Ga0496115_0137368 | 3300048918 | Bacteria | 2016 |
| 467 | Ga0496116_0000237 | 3300048919 | Bacteria | 100835 |
| 468 | Ga0496116_0002504 | 3300048919 | Bacteria | 19234 |
| 469 | Ga0496116_0009238 | 3300048919 | Bacteria | 8436 |
| 470 | Ga0496116_0054330 | 3300048919 | Bacteria | 2640 |
| 471 | Ga0496117_0000073 | 3300048920 | Bacteria | 236223 |
| 472 | Ga0496117_0000294 | 3300048920 | Bacteria | 89536 |
| 473 | Ga0496117_0000359 | 3300048920 | Bacteria | 79857 |
| 474 | Ga0496117_0001052 | 3300048920 | Bacteria | 42055 |
| 475 | Ga0496117_0001351 | 3300048920 | Bacteria | 35913 |
| 476 | Ga0496117_0001750 | 3300048920 | Bacteria | 29891 |
| 477 | Ga0496117_0018487 | 3300048920 | Bacteria | 5767 |
| 478 | Ga0496117_0024383 | 3300048920 | Bacteria | 4787 |
| 479 | Ga0496117_0028205 | 3300048920 | Bacteria | 4351 |
| 480 | Ga0496117_0029299 | 3300048920 | Bacteria | 4247 |
| 481 | Ga0496117_0115293 | 3300048920 | Bacteria | 1663 |
| 482 | Ga0496118_0000449 | 3300048921 | Bacteria | 68182 |
| 483 | Ga0496118_0000508 | 3300048921 | Bacteria | 64418 |
| 484 | Ga0496118_0002694 | 3300048921 | Bacteria | 23398 |
| 485 | Ga0496118_0004769 | 3300048921 | Bacteria | 15859 |
| 486 | Ga0496118_0013377 | 3300048921 | Bacteria | 7768 |
| 487 | Ga0496118_0047406 | 3300048921 | Bacteria | 3330 |
| 488 | Ga0496118_0158919 | 3300048921 | Bacteria | 1401 |
| 489 | Ga0496119_0000400 | 3300048922 | Bacteria | 59582 |
| 490 | Ga0496119_0000523 | 3300048922 | Bacteria | 52176 |
| 491 | Ga0496119_0002263 | 3300048922 | Bacteria | 21397 |
| 492 | Ga0496119_0044806 | 3300048922 | Bacteria | 2780 |
| 493 | Ga0496120_0000524 | 3300048923 | Bacteria | 59374 |
| 494 | Ga0496120_0000728 | 3300048923 | Bacteria | 48229 |
| 495 | Ga0496120_0002026 | 3300048923 | Bacteria | 22033 |
| 496 | Ga0496120_0022124 | 3300048923 | Bacteria | 4003 |
| 497 | Ga0496121_0000626 | 3300048924 | Bacteria | 65892 |
| 498 | Ga0496121_0001053 | 3300048924 | Bacteria | 48912 |
| 499 | Ga0496121_0017234 | 3300048924 | Bacteria | 7395 |
| 500 | Ga0496121_0039538 | 3300048924 | Bacteria | 4153 |
| 501 | Ga0496121_0062041 | 3300048924 | Bacteria | 3064 |
| 502 | Ga0496121_0091262 | 3300048924 | Bacteria | 2379 |
| 503 | Ga0496122_0003103 | 3300048925 | Bacteria | 22321 |
| 504 | Ga0496122_0010612 | 3300048925 | Bacteria | 9461 |
| 505 | Ga0496122_0020704 | 3300048925 | Bacteria | 5925 |
| 506 | Ga0496122_0029999 | 3300048925 | Bacteria | 4568 |
| 507 | Ga0496123_0004591 | 3300048926 | Bacteria | 14379 |
| 508 | Ga0496123_0020411 | 3300048926 | Bacteria | 5183 |
| 509 | Ga0496123_0045540 | 3300048926 | Bacteria | 2987 |
| 510 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 511 | Ga0496124_0000309 | 3300048927 | Bacteria | 90452 |
| 512 | Ga0496124_0000600 | 3300048927 | Bacteria | 60608 |
| 513 | Ga0496124_0062338 | 3300048927 | Bacteria | 3121 |
| 514 | Ga0496124_0082211 | 3300048927 | Bacteria | 2644 |
| 515 | Ga0496124_0102660 | 3300048927 | Bacteria | 2314 |
| 516 | Ga0496124_0148430 | 3300048927 | Bacteria | 1842 |
| 517 | Ga0496125_0003909 | 3300048928 | Bacteria | 17584 |
| 518 | Ga0496125_0006719 | 3300048928 | Bacteria | 12368 |
| 519 | Ga0496126_0000098 | 3300048929 | Bacteria | 205129 |
| 520 | Ga0496126_0001174 | 3300048929 | Bacteria | 43118 |
| 521 | Ga0496126_0004745 | 3300048929 | Bacteria | 16024 |
| 522 | Ga0496126_0053113 | 3300048929 | Bacteria | 3678 |
| 523 | Ga0496126_0055817 | 3300048929 | Bacteria | 3572 |
| 524 | Ga0496126_0173714 | 3300048929 | Bacteria | 1834 |
| 525 | Ga0495678_000007 | 3300049459 | Bacteria | 448039 |
| 526 | Ga0495682_0000011 | 3300049460 | Bacteria | 278474 |
| 527 | Ga0501039_0089634 | 3300049575 | Bacteria | 2397 |
| 528 | Ga0501070_0102486 | 3300049586 | Bacteria | 2367 |
| 529 | Ga0501074_0150753 | 3300049590 | Bacteria | 1662 |
| 530 | Ga0501045_0069718 | 3300049824 | Bacteria | 2585 |
| 531 | nmdc:mga00v17_174512_c1 | 3300050491 | Bacteria | 1386 |
| 532 | nmdc:mga00v17_449_c1 | 3300050491 | Bacteria | 23134 |
| 533 | nmdc:mga00v17_83107_c1 | 3300050491 | Bacteria | 2002 |
| 534 | nmdc:mga0sz30_3595_c2 | 3300050516 | Bacteria | 4771 |
| 535 | Ga0500618_004950 | 3300053125 | Bacteria | 4133 |
| 536 | 2501410484 | 2501025504 | Bacteria | 8008976 |
| 537 | 2501072600 | 2501025501 | Bacteria | 7768574 |
| 538 | 2501083343 | 2501025502 | Bacteria | 9641094 |
| 539 | 2510251567 | 2510065045 | Bacteria | 7761063 |
| 540 | 2510281912 | 2510065053 | Bacteria | 5005518 |
| 541 | 2510291926 | 2510065055 | Bacteria | 5037935 |
| 542 | 2510310060 | 2510065058 | Bacteria | 5005894 |
| 543 | 2511087081 | 2510917013 | Bacteria | 9951648 |
| 544 | 2511097050 | 2510917014 | Bacteria | 8296963 |
| 545 | 2511103860 | 2510917015 | Bacteria | 7950052 |
| 546 | 2511381697 | 2511231025 | Bacteria | 5324661 |
| 547 | 2512345456 | 2512047030 | Bacteria | 9031815 |
| 548 | 2513552290 | 2513237082 | Bacteria | 8640282 |
| 549 | 2513561078 | 2513237083 | Bacteria | 8410967 |
| 550 | 2513960162 | 2513237151 | Bacteria | 6309801 |
| 551 | 2514048933 | 2513237166 | Bacteria | 10373764 |
| 552 | 2515680701 | 2515154122 | Bacteria | 8609520 |
| 553 | 2516019524 | 2515154189 | Bacteria | 9629850 |
| 554 | 2519458369 | 2519103095 | Bacteria | 6629912 |
| 555 | 2527075602 | 2526164713 | Bacteria | 6780608 |
| 556 | 2563058881 | 2562617112 | Bacteria | 10918404 |
| 557 | 2585292756 | 2582581311 | Bacteria | 6763856 |
| 558 | 2599397559 | 2599185167 | Bacteria | 6353609 |
| 559 | 2599452004 | 2599185179 | Bacteria | 6611171 |
| 560 | 2599500771 | 2599185188 | Bacteria | 6164180 |
| 561 | 2599513614 | 2599185190 | Bacteria | 6285678 |
| 562 | 2599517886 | 2599185191 | Bacteria | 6297582 |
| 563 | 2599612508 | 2599185212 | Bacteria | 6765997 |
| 564 | 2599738233 | 2599185239 | Bacteria | 8686614 |
| 565 | 2599742396 | 2599185240 | Bacteria | 7968121 |
| 566 | 2599880662 | 2599185288 | Bacteria | 6666191 |
| 567 | 2599892291 | 2599185290 | Bacteria | 6289611 |
| 568 | 2599926707 | 2599185299 | Bacteria | 4854625 |
| 569 | 2599932437 | 2599185300 | Bacteria | 6062622 |
| 570 | 2599952037 | 2599185303 | Bacteria | 6512725 |
| 571 | 2600022113 | 2599185316 | Bacteria | 6320029 |
| 572 | 2600028379 | 2599185317 | Bacteria | 6435722 |
| 573 | 2600040760 | 2599185319 | Bacteria | 6637840 |
| 574 | 2600059375 | 2599185322 | Bacteria | 6763055 |
| 575 | 2600063097 | 2599185323 | Bacteria | 6688755 |
| 576 | 2600075387 | 2599185325 | Bacteria | 6324919 |
| 577 | 2600204514 | 2599185355 | Bacteria | 7968906 |
| 578 | 2600357546 | 2600254930 | Bacteria | 6431253 |
| 579 | 2600812210 | 2600255067 | Bacteria | 6795583 |
| 580 | 2608670176 | 2608642108 | Bacteria | 4104624 |
| 581 | 2621300165 | 2619619299 | Bacteria | 6649820 |
| 582 | 2624493096 | 2623620446 | Bacteria | 6500345 |
| 583 | 2644059588 | 2643221609 | Bacteria | 6756331 |
| 584 | 2644074730 | 2643221611 | Bacteria | 6820941 |
| 585 | 2644284468 | 2643221650 | Bacteria | 7029547 |
| 586 | 2650895951 | 2648501693 | Bacteria | 5069560 |
| 587 | 2671126466 | 2667528176 | Bacteria | 6724917 |
| 588 | 2676741499 | 2675903129 | Bacteria | 7964495 |
| 589 | 2677901191 | 2675903420 | Bacteria | 6247433 |
| 590 | 2678265453 | 2675903515 | Bacteria | 6580491 |
| 591 | 2686356077 | 2684622997 | Bacteria | 4624240 |
| 592 | 2713480069 | 2711768613 | Bacteria | 11048459 |
| 593 | 2719640681 | 2718217991 | Bacteria | 7829542 |
| 594 | 2722884250 | 2721755523 | Bacteria | 6430384 |
| 595 | 2723877538 | 2721755763 | Bacteria | 4464185 |
| 596 | 2738675138 | 2738541265 | Bacteria | 6594665 |
| 597 | 2738753428 | 2738541282 | Bacteria | 6593925 |
| 598 | 2738806217 | 2738541294 | Bacteria | 6925949 |
| 599 | 2738818742 | 2738541296 | Bacteria | 7285013 |
| 600 | 2738831102 | 2738541298 | Bacteria | 7286732 |
| 601 | 2738862340 | 2738541303 | Bacteria | 6591772 |
| 602 | 2738872629 | 2738541306 | Bacteria | 7284992 |
| 603 | 2738893577 | 2738541309 | Bacteria | 6926455 |
| 604 | 2739184259 | 2738543002 | Bacteria | 7284546 |
| 605 | 2739219229 | 2738543008 | Bacteria | 7282815 |
| 606 | 2739241118 | 2738543012 | Bacteria | 7115078 |
| 607 | 2745005904 | 2744054620 | Bacteria | 6551379 |
| 608 | 2746089767 | 2744054900 | Bacteria | 8399525 |
| 609 | 2746094414 | 2744054901 | Bacteria | 8397047 |
| 610 | 2753567127 | 2751185846 | Bacteria | 7242164 |
| 611 | 2774129917 | 2773857672 | Bacteria | 4993178 |
| 612 | 2792836167 | 2791355137 | Bacteria | 9654227 |
| 613 | 2794597284 | 2791355520 | Bacteria | 5948615 |
| 614 | 2808959050 | 2808606382 | Bacteria | 6841132 |
| 615 | 2808980348 | 2808606385 | Bacteria | 6711065 |
| 616 | 2808996069 | 2808606388 | Bacteria | 6706662 |
| 617 | 2809125412 | 2808606414 | Bacteria | 4917181 |
| 618 | 2816471804 | 2816332133 | Bacteria | 7249298 |
| 619 | 2817260513 | 2816332253 | Bacteria | 6764532 |
| 620 | 2817278200 | 2816332256 | Bacteria | 6891714 |
| 621 | 2817452561 | 2816332286 | Bacteria | 6853759 |
| 622 | 2817491511 | 2816332298 | Bacteria | 6852809 |
| 623 | 2819624667 | 2818991450 | Bacteria | 6962147 |
| 624 | 2819633057 | 2818991452 | Bacteria | 8442785 |
| 625 | 2826582029 | 2826581358 | Bacteria | 5963467 |
| 626 | 2834033428 | 2834028612 | Bacteria | 6354979 |
| 627 | 2838055577 | 2838054893 | Bacteria | 7451788 |
| 628 | 2842328535 | 2842324504 | Bacteria | 9364110 |
| 629 | 2842352851 | 2842348783 | Bacteria | 9002918 |
| 630 | 2842458794 | 2842454564 | Bacteria | 8730687 |
| 631 | 2842819388 | 2842815866 | Bacteria | 5947510 |
| 632 | 2842852364 | 2842849001 | Bacteria | 5924277 |
| 633 | 2844529305 | 2844528606 | Bacteria | 4733806 |
| 634 | 2847798768 | 2847797336 | Bacteria | 5176640 |
| 635 | 2852613950 | 2852612431 | Bacteria | 6885235 |
| 636 | 2852668313 | 2852667396 | Bacteria | 6885555 |
| 637 | 2855732769 | 2855730933 | Bacteria | 7047938 |
| 638 | 2855771521 | 2855767633 | Bacteria | 7049357 |
| 639 | 2856294155 | 2856287931 | Bacteria | 7223934 |
| 640 | 2857367409 | 2857357740 | Bacteria | 9937880 |
| 641 | 2857546196 | 2857542790 | Bacteria | 5326616 |
| 642 | 2860344324 | 2860339153 | Bacteria | 6846989 |
| 643 | 2860870024 | 2860867994 | Bacteria | 5645326 |
| 644 | 2863422064 | 2863421361 | Bacteria | 7300805 |
| 645 | 2865017115 | 2865014394 | Bacteria | 4764573 |
| 646 | 2870071996 | 2870068957 | Bacteria | 8925310 |
| 647 | 2876603099 | 2876601092 | Bacteria | 5114497 |
| 648 | 2881415565 | 2881412998 | Bacteria | 6492157 |
| 649 | 2883093118 | 2883087390 | Bacteria | 9532701 |
| 650 | 2885194738 | 2885192300 | Bacteria | 5882526 |
| 651 | 2885275689 | 2885270888 | Bacteria | 9831543 |
| 652 | 2902683785 | 2902682994 | Bacteria | 8951596 |
| 653 | 2904437534 | 2904434214 | Bacteria | 6230908 |
| 654 | 2904484497 | 2904483920 | Bacteria | 7545285 |
| 655 | 2904566227 | 2904564687 | Bacteria | 7609577 |
| 656 | 2904573271 | 2904571731 | Bacteria | 7608790 |
| 657 | 2904617335 | 2904615490 | Bacteria | 10047340 |
| 658 | 2913039851 | 2913036834 | Bacteria | 6704877 |
| 659 | 2917832682 | 2917832318 | Bacteria | 5346010 |
| 660 | 2919125471 | 2919125081 | Bacteria | 5385106 |
| 661 | 2919484890 | 2919481497 | Bacteria | 6907839 |
| 662 | 2919502000 | 2919501602 | Bacteria | 5286340 |
| 663 | 2919531539 | 2919527303 | Bacteria | 7718827 |
| 664 | 2921654174 | 2921643360 | Bacteria | 11448031 |
| 665 | 2923588683 | 2923586266 | Bacteria | 6565975 |
| 666 | 2926063673 | 2926063275 | Bacteria | 5285848 |
| 667 | 2928110643 | 2928108538 | Bacteria | 7360024 |
| 668 | 2928120447 | 2928115317 | Bacteria | 6477646 |
| 669 | 2928140159 | 2928135762 | Bacteria | 7259641 |
| 670 | 2928159352 | 2928157003 | Bacteria | 7522202 |
| 671 | 2928164587 | 2928163908 | Bacteria | 7561269 |
| 672 | 2928177288 | 2928170801 | Bacteria | 8785406 |
| 673 | 2928538207 | 2928536128 | Bacteria | 7657547 |
| 674 | 2929161767 | 2929160207 | Bacteria | 9075316 |
| 675 | 2931375392 | 2931369376 | Bacteria | 6847892 |
| 676 | 2931393486 | 2931390751 | Bacteria | 6273349 |
| 677 | 2939604390 | 2939602548 | Bacteria | 4950493 |
| 678 | 2945933000 | 2945928738 | Bacteria | 6053221 |
| 679 | 2945937442 | 2945934425 | Bacteria | 7444609 |
| 680 | 2945952021 | 2945951305 | Bacteria | 4918162 |
| 681 | 2952255948 | 2952252522 | Bacteria | 4171745 |
| 682 | 2974300294 | 2974298342 | Bacteria | 4840922 |
| 683 | 2978978513 | 2978975091 | Bacteria | 4704313 |
| 684 | 2981993783 | 2981990288 | Bacteria | 7590678 |
| 685 | 2984497733 | 2984494565 | Bacteria | 5000175 |
| 686 | 2984502714 | 2984499530 | Bacteria | 5020881 |
| 687 | 2984508674 | 2984504281 | Bacteria | 5262371 |
| 688 | 2990261678 | 2990261002 | Bacteria | 4919493 |
| 689 | 2990705862 | 2990703756 | Bacteria | 7715990 |
| 690 | 3007320426 | 3007315729 | Bacteria | 5076637 |
| 691 | 3007422335 | 3007419365 | Bacteria | 7026924 |
| 692 | 642426786 | 641736151 | Bacteria | 7477263 |
| 693 | 642416404 | 641736154 | Bacteria | 7689995 |
| 694 | 642593285 | 642555112 | Bacteria | 8676562 |
| 695 | 646814399 | 646564506 | Bacteria | 3192235 |
| 696 | 8003955649 | 8003955200 | Bacteria | 8601927 |
| 697 | 8016729050 | 8016728285 | Bacteria | 5263933 |
| 698 | 8016734896 | 8016733728 | Bacteria | 5274317 |
| 699 | 8018850545 | 8018845410 | Bacteria | 8933938 |
| 700 | 8019501618 | 8019499862 | Bacteria | 5169538 |
| 701 | 8020812046 | 8020807995 | Bacteria | 6801506 |
| 702 | 8020944399 | 8020938398 | Bacteria | 7472757 |
| 703 | 8020947075 | 8020945358 | Bacteria | 8467355 |
| 704 | 8020960097 | 8020953355 | Bacteria | 7439080 |
| 705 | 8021122957 | 8021120328 | Bacteria | 8782274 |
| 706 | 8039104211 | 8039098773 | Bacteria | 6602928 |
| 707 | 8040169172 | 8040167225 | Bacteria | 6542727 |
| 708 | 8040177847 | 8040173305 | Bacteria | 6827067 |
| 709 | 8054287570 | 8054285046 | Bacteria | 6919322 |
| 710 | 8054506783 | 8054503363 | Bacteria | 6101651 |
| 711 | 8055269024 | 8055266321 | Bacteria | 7999742 |
| 712 | 8055301989 | 8055301274 | Bacteria | 8587385 |
| 713 | 8055821556 | 8055817908 | Bacteria | 6609162 |
| 714 | 8056135225 | 8056131705 | Bacteria | 6107031 |
| 715 | 8056165646 | 8056161164 | Bacteria | 6106669 |
| 716 | MRS2a_Contig_6865 | |||
| 717 | MRS1b_contig_1130785 | |||
| 718 | JGI24740J21852_10003531 | |||
| 719 | JGI24740J21852_10044095 | |||
| 720 | JGI24739J22299_10000111 | |||
| 721 | JGI24739J22299_10009313 | |||
| 722 | JGI24739J22299_10009453 | |||
| 723 | JGI24735J21928_10000087 | |||
| 724 | JGI24738J21930_10002901 | |||
| 725 | JGI25156J39149_1000429 | |||
| 726 | JGI25156J39149_1002844 | |||
| 727 | JGI25156J39149_1017479 | |||
| 728 | JGI25162J39368_1004043 | |||
| 729 | JGI25165J46597_1000886 | |||
| 730 | rootL2_10038977 | |||
| 731 | rootL2_10137897 | |||
| 732 | JGI25160J50197_1001438 | |||
| 733 | Ga0055533_1000253 | |||
| 734 | Ga0055533_1000303 | |||
| 735 | Ga0055533_1001847 | |||
| 736 | Ga0055532_1000001 | |||
| 737 | Ga0055532_1002855 | |||
| 738 | Ga0055527_1000002 | |||
| 739 | Ga0055527_1000564 | |||
| 740 | Ga0055527_1000600 | |||
| 741 | Ga0055535_1000001 | |||
| 742 | Ga0055535_1001424 | |||
| 743 | Ga0055535_1001498 | |||
| 744 | Ga0055542_1000001 | |||
| 745 | Ga0055542_1001400 | |||
| 746 | Ga0055529_1000001 | |||
| 747 | Ga0055529_1000418 | |||
| 748 | Ga0055530_10000016 | |||
| 749 | Ga0055540_1000048 | |||
| 750 | Ga0058692_1000510 | |||
| 751 | Ga0058692_1000633 | |||
| 752 | Ga0058692_1000833 | |||
| 753 | Ga0058692_1002146 | |||
| 754 | Ga0065165_1002944 | |||
| 755 | Ga0065714_10003520 | |||
| 756 | Ga0065714_10066603 | |||
| 757 | Ga0065704_10015303 | |||
| 758 | Ga0065712_10000124 | |||
| 759 | Ga0065712_10171664 | |||
| 760 | Ga0070658_10008756 | |||
| 761 | Ga0070658_10120180 | |||
| 762 | Ga0070676_10062871 | |||
| 763 | Ga0070670_100003668 | |||
| 764 | Ga0070670_100004735 | |||
| 765 | Ga0070670_100006345 | |||
| 766 | Ga0070677_10002183 | |||
| 767 | Ga0070660_100000028 | |||
| 768 | Ga0070661_100000025 | |||
| 769 | Ga0070661_100109132 | |||
| 770 | Ga0070668_100008307 | |||
| 771 | Ga0070669_100002340 | |||
| 772 | Ga0070669_100101741 | |||
| 773 | Ga0070675_100002569 | |||
| 774 | Ga0070671_100018623 | |||
| 775 | Ga0070674_100001349 | |||
| 776 | Ga0070659_100000152 | |||
| 777 | Ga0070667_100157580 | |||
| 778 | Ga0070694_100219837 | |||
| 779 | Ga0070663_100002650 | |||
| 780 | Ga0070678_100014570 | |||
| 781 | Ga0070662_100004610 | |||
| 782 | Ga0070662_100007483 | |||
| 783 | Ga0070685_10179210 | |||
| 784 | Ga0068853_100131074 | |||
| 785 | Ga0070672_100005395 | |||
| 786 | Ga0068855_100077059 | |||
| 787 | Ga0068855_100136676 | |||
| 788 | Ga0070664_100000019 | |||
| 789 | Ga0068851_10000170 | |||
| 790 | Ga0068851_10061925 | |||
| 791 | Ga0075364_10006083 | |||
| 792 | Ga0075364_10029261 | |||
| 793 | Ga0075432_10001128 | |||
| 794 | Ga0075366_10044050 | |||
| 795 | Ga0097621_100048533 | |||
| 796 | Ga0079104_1000004 | |||
| 797 | Ga0105251_10000164 | |||
| 798 | Ga0105251_10000870 | |||
| 799 | Ga0105251_10004080 | |||
| 800 | Ga0105251_10005616 | |||
| 801 | Ga0105251_10005977 | |||
| 802 | Ga0105251_10019299 | |||
| 803 | Ga0105251_10020137 | |||
| 804 | Ga0105251_10025501 | |||
| 805 | Ga0105251_10071664 | |||
| 806 | Ga0105244_10000327 | |||
| 807 | Ga0105244_10001910 | |||
| 808 | Ga0105244_10001938 | |||
| 809 | Ga0105244_10002043 | |||
| 810 | Ga0105244_10002430 | |||
| 811 | Ga0105244_10004588 | |||
| 812 | Ga0105244_10020953 | |||
| 813 | Ga0105250_10000337 | |||
| 814 | Ga0105250_10003445 | |||
| 815 | Ga0105250_10018785 | |||
| 816 | Ga0105243_10000067 | |||
| 817 | Ga0105243_10002650 | |||
| 818 | Ga0105242_10002802 | |||
| 819 | Ga0105242_10442567 | |||
| 820 | Ga0105248_10097045 | |||
| 821 | Ga0105248_10129630 | |||
| 822 | Ga0105237_10000093 | |||
| 823 | Ga0105237_10229880 | |||
| 824 | Ga0105238_10018266 | |||
| 825 | Ga0105246_10002024 | |||
| 826 | Ga0105246_10008857 | |||
| 827 | Ga0105246_10009427 | |||
| 828 | Ga0105246_10018354 | |||
| 829 | Ga0157373_10000739 | |||
| 830 | Ga0157373_10047786 | |||
| 831 | Ga0157373_10087852 | |||
| 832 | Ga0157373_10103295 | |||
| 833 | Ga0157373_10131437 | |||
| 834 | Ga0157371_10000780 | |||
| 835 | Ga0157371_10013564 | |||
| 836 | Ga0157371_10020225 | |||
| 837 | Ga0157370_10000053 | |||
| 838 | Ga0157370_10001977 | |||
| 839 | Ga0157370_10037342 | |||
| 840 | Ga0157370_10284624 | |||
| 841 | Ga0157370_10285909 | |||
| 842 | Ga0157369_10002960 | |||
| 843 | Ga0157369_10011611 | |||
| 844 | Ga0157369_10012325 | |||
| 845 | Ga0171462_1023 | |||
| 846 | Ga0157378_10205415 | |||
| 847 | Ga0163162_10065393 | |||
| 848 | Ga0163162_10242625 | |||
| 849 | Ga0163162_10257219 | |||
| 850 | Ga0163162_10472826 | |||
| 851 | Ga0157372_10027933 | |||
| 852 | Ga0157375_10001719 | |||
| 853 | Ga0157375_10052240 | |||
| 854 | Ga0157375_10070605 | |||
| 855 | Ga0182008_10009313 | |||
| 856 | Ga0182008_10059835 | |||
| 857 | Ga0182008_10089892 | |||
| 858 | Ga0157376_10152552 | |||
| 859 | Ga0182006_1006542 | |||
| 860 | Ga0182007_10002335 | |||
| 861 | Ga0182007_10008173 | |||
| 862 | Ga0182007_10009615 | |||
| 863 | Ga0182007_10034779 | |||
| 864 | Ga0182005_1011725 | |||
| 865 | Ga0183361_10006 | |||
| 866 | Ga0163161_10004415 | |||
| 867 | Ga0213872_10045946 | |||
| 868 | Ga0209566_100276 | |||
| 869 | Ga0209674_100005 | |||
| 870 | Ga0209674_100146 | |||
| 871 | Ga0209674_103030 | |||
| 872 | Ga0209672_100001 | |||
| 873 | Ga0209672_100019 | |||
| 874 | Ga0209672_100069 | |||
| 875 | Ga0209147_100001 | |||
| 876 | Ga0209147_100026 | |||
| 877 | Ga0209147_100044 | |||
| 878 | Ga0209147_100128 | |||
| 879 | Ga0209563_104186 | |||
| 880 | Ga0209437_100115 | |||
| 881 | Ga0209258_100001 | |||
| 882 | Ga0209258_100031 | |||
| 883 | Ga0209258_100079 | |||
| 884 | Ga0209148_1000003 | |||
| 885 | Ga0209148_1000027 | |||
| 886 | Ga0209148_1001002 | |||
| 887 | Ga0209759_1000079 | |||
| 888 | Ga0209759_1000088 | |||
| 889 | Ga0209759_1007984 | |||
| 890 | Ga0209759_1019292 | |||
| 891 | Ga0209233_1000016 | |||
| 892 | Ga0209455_1000001 | |||
| 893 | Ga0209455_1000058 | |||
| 894 | Ga0209455_1000421 | |||
| 895 | Ga0209673_1000059 | |||
| 896 | Ga0209676_1003489 | |||
| 897 | Ga0209025_1002963 | |||
| 898 | Ga0209564_1001947 | |||
| 899 | Ga0209564_1011838 | |||
| 900 | Ga0209050_1000013 | |||
| 901 | Ga0207426_1000245 | |||
| 902 | Ga0209051_1000007 | |||
| 903 | Ga0207656_10042641 | |||
| 904 | Ga0207696_1000035 | |||
| 905 | Ga0207696_1000090 | |||
| 906 | Ga0207696_1000176 | |||
| 907 | Ga0207696_1000177 | |||
| 908 | Ga0207696_1000348 | |||
| 909 | Ga0207655_1000006 | |||
| 910 | Ga0207655_1000137 | |||
| 911 | Ga0207655_1000171 | |||
| 912 | Ga0207655_1000628 | |||
| 913 | Ga0207655_1002225 | |||
| 914 | Ga0207655_1002878 | |||
| 915 | Ga0207655_1033103 | |||
| 916 | Ga0207655_1048410 | |||
| 917 | Ga0207713_1000001 | |||
| 918 | Ga0207713_1000716 | |||
| 919 | Ga0207713_1004703 | |||
| 920 | Ga0207713_1006091 | |||
| 921 | Ga0207713_1048709 | |||
| 922 | Ga0207682_10003822 | |||
| 923 | Ga0207647_10015111 | |||
| 924 | Ga0207647_10159390 | |||
| 925 | Ga0207645_10019998 | |||
| 926 | Ga0207705_10000545 | |||
| 927 | Ga0207695_10000625 | |||
| 928 | Ga0207671_10000261 | |||
| 929 | Ga0207671_10032044 | |||
| 930 | Ga0207657_10000001 | |||
| 931 | Ga0207649_10000207 | |||
| 932 | Ga0207681_10012408 | |||
| 933 | Ga0207650_10000145 | |||
| 934 | Ga0207650_10001015 | |||
| 935 | Ga0207650_10001027 | |||
| 936 | Ga0207659_10001133 | |||
| 937 | Ga0207644_10021910 | |||
| 938 | Ga0207690_10000072 | |||
| 939 | Ga0207706_10002953 | |||
| 940 | Ga0207686_10008721 | |||
| 941 | Ga0207709_10000004 | |||
| 942 | Ga0207709_10000138 | |||
| 943 | Ga0207669_10106232 | |||
| 944 | Ga0207691_10001104 | |||
| 945 | Ga0207679_10000045 | |||
| 946 | Ga0207667_10001276 | |||
| 947 | Ga0207651_10003576 | |||
| 948 | Ga0207668_10187802 | |||
| 949 | Ga0207639_10027034 | |||
| 950 | Ga0207678_10001622 | |||
| 951 | Ga0207683_10004624 | |||
| 952 | Ga0209281_1000005 | |||
| 953 | Ga0209371_1000084 | |||
| 954 | Ga0209371_1000127 | |||
| 955 | Ga0209371_1000186 | |||
| 956 | Ga0209371_1000190 | |||
| 957 | Ga0209371_1000258 | |||
| 958 | Ga0209371_1000457 | |||
| 959 | Ga0209371_1001415 | |||
| 960 | Ga0209371_1007034 | |||
| 961 | Ga0209371_1008131 | |||
| 962 | Ga0207428_10012907 | |||
| 963 | Ga0268266_10183440 | |||
| 964 | Ga0265338_10000437 | |||
| 965 | Ga0268256_1000069 | |||
| 966 | Ga0268256_1000075 | |||
| 967 | Ga0268256_1000104 | |||
| 968 | Ga0268256_1000215 | |||
| 969 | Ga0268256_1000439 | |||
| 970 | Ga0268256_1001212 | |||
| 971 | Ga0268256_1004606 | |||
| 972 | Ga0268256_1008907 | |||
| 973 | Ga0307511_10000406 | |||
| 974 | Ga0307408_100123246 | |||
| 975 | Ga0307405_10000073 | |||
| 976 | Ga0307405_10012594 | |||
| 977 | Ga0307412_10000008 | |||
| 978 | Ga0307416_100163487 | |||
| 979 | Ga0373924_0002525 | |||
| 980 | Ga0395901_0000011 | |||
| 981 | Ga0400484_35478 | |||
| 982 | Ga0400490_35226 | |||
| 983 | Ga0400483_099993 | |||
| 984 | Ga0400483_229956 | |||
| 985 | Ga0400487_02139 | |||
| 986 | Ga0436361_0296121 | |||
| 987 | Ga0436361_0865024 | |||
| 988 | Ga0439436_0016981 | |||
| 989 | Ga0439447_040104 | |||
| 990 | Ga0439465_0009313 | |||
| 991 | Ga0439433_0000364 | |||
| 992 | Ga0439445_0002315 | |||
| 993 | Ga0439432_004301 | |||
| 994 | Ga0439449_0006098 | |||
| 995 | Ga0439452_000015 | |||
| 996 | Ga0439452_000914 | |||
| 997 | Ga0439462_0025859 | |||
| 998 | Ga0450907_000104 | |||
| 999 | Ga0439464_0016940 | |||
| 1000 | Ga0439464_0029536 | |||
| 1001 | Ga0451577_0038179 | |||
| 1002 | Ga0466965_0023874 | |||
| 1003 | Ga0466966_0000002 | |||
| 1004 | Ga0466961_0002576 | |||
| 1005 | Ga0466961_0111305 | |||
| 1006 | Ga0466963_0007401 | |||
| 1007 | Ga0466963_0204480 | |||
| 1008 | Ga0453684_0009647 | |||
| 1009 | Ga0453684_0061215 | |||
| 1010 | Ga0466971_0004081 | |||
| 1011 | Ga0466957_0130658 | |||
| 1012 | Ga0466957_0198140 | |||
| 1013 | Ga0466959_0040833 | |||
| 1014 | Ga0466958_0002465 | |||
| 1015 | Ga0495627_000023 | |||
| 1016 | Ga0495592_0000085 | |||
| 1017 | Ga0495592_0026430 | |||
| 1018 | Ga0495603_0009018 | |||
| 1019 | Ga0495603_0012089 | |||
| 1020 | Ga0495590_0001854 | |||
| 1021 | Ga0495590_0007039 | |||
| 1022 | Ga0495590_0026329 | |||
| 1023 | Ga0495591_000025 | |||
| 1024 | Ga0495591_009570 | |||
| 1025 | Ga0495629_0000022 | |||
| 1026 | Ga0495629_0001615 | |||
| 1027 | Ga0495629_0003716 | |||
| 1028 | Ga0495641_0013663 | |||
| 1029 | Ga0495641_0031135 | |||
| 1030 | Ga0495651_0123433 | |||
| 1031 | Ga0495653_0001160 | |||
| 1032 | Ga0495653_0007937 | |||
| 1033 | Ga0495653_0009844 | |||
| 1034 | Ga0495653_0077557 | |||
| 1035 | Ga0495650_0000149 | |||
| 1036 | Ga0495650_0001500 | |||
| 1037 | Ga0495650_0007453 | |||
| 1038 | Ga0495650_0020989 | |||
| 1039 | Ga0495580_0000047 | |||
| 1040 | Ga0495580_0001313 | |||
| 1041 | Ga0495580_0003496 | |||
| 1042 | Ga0495580_0070679 | |||
| 1043 | Ga0495580_0189525 | |||
| 1044 | Ga0495580_0189530 | |||
| 1045 | Ga0495582_0076613 | |||
| 1046 | Ga0495605_0000848 | |||
| 1047 | Ga0495605_0001095 | |||
| 1048 | Ga0495605_0001468 | |||
| 1049 | Ga0495605_0015260 | |||
| 1050 | Ga0495605_0042865 | |||
| 1051 | Ga0495639_0000049 | |||
| 1052 | Ga0495662_0011151 | |||
| 1053 | Ga0495664_0000200 | |||
| 1054 | Ga0495585_0025767 | |||
| 1055 | Ga0495594_0002273 | |||
| 1056 | Ga0495607_0000069 | |||
| 1057 | Ga0495607_0001068 | |||
| 1058 | Ga0495607_0022294 | |||
| 1059 | Ga0495607_0085198 | |||
| 1060 | Ga0495607_0100113 | |||
| 1061 | Ga0495583_0004214 | |||
| 1062 | Ga0495583_0016067 | |||
| 1063 | Ga0495606_0000155 | |||
| 1064 | Ga0495606_0001836 | |||
| 1065 | Ga0495606_0114438 | |||
| 1066 | Ga0495610_0001890 | |||
| 1067 | Ga0495616_0111828 | |||
| 1068 | Ga0495618_0128142 | |||
| 1069 | Ga0495620_0000110 | |||
| 1070 | Ga0495620_0013063 | |||
| 1071 | Ga0495628_0009213 | |||
| 1072 | Ga0495628_0018011 | |||
| 1073 | Ga0495630_0002611 | |||
| 1074 | Ga0495630_0014467 | |||
| 1075 | Ga0495632_0017180 | |||
| 1076 | Ga0495637_0003528 | |||
| 1077 | Ga0495637_0004992 | |||
| 1078 | Ga0495648_0003948 | |||
| 1079 | Ga0495648_0007625 | |||
| 1080 | Ga0495648_0046319 | |||
| 1081 | Ga0495666_0026417 | |||
| 1082 | Ga0495666_0043158 | |||
| 1083 | Ga0495666_0079012 | |||
| 1084 | Ga0495654_0060710 | |||
| 1085 | Ga0495665_0035541 | |||
| 1086 | Ga0495640_0034914 | |||
| 1087 | Ga0495587_0007840 | |||
| 1088 | Ga0495609_0049658 | |||
| 1089 | Ga0495597_0000068 | |||
| 1090 | Ga0495622_0000139 | |||
| 1091 | Ga0495622_0000528 | |||
| 1092 | Ga0495633_0000020 | |||
| 1093 | Ga0495667_0101079 | |||
| 1094 | Ga0495634_0026852 | |||
| 1095 | Ga0495611_0076242 | |||
| 1096 | Ga0495625_0017360 | |||
| 1097 | Ga0495635_0031160 | |||
| 1098 | Ga0495659_0000448 | |||
| 1099 | Ga0495661_0000009 | |||
| 1100 | Ga0495661_0000093 | |||
| 1101 | Ga0495661_0000100 | |||
| 1102 | Ga0495661_0001422 | |||
| 1103 | Ga0495661_0012289 | |||
| 1104 | Ga0495661_0013579 | |||
| 1105 | Ga0495599_0003484 | |||
| 1106 | Ga0495623_0038986 | |||
| 1107 | Ga0495623_0245793 | |||
| 1108 | Ga0495646_0049968 | |||
| 1109 | Ga0495646_0055390 | |||
| 1110 | Ga0495669_0070243 | |||
| 1111 | Ga0495613_0005055 | |||
| 1112 | Ga0495624_0001495 | |||
| 1113 | Ga0495624_0010050 | |||
| 1114 | Ga0495624_0055117 | |||
| 1115 | Ga0495624_0144421 | |||
| 1116 | Ga0495671_0042657 | |||
| 1117 | Ga0495649_0000336 | |||
| 1118 | Ga0495649_0002361 | |||
| 1119 | Ga0495649_0087709 | |||
| 1120 | Ga0495649_0136387 | |||
| 1121 | Ga0495589_0002872 | |||
| 1122 | Ga0495589_0005686 | |||
| 1123 | Ga0495589_0006461 | |||
| 1124 | Ga0495600_0013615 | |||
| 1125 | Ga0495660_0000761 | |||
| 1126 | Ga0495581_0019145 | |||
| 1127 | Ga0495674_0000750 | |||
| 1128 | Ga0495674_0008469 | |||
| 1129 | Ga0495674_0026003 | |||
| 1130 | Ga0495672_0000001 | |||
| 1131 | Ga0495672_0000052 | |||
| 1132 | Ga0495672_0031408 | |||
| 1133 | Ga0495676_0000804 | |||
| 1134 | Ga0495676_0055845 | |||
| 1135 | Ga0495676_0059017 | |||
| 1136 | Ga0495676_0140118 | |||
| 1137 | Ga0495680_0005110 | |||
| 1138 | Ga0495680_0053008 | |||
| 1139 | Ga0495683_0000254 | |||
| 1140 | Ga0495683_0001678 | |||
| 1141 | Ga0495683_0003858 | |||
| 1142 | Ga0495683_0018026 | |||
| 1143 | Ga0495683_0102893 | |||
| 1144 | Ga0495687_003713 | |||
| 1145 | Ga0495687_039789 | |||
| 1146 | Ga0495675_0027315 | |||
| 1147 | Ga0495675_0106586 | |||
| 1148 | Ga0495675_0133940 | |||
| 1149 | Ga0495679_000033 | |||
| 1150 | Ga0495679_001055 | |||
| 1151 | Ga0495679_034159 | |||
| 1152 | Ga0495673_0000972 | |||
| 1153 | Ga0495673_0013456 | |||
| 1154 | Ga0495681_0022553 | |||
| 1155 | Ga0495684_0184129 | |||
| 1156 | Ga0495686_0000080 | |||
| 1157 | Ga0495686_0034170 | |||
| 1158 | Ga0495593_0009310 | |||
| 1159 | Ga0495593_0019388 | |||
| 1160 | Ga0495593_0032560 | |||
| 1161 | Ga0495593_0032665 | |||
| 1162 | Ga0495602_0052023 | |||
| 1163 | Ga0496100_0007475 | |||
| 1164 | Ga0496100_0032485 | |||
| 1165 | Ga0496100_0089522 | |||
| 1166 | Ga0496101_0000365 | |||
| 1167 | Ga0496101_0006013 | |||
| 1168 | Ga0496101_0196727 | |||
| 1169 | Ga0496102_0003703 | |||
| 1170 | Ga0496102_0012212 | |||
| 1171 | Ga0496102_0053540 | |||
| 1172 | Ga0496102_0094026 | |||
| 1173 | Ga0496103_0000509 | |||
| 1174 | Ga0496104_0154070 | |||
| 1175 | Ga0496105_0007423 | |||
| 1176 | Ga0496105_0058288 | |||
| 1177 | Ga0496106_0031483 | |||
| 1178 | Ga0496106_0341149 | |||
| 1179 | Ga0496112_0030464 | |||
| 1180 | Ga0496113_0195220 | |||
| 1181 | Ga0496115_0137368 | |||
| 1182 | Ga0496116_0000237 | |||
| 1183 | Ga0496116_0002504 | |||
| 1184 | Ga0496116_0009238 | |||
| 1185 | Ga0496116_0054330 | |||
| 1186 | Ga0496117_0000073 | |||
| 1187 | Ga0496117_0000294 | |||
| 1188 | Ga0496117_0000359 | |||
| 1189 | Ga0496117_0001052 | |||
| 1190 | Ga0496117_0001351 | |||
| 1191 | Ga0496117_0001750 | |||
| 1192 | Ga0496117_0018487 | |||
| 1193 | Ga0496117_0024383 | |||
| 1194 | Ga0496117_0028205 | |||
| 1195 | Ga0496117_0029299 | |||
| 1196 | Ga0496117_0115293 | |||
| 1197 | Ga0496118_0000449 | |||
| 1198 | Ga0496118_0000508 | |||
| 1199 | Ga0496118_0002694 | |||
| 1200 | Ga0496118_0004769 | |||
| 1201 | Ga0496118_0013377 | |||
| 1202 | Ga0496118_0047406 | |||
| 1203 | Ga0496118_0158919 | |||
| 1204 | Ga0496119_0000400 | |||
| 1205 | Ga0496119_0000523 | |||
| 1206 | Ga0496119_0002263 | |||
| 1207 | Ga0496119_0044806 | |||
| 1208 | Ga0496120_0000524 | |||
| 1209 | Ga0496120_0000728 | |||
| 1210 | Ga0496120_0002026 | |||
| 1211 | Ga0496120_0022124 | |||
| 1212 | Ga0496121_0000626 | |||
| 1213 | Ga0496121_0001053 | |||
| 1214 | Ga0496121_0017234 | |||
| 1215 | Ga0496121_0039538 | |||
| 1216 | Ga0496121_0062041 | |||
| 1217 | Ga0496121_0091262 | |||
| 1218 | Ga0496122_0003103 | |||
| 1219 | Ga0496122_0010612 | |||
| 1220 | Ga0496122_0020704 | |||
| 1221 | Ga0496122_0029999 | |||
| 1222 | Ga0496123_0004591 | |||
| 1223 | Ga0496123_0020411 | |||
| 1224 | Ga0496123_0045540 | |||
| 1225 | Ga0496124_0000004 | |||
| 1226 | Ga0496124_0000309 | |||
| 1227 | Ga0496124_0000600 | |||
| 1228 | Ga0496124_0062338 | |||
| 1229 | Ga0496124_0082211 | |||
| 1230 | Ga0496124_0102660 | |||
| 1231 | Ga0496124_0148430 | |||
| 1232 | Ga0496125_0003909 | |||
| 1233 | Ga0496125_0006719 | |||
| 1234 | Ga0496126_0000098 | |||
| 1235 | Ga0496126_0001174 | |||
| 1236 | Ga0496126_0004745 | |||
| 1237 | Ga0496126_0053113 | |||
| 1238 | Ga0496126_0055817 | |||
| 1239 | Ga0496126_0173714 | |||
| 1240 | Ga0495678_000007 | |||
| 1241 | Ga0495682_0000011 | |||
| 1242 | Ga0501039_0089634 | |||
| 1243 | Ga0501070_0102486 | |||
| 1244 | Ga0501074_0150753 | |||
| 1245 | Ga0501045_0069718 | |||
| 1246 | nmdc:mga00v17_174512_c1 | |||
| 1247 | nmdc:mga00v17_449_c1 | |||
| 1248 | nmdc:mga00v17_83107_c1 | |||
| 1249 | nmdc:mga0sz30_3595_c2 | |||
| 1250 | Ga0500618_004950 | |||
| 1251 | 2501410484 | |||
| 1252 | 2501072600 | |||
| 1253 | 2501083343 | |||
| 1254 | 2510251567 | |||
| 1255 | 2510281912 | |||
| 1256 | 2510291926 | |||
| 1257 | 2510310060 | |||
| 1258 | 2511087081 | |||
| 1259 | 2511097050 | |||
| 1260 | 2511103860 | |||
| 1261 | 2511381697 | |||
| 1262 | 2512345456 | |||
| 1263 | 2513552290 | |||
| 1264 | 2513561078 | |||
| 1265 | 2513960162 | |||
| 1266 | 2514048933 | |||
| 1267 | 2515680701 | |||
| 1268 | 2516019524 | |||
| 1269 | 2519458369 | |||
| 1270 | 2527075602 | |||
| 1271 | 2563058881 | |||
| 1272 | 2585292756 | |||
| 1273 | 2599397559 | |||
| 1274 | 2599452004 | |||
| 1275 | 2599500771 | |||
| 1276 | 2599513614 | |||
| 1277 | 2599517886 | |||
| 1278 | 2599612508 | |||
| 1279 | 2599738233 | |||
| 1280 | 2599742396 | |||
| 1281 | 2599880662 | |||
| 1282 | 2599892291 | |||
| 1283 | 2599926707 | |||
| 1284 | 2599932437 | |||
| 1285 | 2599952037 | |||
| 1286 | 2600022113 | |||
| 1287 | 2600028379 | |||
| 1288 | 2600040760 | |||
| 1289 | 2600059375 | |||
| 1290 | 2600063097 | |||
| 1291 | 2600075387 | |||
| 1292 | 2600204514 | |||
| 1293 | 2600357546 | |||
| 1294 | 2600812210 | |||
| 1295 | 2608670176 | |||
| 1296 | 2621300165 | |||
| 1297 | 2624493096 | |||
| 1298 | 2644059588 | |||
| 1299 | 2644074730 | |||
| 1300 | 2644284468 | |||
| 1301 | 2650895951 | |||
| 1302 | 2671126466 | |||
| 1303 | 2676741499 | |||
| 1304 | 2677901191 | |||
| 1305 | 2678265453 | |||
| 1306 | 2686356077 | |||
| 1307 | 2713480069 | |||
| 1308 | 2719640681 | |||
| 1309 | 2722884250 | |||
| 1310 | 2723877538 | |||
| 1311 | 2738675138 | |||
| 1312 | 2738753428 | |||
| 1313 | 2738806217 | |||
| 1314 | 2738818742 | |||
| 1315 | 2738831102 | |||
| 1316 | 2738862340 | |||
| 1317 | 2738872629 | |||
| 1318 | 2738893577 | |||
| 1319 | 2739184259 | |||
| 1320 | 2739219229 | |||
| 1321 | 2739241118 | |||
| 1322 | 2745005904 | |||
| 1323 | 2746089767 | |||
| 1324 | 2746094414 | |||
| 1325 | 2753567127 | |||
| 1326 | 2774129917 | |||
| 1327 | 2792836167 | |||
| 1328 | 2794597284 | |||
| 1329 | 2808959050 | |||
| 1330 | 2808980348 | |||
| 1331 | 2808996069 | |||
| 1332 | 2809125412 | |||
| 1333 | 2816471804 | |||
| 1334 | 2817260513 | |||
| 1335 | 2817278200 | |||
| 1336 | 2817452561 | |||
| 1337 | 2817491511 | |||
| 1338 | 2819624667 | |||
| 1339 | 2819633057 | |||
| 1340 | 2826582029 | |||
| 1341 | 2834033428 | |||
| 1342 | 2838055577 | |||
| 1343 | 2842328535 | |||
| 1344 | 2842352851 | |||
| 1345 | 2842458794 | |||
| 1346 | 2842819388 | |||
| 1347 | 2842852364 | |||
| 1348 | 2844529305 | |||
| 1349 | 2847798768 | |||
| 1350 | 2852613950 | |||
| 1351 | 2852668313 | |||
| 1352 | 2855732769 | |||
| 1353 | 2855771521 | |||
| 1354 | 2856294155 | |||
| 1355 | 2857367409 | |||
| 1356 | 2857546196 | |||
| 1357 | 2860344324 | |||
| 1358 | 2860870024 | |||
| 1359 | 2863422064 | |||
| 1360 | 2865017115 | |||
| 1361 | 2870071996 | |||
| 1362 | 2876603099 | |||
| 1363 | 2881415565 | |||
| 1364 | 2883093118 | |||
| 1365 | 2885194738 | |||
| 1366 | 2885275689 | |||
| 1367 | 2902683785 | |||
| 1368 | 2904437534 | |||
| 1369 | 2904484497 | |||
| 1370 | 2904566227 | |||
| 1371 | 2904573271 | |||
| 1372 | 2904617335 | |||
| 1373 | 2913039851 | |||
| 1374 | 2917832682 | |||
| 1375 | 2919125471 | |||
| 1376 | 2919484890 | |||
| 1377 | 2919502000 | |||
| 1378 | 2919531539 | |||
| 1379 | 2921654174 | |||
| 1380 | 2923588683 | |||
| 1381 | 2926063673 | |||
| 1382 | 2928110643 | |||
| 1383 | 2928120447 | |||
| 1384 | 2928140159 | |||
| 1385 | 2928159352 | |||
| 1386 | 2928164587 | |||
| 1387 | 2928177288 | |||
| 1388 | 2928538207 | |||
| 1389 | 2929161767 | |||
| 1390 | 2931375392 | |||
| 1391 | 2931393486 | |||
| 1392 | 2939604390 | |||
| 1393 | 2945933000 | |||
| 1394 | 2945937442 | |||
| 1395 | 2945952021 | |||
| 1396 | 2952255948 | |||
| 1397 | 2974300294 | |||
| 1398 | 2978978513 | |||
| 1399 | 2981993783 | |||
| 1400 | 2984497733 | |||
| 1401 | 2984502714 | |||
| 1402 | 2984508674 | |||
| 1403 | 2990261678 | |||
| 1404 | 2990705862 | |||
| 1405 | 3007320426 | |||
| 1406 | 3007422335 | |||
| 1407 | 642426786 | |||
| 1408 | 642416404 | |||
| 1409 | 642593285 | |||
| 1410 | 646814399 | |||
| 1411 | 8003955649 | |||
| 1412 | 8016729050 | |||
| 1413 | 8016734896 | |||
| 1414 | 8018850545 | |||
| 1415 | 8019501618 | |||
| 1416 | 8020812046 | |||
| 1417 | 8020944399 | |||
| 1418 | 8020947075 | |||
| 1419 | 8020960097 | |||
| 1420 | 8021122957 | |||
| 1421 | 8039104211 | |||
| 1422 | 8040169172 | |||
| 1423 | 8040177847 | |||
| 1424 | 8054287570 | |||
| 1425 | 8054506783 | |||
| 1426 | 8055269024 | |||
| 1427 | 8055301989 | |||
| 1428 | 8055821556 | |||
| 1429 | 8056135225 | |||
| 1430 | 8056165646 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r6y-assembly1.cif.gz_A | crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate | 0.8465 | 23 | 333 |
| 5t1p-assembly5.cif.gz_E | crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni | 0.8405 | 18 | 333 |
| 6j2s-assembly2.cif.gz_B | structure of hita bound to gallium from pseudomonas aeruginosa | 0.8382 | 24 | 334 |
| 7f6r-assembly1.cif.gz_A | crystal structure of metal-citrate-binding mutant (s164a) protein (mcta) of abc transporter in apo state | 0.8335 | 25 | 333 |
| 6j2s-assembly2.cif.gz_B | structure of hita bound to gallium from pseudomonas aeruginosa | 0.8332 | 24 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8938 | 26 | 290 | 3.40.190.10 |
| 1xvyA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8669 | 26 | 120 | 3.40.190.10 |
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8594 | 26 | 290 | 3.40.190.10 |
| 1q35A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8556 | 22 | 292 | 3.40.190.10 |
| 4r6yA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.855 | 23 | 299 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2W9X9-F1-model_v4 | deleted | 0.951 | 1 | 334 |
|
| AF-A0A2W5PPI8-F1-model_v4 | ABC transporter substrate-binding protein | 0.9488 | 110 | 334 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |
| AF-A0A0K2W9X9-F1-model_v4 | deleted | 0.9455 | 1 | 334 |
|
| AF-A0A7J3XZ67-F1-model_v4 | Extracellular solute-binding protein | 0.9431 | 23 | 333 |
GO:0015888
GO:0030975 GO:0030976 |
| AF-A0A2W5PPI8-F1-model_v4 | ABC transporter substrate-binding protein | 0.94 | 110 | 334 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |