F477072

General Info

Members Datasets Scaffolds Average Seq Length
716 491 570 230

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0225759|Ga0495625_0225759_150_881
Length 243
Sequence MAGIDAGAAMSANPFSLWVYLSQTPLLWLTVTLVVYALADAVSLATHRHPLANPVLHSMWLIGLFLYLTATPYGVYFGGAQFVHFLLGPATVALAVPLYENRKIVFRALVPMLVALVAGSVTAIASVVLLARAFGLALAPKSVTAGVAMGISETLGADPALTAVAVILTGIMGAIVVTPMMNRMGITDFRARGFAAGLASHGIGTARAFQVDEVAGVFAGIAMSLNALVTSLLVPLAVTVLLR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
16 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
17 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
18 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
19 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
20 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2643221618 Ensifer sp. Root231 Isolate Unclassified
23 2643221626 Ensifer sp. Root31 Isolate Unclassified
24 2643221651 Afipia sp. Root123D2 Isolate Unclassified
25 2643221655 Ensifer sp. Root1252 Isolate Unclassified
26 2643221659 Ensifer sp. Root127 Isolate Unclassified
27 2643221698 Ensifer sp. Root142 Isolate Unclassified
28 2643221712 Ensifer sp. Root258 Isolate Unclassified
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
31 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
34 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
35 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
36 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
51 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
52 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
53 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
54 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
55 2844163670 Ensifer sp. 1H6 Isolate Unclassified
56 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
64 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
65 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
66 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
67 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
68 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
69 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
70 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
71 2902330777 Methylobacterium sp. 2A Isolate Unclassified
72 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
73 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
74 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
75 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
76 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
77 2904699407
78 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
79 2906610324
80 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
81 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
82 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
83 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
84 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
85 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
86 2922425934
87 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
88 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
89 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
90 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
91 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
92 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
93 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
94 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
95 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
96 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
97 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
98 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
99 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
100 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
101 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
102 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
103 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
104 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
105 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
106 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
107 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
108 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
109 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
110 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
111 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
112 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
113 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
114 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
115 2996893221 Rhizobium sp. R635 Isolate Nodule
116 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
117 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
118 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
119 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
120 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
121 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
122 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
123 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
124 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
125 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
126 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
127 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
128 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
129 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
130 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
133 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
134 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
135 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
136 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
137 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
138 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
139 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
140 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
141 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
142 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
143 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
144 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
145 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
146 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
147 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
148 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
149 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
150 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
151 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
152 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
153 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
154 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
155 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
156 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
157 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
158 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
159 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
160 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
161 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
162 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
163 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
164 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
165 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
166 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
167 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
168 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
169 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
170 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
171 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
172 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
173 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
174 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
175 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
176 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
177 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
178 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
179 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
180 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
181 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
182 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
183 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
184 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
185 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
186 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
187 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
188 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
189 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
190 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
191 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
192 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
195 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
196 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
197 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
198 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
199 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
200 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
201 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
202 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
203 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
204 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
205 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
206 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
207 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
208 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
209 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
210 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
211 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
212 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
213 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
214 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
215 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
216 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
217 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
218 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
219 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
220 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
221 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
222 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
223 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
224 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
225 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
226 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
227 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
228 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
229 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
230 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
231 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
232 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
233 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
237 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
301 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
302 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
303 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
304 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
305 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
308 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
309 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
310 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
311 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
312 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
313 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
314 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
315 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
316 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
317 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
318 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
319 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
320 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
321 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
323 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
324 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
325 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
326 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
327 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
333 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
334 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
335 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
353 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
354 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
355 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
369 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
372 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
379 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
395 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
449 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
454 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
455 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
456 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
457 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
458 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
459 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
460 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
461 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
462 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
463 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
464 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
467 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
468 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
469 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
470 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
471 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
472 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
473 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
474 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
475 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
476 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
477 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
478 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
479 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
480 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
481 641522639 Methylobacterium sp. 4-46 Isolate Nodule
482 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
483 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
484 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
485 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
486 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
487 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
488 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
489 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
490 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
491 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.94
Metatranscriptomes 0
Isolates 20.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.31
Nodule 13.13
Rhizoplane 8.38
Rhizosphere 54.75
Stem 0
Stem Tuber 0
Unclassified 12.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10003527 3300001991 Bacteria 2483
2 JGI24750J21931_1000926 3300002070 Bacteria 3924
3 JGI24744J21845_10000165 3300002077 Bacteria 9805
4 JGI25165J46597_1009366 3300003214 Bacteria 1478
5 JGI25153J46596_10001308 3300003215 Bacteria 14903
6 JGI25153J46596_10002547 3300003215 Bacteria 10449
7 JGI25153J46596_10003542 3300003215 Bacteria 8707
8 JGI25153J46596_10031294 3300003215 Bacteria 1794
9 JGI25160J50197_1001680 3300003354 Bacteria 10780
10 JGI25160J50197_1003442 3300003354 Bacteria 7079
11 JGI25160J50197_1005384 3300003354 Bacteria 5338
12 Ga0055531_10007525 3300003794 Bacteria 5917
13 Ga0055543_1007516 3300004625 Bacteria 2506
14 Ga0065165_1000370 3300005262 Bacteria 73604
15 Ga0065165_1008717 3300005262 Bacteria 4687
16 Ga0065165_1012184 3300005262 Bacteria 3520
17 Ga0070658_10021405 3300005327 Bacteria 5182
18 Ga0070658_10226254 3300005327 Bacteria 1583
19 Ga0070676_10101803 3300005328 Bacteria 1776
20 Ga0070683_100135003 3300005329 Bacteria 2336
21 Ga0070690_100004755 3300005330 Bacteria 7578
22 Ga0070670_100008567 3300005331 Bacteria 8726
23 Ga0070677_10180098 3300005333 Bacteria 1006
24 Ga0068869_100028404 3300005334 Bacteria 3908
25 Ga0070666_10049837 3300005335 Bacteria 2816
26 Ga0070682_100110140 3300005337 Bacteria 1834
27 Ga0070682_100734482 3300005337 Bacteria 795
28 Ga0068868_100064683 3300005338 Bacteria 2904
29 Ga0070660_100174060 3300005339 Bacteria 1740
30 Ga0070689_100025542 3300005340 Bacteria 4439
31 Ga0070689_100286403 3300005340 Bacteria 1368
32 Ga0070691_10179934 3300005341 Bacteria 1100
33 Ga0070668_100027658 3300005347 Bacteria 4306
34 Ga0070668_100099603 3300005347 Bacteria 2301
35 Ga0070668_100209875 3300005347 Bacteria 1601
36 Ga0070669_100081406 3300005353 Bacteria 2412
37 Ga0070675_100045440 3300005354 Bacteria 3593
38 Ga0070671_100029320 3300005355 Bacteria 4537
39 Ga0070671_100032245 3300005355 Bacteria 4332
40 Ga0070674_100043548 3300005356 Bacteria 3054
41 Ga0070673_100696505 3300005364 Bacteria 933
42 Ga0070688_100018986 3300005365 Bacteria 3977
43 Ga0070659_100066592 3300005366 Bacteria 2854
44 Ga0070667_100046765 3300005367 Bacteria 3641
45 Ga0070667_100238893 3300005367 Bacteria 1622
46 Ga0070667_100272519 3300005367 Bacteria 1518
47 Ga0070709_10001375 3300005434 Bacteria 13254
48 Ga0070714_100083302 3300005435 Bacteria 2788
49 Ga0070713_100032505 3300005436 Bacteria 4168
50 Ga0070713_100406852 3300005436 Bacteria 1272
51 Ga0070710_10021417 3300005437 Bacteria 3369
52 Ga0070710_10032712 3300005437 Bacteria 2819
53 Ga0070711_100002720 3300005439 Bacteria 10143
54 Ga0070711_100087251 3300005439 Bacteria 2239
55 Ga0070700_100006014 3300005441 Bacteria 6456
56 Ga0070694_100074711 3300005444 Bacteria 2343
57 Ga0070708_100561638 3300005445 Bacteria 1076
58 Ga0070663_100121239 3300005455 Bacteria 1975
59 Ga0070663_100125401 3300005455 Bacteria 1944
60 Ga0070663_100478155 3300005455 Bacteria 1031
61 Ga0068867_100119256 3300005459 Bacteria 2037
62 Ga0070685_10010088 3300005466 Bacteria 4901
63 Ga0070707_100170276 3300005468 Bacteria 2122
64 Ga0070684_100139066 3300005535 Bacteria 2195
65 Ga0070697_100050464 3300005536 Bacteria 3377
66 Ga0070697_100171037 3300005536 Bacteria 1839
67 Ga0068853_100042589 3300005539 Bacteria 3883
68 Ga0068853_100112148 3300005539 Bacteria 2424
69 Ga0070672_100002676 3300005543 Bacteria 11388
70 Ga0070686_100031603 3300005544 Bacteria 3238
71 Ga0070696_100045475 3300005546 Bacteria 3042
72 Ga0070665_100040108 3300005548 Bacteria 4707
73 Ga0070665_100045145 3300005548 Bacteria 4425
74 Ga0070665_100084358 3300005548 Bacteria 3182
75 Ga0068855_100452592 3300005563 Bacteria 1401
76 Ga0070664_100003633 3300005564 Bacteria 12423
77 Ga0068857_100292677 3300005577 Bacteria 1500
78 Ga0068854_100010172 3300005578 Bacteria 6095
79 Ga0068854_100461363 3300005578 Bacteria 1063
80 Ga0068856_100177572 3300005614 Bacteria 2142
81 Ga0068856_100364837 3300005614 Bacteria 1463
82 Ga0070702_100589668 3300005615 Bacteria 831
83 Ga0068852_100011009 3300005616 Bacteria 6786
84 Ga0068852_100185761 3300005616 Bacteria 1958
85 Ga0068852_100240589 3300005616 Bacteria 1729
86 Ga0068859_100359204 3300005617 Bacteria 1552
87 Ga0068864_100008924 3300005618 Bacteria 8263
88 Ga0068864_100162154 3300005618 Bacteria 2033
89 Ga0068866_10108429 3300005718 Bacteria 1545
90 Ga0068861_100081663 3300005719 Bacteria 2531
91 Ga0068861_100162437 3300005719 Bacteria 1844
92 Ga0068851_10129018 3300005834 Bacteria 1366
93 Ga0068870_10077738 3300005840 Bacteria 1826
94 Ga0068863_100524593 3300005841 Bacteria 1168
95 Ga0068863_100913919 3300005841 Bacteria 878
96 Ga0068858_100217242 3300005842 Bacteria 1810
97 Ga0068858_100909184 3300005842 Bacteria 861
98 Ga0068860_100084953 3300005843 Bacteria 3010
99 Ga0068860_100198345 3300005843 Bacteria 1944
100 Ga0068862_100101439 3300005844 Bacteria 2518
101 Ga0068862_100742717 3300005844 Bacteria 954
102 Ga0075365_10238945 3300006038 Bacteria 1276
103 Ga0075368_10113012 3300006042 Bacteria 1120
104 Ga0075363_100265134 3300006048 Bacteria 991
105 Ga0075364_10132972 3300006051 Bacteria 1670
106 Ga0070715_10001698 3300006163 Bacteria 6540
107 Ga0070715_10067122 3300006163 Bacteria 1592
108 Ga0070716_100005769 3300006173 Bacteria 6014
109 Ga0070716_100036674 3300006173 Bacteria 2704
110 Ga0070712_100070198 3300006175 Bacteria 2502
111 Ga0070712_100469162 3300006175 Bacteria 1051
112 Ga0075362_10058211 3300006177 Bacteria 1742
113 Ga0075367_10041348 3300006178 Bacteria 2694
114 Ga0075369_10038354 3300006186 Bacteria 2043
115 Ga0075366_10008044 3300006195 Bacteria 5844
116 Ga0075366_10025744 3300006195 Bacteria 3441
117 Ga0097621_100012720 3300006237 Bacteria 6251
118 Ga0075370_10028282 3300006353 Bacteria 3115
119 Ga0068871_100023661 3300006358 Bacteria 4755
120 Ga0075434_100046483 3300006871 Bacteria 4307
121 Ga0068865_100004145 3300006881 Bacteria 8715
122 Ga0097620_100359228 3300006931 Bacteria 1552
123 Ga0099824_1002047 3300006942 Bacteria 29222
124 Ga0099824_1018951 3300006942 Bacteria 5500
125 Ga0099822_1004737 3300006943 Bacteria 17740
126 Ga0099794_10010337 3300007265 Bacteria 3959
127 Ga0105244_10092099 3300009036 Bacteria 1490
128 Ga0105240_10071393 3300009093 Bacteria 4295
129 Ga0105240_10126225 3300009093 Bacteria 3074
130 Ga0105240_10589561 3300009093 Bacteria 1225
131 Ga0111539_10138127 3300009094 Bacteria 2854
132 Ga0111539_10341581 3300009094 Bacteria 1743
133 Ga0105245_10003624 3300009098 Bacteria 13786
134 Ga0105247_10060123 3300009101 Bacteria 2354
135 Ga0105247_10121513 3300009101 Bacteria 1692
136 Ga0114129_10033500 3300009147 Bacteria 7261
137 Ga0105241_10083696 3300009174 Bacteria 2503
138 Ga0105242_10205664 3300009176 Bacteria 1751
139 Ga0105248_10051723 3300009177 Bacteria 4609
140 Ga0105248_10144863 3300009177 Bacteria 2681
141 Ga0105237_10026831 3300009545 Bacteria 5887
142 Ga0105237_10100206 3300009545 Bacteria 2888
143 Ga0105237_10772377 3300009545 Bacteria 968
144 Ga0105249_10106531 3300009553 Bacteria 2645
145 Ga0105249_10204875 3300009553 Bacteria 1932
146 Ga0105249_10406203 3300009553 Bacteria 1393
147 Ga0105239_10135986 3300010375 Bacteria 2736
148 Ga0105246_10032958 3300011119 Bacteria 3439
149 Ga0105246_10047093 3300011119 Bacteria 2943
150 Ga0157374_10192459 3300013296 Bacteria 1995
151 Ga0157374_10364885 3300013296 Bacteria 1437
152 Ga0157378_10083406 3300013297 Bacteria 2892
153 Ga0157378_10389292 3300013297 Bacteria 1371
154 Ga0163162_10062435 3300013306 Bacteria 3766
155 Ga0163162_10071107 3300013306 Bacteria 3532
156 Ga0163162_10205407 3300013306 Bacteria 2099
157 Ga0163162_10207504 3300013306 Bacteria 2088
158 Ga0157375_10118303 3300013308 Bacteria 2756
159 Ga0163163_10002774 3300014325 Bacteria 14789
160 Ga0163163_10043948 3300014325 Bacteria 4382
161 Ga0157377_10138168 3300014745 Bacteria 1495
162 Ga0157379_10049160 3300014968 Bacteria 3765
163 Ga0157379_10407601 3300014968 Bacteria 1250
164 Ga0214544_1000030 3300021320 Bacteria 153107
165 Ga0214544_1001366 3300021320 Bacteria 50322
166 Ga0214542_1000026 3300021321 Bacteria 182145
167 Ga0214542_1001752 3300021321 Bacteria 44870
168 Ga0214545_1000015 3300021324 Bacteria 182143
169 Ga0214545_1000519 3300021324 Bacteria 61850
170 Ga0214543_1000036 3300021327 Bacteria 182143
171 Ga0214543_1002074 3300021327 Bacteria 39370
172 Ga0209563_100438 3300025230 Bacteria 14431
173 Ga0209677_105312 3300025253 Bacteria 3398
174 Ga0209233_1006433 3300025261 Bacteria 3787
175 Ga0209233_1007514 3300025261 Bacteria 3448
176 Ga0209673_1013733 3300025273 Bacteria 3180
177 Ga0209564_1010432 3300025295 Bacteria 4282
178 Ga0209564_1013885 3300025295 Bacteria 3387
179 Ga0209758_1000030 3300025297 Bacteria 509217
180 Ga0209758_1000711 3300025297 Bacteria 49164
181 Ga0209758_1000801 3300025297 Bacteria 44590
182 Ga0209758_1000893 3300025297 Bacteria 40627
183 Ga0209758_1001645 3300025297 Bacteria 25366
184 Ga0209758_1002462 3300025297 Bacteria 18855
185 Ga0209256_1002674 3300025299 Bacteria 13977
186 Ga0209256_1062115 3300025299 Bacteria 866
187 Ga0207426_1000271 3300025302 Bacteria 108392
188 Ga0207426_1008000 3300025302 Bacteria 4342
189 Ga0209257_1000662 3300025304 Bacteria 54143
190 Ga0207656_10066768 3300025321 Bacteria 1591
191 Ga0207692_10003134 3300025898 Bacteria 6415
192 Ga0207692_10156810 3300025898 Bacteria 1309
193 Ga0207642_10005329 3300025899 Bacteria 4189
194 Ga0207642_10084055 3300025899 Bacteria 1554
195 Ga0207710_10093623 3300025900 Bacteria 1410
196 Ga0207710_10156409 3300025900 Bacteria 1108
197 Ga0207688_10000210 3300025901 Bacteria 26010
198 Ga0207688_10040030 3300025901 Bacteria 2604
199 Ga0207647_10008109 3300025904 Bacteria 7549
200 Ga0207647_10016728 3300025904 Bacteria 4998
201 Ga0207685_10010493 3300025905 Bacteria 2739
202 Ga0207699_10003346 3300025906 Bacteria 7643
203 Ga0207645_10004480 3300025907 Bacteria 10332
204 Ga0207643_10000142 3300025908 Bacteria 48907
205 Ga0207705_10128946 3300025909 Bacteria 1881
206 Ga0207705_10369888 3300025909 Bacteria 1106
207 Ga0207695_10018587 3300025913 Bacteria 8030
208 Ga0207695_10236341 3300025913 Bacteria 1730
209 Ga0207671_10107617 3300025914 Bacteria 2118
210 Ga0207693_10002151 3300025915 Bacteria 17197
211 Ga0207693_10042766 3300025915 Bacteria 3566
212 Ga0207693_10159731 3300025915 Bacteria 1773
213 Ga0207693_10491291 3300025915 Bacteria 958
214 Ga0207663_10001035 3300025916 Bacteria 12747
215 Ga0207663_10435076 3300025916 Bacteria 1009
216 Ga0207662_10032599 3300025918 Bacteria 3034
217 Ga0207657_10046650 3300025919 Bacteria 3794
218 Ga0207657_10125678 3300025919 Bacteria 2106
219 Ga0207649_10013542 3300025920 Bacteria 4553
220 Ga0207652_10479839 3300025921 Bacteria 1120
221 Ga0207646_10046025 3300025922 Bacteria 3916
222 Ga0207681_10062623 3300025923 Bacteria 2562
223 Ga0207650_10002372 3300025925 Bacteria 13103
224 Ga0207650_10017521 3300025925 Bacteria 5018
225 Ga0207659_10070440 3300025926 Bacteria 2550
226 Ga0207687_10540199 3300025927 Bacteria 977
227 Ga0207700_10087229 3300025928 Bacteria 2454
228 Ga0207700_10130759 3300025928 Bacteria 2049
229 Ga0207700_10321432 3300025928 Bacteria 1341
230 Ga0207664_10003571 3300025929 Bacteria 10392
231 Ga0207644_10018254 3300025931 Bacteria 4744
232 Ga0207644_10153755 3300025931 Bacteria 1782
233 Ga0207690_10079489 3300025932 Bacteria 2285
234 Ga0207706_10170076 3300025933 Bacteria 1915
235 Ga0207686_10463152 3300025934 Bacteria 977
236 Ga0207709_10005119 3300025935 Bacteria 7483
237 Ga0207670_10026050 3300025936 Bacteria 3681
238 Ga0207669_10019691 3300025937 Bacteria 3521
239 Ga0207704_10002563 3300025938 Bacteria 8196
240 Ga0207665_10003044 3300025939 Bacteria 11252
241 Ga0207665_10040353 3300025939 Bacteria 3114
242 Ga0207665_10210597 3300025939 Bacteria 1420
243 Ga0207665_10243449 3300025939 Bacteria 1326
244 Ga0207691_10001552 3300025940 Bacteria 22799
245 Ga0207711_10388580 3300025941 Bacteria 1295
246 Ga0207711_10549480 3300025941 Bacteria 1077
247 Ga0207689_10001664 3300025942 Bacteria 21088
248 Ga0207661_10073459 3300025944 Bacteria 2801
249 Ga0207679_10054346 3300025945 Bacteria 2947
250 Ga0207667_10605322 3300025949 Bacteria 1105
251 Ga0207651_10787236 3300025960 Bacteria 842
252 Ga0207712_10067571 3300025961 Bacteria 2559
253 Ga0207712_10794891 3300025961 Bacteria 831
254 Ga0207668_10183590 3300025972 Bacteria 1652
255 Ga0207658_10250106 3300025986 Bacteria 1506
256 Ga0207703_10005307 3300026035 Bacteria 10385
257 Ga0207703_10181953 3300026035 Bacteria 1855
258 Ga0207703_10931557 3300026035 Bacteria 832
259 Ga0207639_10160589 3300026041 Bacteria 1893
260 Ga0207639_10708770 3300026041 Bacteria 934
261 Ga0207678_10023768 3300026067 Bacteria 5359
262 Ga0207678_10040824 3300026067 Bacteria 4022
263 Ga0207678_10237441 3300026067 Bacteria 1561
264 Ga0207708_10011317 3300026075 Bacteria 6643
265 Ga0207702_10013844 3300026078 Bacteria 6700
266 Ga0207641_10002866 3300026088 Bacteria 15667
267 Ga0207641_10273095 3300026088 Bacteria 1587
268 Ga0207648_10002204 3300026089 Bacteria 21153
269 Ga0207676_10002677 3300026095 Bacteria 12661
270 Ga0207676_10520631 3300026095 Bacteria 1132
271 Ga0207674_10057340 3300026116 Bacteria 3948
272 Ga0207674_10314174 3300026116 Bacteria 1516
273 Ga0207675_100000323 3300026118 Bacteria 45494
274 Ga0207683_10003902 3300026121 Bacteria 12922
275 Ga0207683_10373030 3300026121 Bacteria 1311
276 Ga0207698_10006113 3300026142 Bacteria 7493
277 Ga0207698_10087346 3300026142 Bacteria 2539
278 Ga0207698_10785239 3300026142 Bacteria 953
279 Ga0209389_1000055 3300027296 Bacteria 108798
280 Ga0209589_1000005 3300027357 Bacteria 530958
281 Ga0209589_1000024 3300027357 Bacteria 169886
282 Ga0209489_100005 3300027361 Bacteria 530958
283 Ga0209489_100123 3300027361 Bacteria 113105
284 Ga0209700_100006 3300027363 Bacteria 530958
285 Ga0209813_10024296 3300027866 Bacteria 1732
286 Ga0209813_10024464 3300027866 Bacteria 1727
287 Ga0268265_10376455 3300028380 Bacteria 1304
288 Ga0268264_10065025 3300028381 Bacteria 3071
289 Ga0268264_10224515 3300028381 Bacteria 1731
290 Ga0265337_1006988 3300028556 Bacteria 4274
291 Ga0265319_1048560 3300028563 Bacteria 1408
292 Ga0265318_10028598 3300028577 Bacteria 2179
293 Ga0265323_10000560 3300028653 Bacteria 20568
294 Ga0265322_10013558 3300028654 Bacteria 2360
295 Ga0265336_10000550 3300028666 Bacteria 21394
296 Ga0265338_10000231 3300028800 Bacteria 103805
297 Ga0265314_10051359 3300031711 Bacteria 2872
298 Ga0265342_10003396 3300031712 Bacteria 13107
299 Ga0307406_10438749 3300031901 Bacteria 1045
300 Ga0307510_10108546 3300033180 Bacteria 2528
301 Ga0307510_10119002 3300033180 Bacteria 2353
302 Ga0307510_10121417 3300033180 Bacteria 2316
303 Ga0315911_1000005 3300033442 Bacteria 426255
304 Ga0373926_0004957 3300035083 Bacteria 4373
305 Ga0373944_0003369 3300035089 Bacteria 4119
306 Ga0373923_0137980 3300035111 Bacteria 1100
307 Ga0373945_0020207 3300035116 Bacteria 2277
308 Ga0373943_0006773 3300035170 Bacteria 5143
309 Ga0373946_0003782 3300035171 Bacteria 5369
310 Ga0373955_0088679 3300035172 Bacteria 1760
311 Ga0373931_0232386 3300035691 Bacteria 1115
312 Ga0373927_0127668 3300035695 Bacteria 1661
313 Ga0373933_0287642 3300035724 Bacteria 1063
314 Ga0373937_0069895 3300036401 Bacteria 3238
315 Ga0373937_0240286 3300036401 Bacteria 1706
316 Ga0373925_0038880 3300037068 Bacteria 3519
317 Ga0395899_0092194 3300037312 Bacteria 2194
318 Ga0395898_0420009 3300037466 Bacteria 1274
319 Ga0436360_0963720 3300039438 Bacteria 857
320 Ga0436361_0617095 3300039447 Bacteria 3164
321 Ga0451800_0183093 3300041459 Bacteria 882
322 Ga0466968_0022068 3300044735 Bacteria 2584
323 Ga0466968_0321553 3300044735 Bacteria 747
324 Ga0466957_0440237 3300044842 Bacteria 897
325 Ga0495592_0041982 3300046454 Bacteria 3426
326 Ga0495603_0101268 3300046455 Bacteria 1681
327 Ga0495591_049249 3300046458 Bacteria 1159
328 Ga0495629_0003519 3300046459 Bacteria 11838
329 Ga0495629_0058978 3300046459 Bacteria 2683
330 Ga0495629_0305227 3300046459 Bacteria 1090
331 Ga0495638_0011267 3300046460 Bacteria 6167
332 Ga0495651_0004449 3300046462 Bacteria 10735
333 Ga0495651_0017692 3300046462 Bacteria 5518
334 Ga0495651_0029243 3300046462 Bacteria 4297
335 Ga0495651_0077253 3300046462 Bacteria 2521
336 Ga0495653_0131375 3300046463 Bacteria 1772
337 Ga0495653_0287713 3300046463 Bacteria 1076
338 Ga0495650_0048658 3300046471 Bacteria 1765
339 Ga0495605_0171754 3300046474 Bacteria 957
340 Ga0495639_0014122 3300046475 Bacteria 3455
341 Ga0495662_0025954 3300046476 Bacteria 2830
342 Ga0495664_0011915 3300046477 Bacteria 4914
343 Ga0495584_0022986 3300046491 Bacteria 3163
344 Ga0495584_0186578 3300046491 Bacteria 1054
345 Ga0495594_0051286 3300046499 Bacteria 2270
346 Ga0495583_0158671 3300046506 Bacteria 934
347 Ga0495606_0251381 3300046507 Bacteria 980
348 Ga0495608_0009906 3300046511 Bacteria 6653
349 Ga0495620_0051491 3300046515 Bacteria 1752
350 Ga0495628_0159724 3300046516 Bacteria 1713
351 Ga0495631_0141581 3300046518 Bacteria 1033
352 Ga0495643_0045119 3300046522 Bacteria 2393
353 Ga0495643_0119948 3300046522 Bacteria 1330
354 Ga0495648_0005796 3300046524 Bacteria 10186
355 Ga0495648_0006342 3300046524 Bacteria 9673
356 Ga0495648_0008955 3300046524 Bacteria 7820
357 Ga0495648_0130312 3300046524 Bacteria 1338
358 Ga0495648_0180898 3300046524 Bacteria 1072
359 Ga0495652_0005458 3300046529 Bacteria 11981
360 Ga0495652_0089837 3300046529 Bacteria 2514
361 Ga0495640_0024790 3300046533 Bacteria 4359
362 Ga0495587_0008038 3300046536 Bacteria 6810
363 Ga0495597_0110098 3300046542 Bacteria 1155
364 Ga0495645_0397472 3300046543 Bacteria 879
365 Ga0495622_0016125 3300046557 Bacteria 3478
366 Ga0495633_0104325 3300046558 Bacteria 1315
367 Ga0495667_0005992 3300046559 Bacteria 8219
368 Ga0495656_0116660 3300046615 Bacteria 1255
369 Ga0495656_0150005 3300046615 Bacteria 1125
370 Ga0495668_0084179 3300046616 Bacteria 1744
371 Ga0495668_0187246 3300046616 Bacteria 1134
372 Ga0495634_0056964 3300046642 Bacteria 2610
373 Ga0495634_0095921 3300046642 Bacteria 1921
374 Ga0495611_0054223 3300046648 Bacteria 1812
375 Ga0495625_0225759 3300046660 Bacteria 1225
376 Ga0495661_0078682 3300046665 Bacteria 1907
377 Ga0495661_0171062 3300046665 Bacteria 1159
378 Ga0495588_0092409 3300046674 Bacteria 1585
379 Ga0495657_0002384 3300046675 Bacteria 15809
380 Ga0495657_0014532 3300046675 Bacteria 5776
381 Ga0495599_0004607 3300046678 Bacteria 8178
382 Ga0495623_0010248 3300046679 Bacteria 6064
383 Ga0495623_0078167 3300046679 Bacteria 2051
384 Ga0495646_0171954 3300046680 Bacteria 1193
385 Ga0495646_0212958 3300046680 Bacteria 1048
386 Ga0495647_0004011 3300046681 Bacteria 4750
387 Ga0495658_0039268 3300046683 Bacteria 2625
388 Ga0495613_0018736 3300046689 Bacteria 5162
389 Ga0495624_0014569 3300046690 Bacteria 5330
390 Ga0495624_0110500 3300046690 Bacteria 1690
391 Ga0495671_0044614 3300046692 Bacteria 2222
392 Ga0495649_0126376 3300046694 Bacteria 1350
393 Ga0495589_0132937 3300046794 Bacteria 1194
394 Ga0495600_0040201 3300046809 Bacteria 3045
395 Ga0495600_0098844 3300046809 Bacteria 1902
396 Ga0495660_0301660 3300046810 Bacteria 726
397 Ga0495581_0175635 3300047315 Bacteria 1252
398 Ga0495604_0002741 3300047317 Bacteria 14128
399 Ga0495604_0347300 3300047317 Bacteria 986
400 Ga0495674_0018174 3300047319 Bacteria 6545
401 Ga0495672_0037854 3300047320 Bacteria 2948
402 Ga0495676_0078201 3300047321 Bacteria 2519
403 Ga0495676_0176228 3300047321 Bacteria 1501
404 Ga0495676_0254294 3300047321 Bacteria 1197
405 Ga0495680_0001876 3300047322 Bacteria 22116
406 Ga0495683_0227434 3300047323 Bacteria 829
407 Ga0495687_016979 3300047443 Bacteria 3645
408 Ga0495675_0007387 3300047444 Bacteria 6766
409 Ga0495677_0095652 3300047445 Bacteria 1122
410 Ga0495593_0042988 3300047673 Bacteria 2424
411 Ga0495602_0134279 3300048088 Bacteria 1968
412 Ga0495602_0355544 3300048088 Bacteria 1056
413 Ga0495614_0138371 3300048089 Bacteria 1081
414 Ga0496100_0004974 3300048903 Bacteria 7107
415 Ga0496100_0079257 3300048903 Bacteria 2213
416 Ga0496100_0188935 3300048903 Bacteria 1494
417 Ga0496102_0026073 3300048905 Bacteria 5209
418 Ga0496102_0046145 3300048905 Bacteria 3956
419 Ga0496102_0065986 3300048905 Bacteria 3317
420 Ga0496102_0578633 3300048905 Bacteria 1046
421 Ga0496102_0730495 3300048905 Bacteria 913
422 Ga0496103_0014250 3300048906 Bacteria 4720
423 Ga0496103_0020368 3300048906 Bacteria 3983
424 Ga0496103_0080553 3300048906 Bacteria 2047
425 Ga0496104_0007659 3300048907 Bacteria 9560
426 Ga0496104_0009070 3300048907 Bacteria 8843
427 Ga0496104_0013563 3300048907 Bacteria 7345
428 Ga0496104_0089753 3300048907 Bacteria 2936
429 Ga0496104_0103508 3300048907 Bacteria 2727
430 Ga0496105_0001737 3300048908 Bacteria 15570
431 Ga0496105_0022832 3300048908 Bacteria 5070
432 Ga0496105_0024603 3300048908 Bacteria 4893
433 Ga0496105_0030575 3300048908 Bacteria 4412
434 Ga0496105_0039456 3300048908 Bacteria 3892
435 Ga0496106_0020734 3300048909 Bacteria 4877
436 Ga0496106_0027678 3300048909 Bacteria 4223
437 Ga0496107_0001885 3300048910 Bacteria 13277
438 Ga0496108_0004524 3300048911 Bacteria 11200
439 Ga0496108_0012004 3300048911 Bacteria 7048
440 Ga0496108_0013488 3300048911 Bacteria 6669
441 Ga0496108_0027730 3300048911 Bacteria 4680
442 Ga0496108_0291745 3300048911 Bacteria 1420
443 Ga0496109_0000334 3300048912 Bacteria 43945
444 Ga0496109_0023442 3300048912 Bacteria 5480
445 Ga0496109_0029067 3300048912 Bacteria 4948
446 Ga0496109_0070692 3300048912 Bacteria 3203
447 Ga0496109_0508779 3300048912 Bacteria 1137
448 Ga0496110_0003537 3300048913 Bacteria 11997
449 Ga0496110_0007586 3300048913 Bacteria 8669
450 Ga0496110_0015719 3300048913 Bacteria 6306
451 Ga0496110_0015752 3300048913 Bacteria 6301
452 Ga0496111_0005043 3300048914 Bacteria 8401
453 Ga0496111_0076502 3300048914 Bacteria 2439
454 Ga0496112_0002098 3300048915 Bacteria 15824
455 Ga0496112_0070920 3300048915 Bacteria 3443
456 Ga0496112_0132303 3300048915 Bacteria 2465
457 Ga0496113_0001458 3300048916 Bacteria 13169
458 Ga0496113_0051808 3300048916 Bacteria 3063
459 Ga0496113_0052310 3300048916 Bacteria 3050
460 Ga0496113_0055910 3300048916 Bacteria 2960
461 Ga0496114_0003383 3300048917 Bacteria 12246
462 Ga0496114_0024979 3300048917 Bacteria 4880
463 Ga0496114_0035207 3300048917 Bacteria 4134
464 Ga0496114_0288360 3300048917 Bacteria 1448
465 Ga0496115_0004993 3300048918 Bacteria 9635
466 Ga0496115_0032960 3300048918 Bacteria 4089
467 Ga0496115_0061736 3300048918 Bacteria 3022
468 Ga0496115_0069485 3300048918 Bacteria 2853
469 Ga0496115_0192898 3300048918 Bacteria 1683
470 Ga0496116_0001246 3300048919 Bacteria 29566
471 Ga0496116_0032538 3300048919 Bacteria 3715
472 Ga0496117_0013506 3300048920 Bacteria 7119
473 Ga0496117_0061833 3300048920 Bacteria 2571
474 Ga0496117_0169603 3300048920 Bacteria 1268
475 Ga0496118_0045250 3300048921 Bacteria 3438
476 Ga0496118_0210880 3300048921 Bacteria 1140
477 Ga0496119_0015983 3300048922 Bacteria 5739
478 Ga0496120_0033190 3300048923 Bacteria 3103
479 Ga0496120_0035858 3300048923 Bacteria 2958
480 Ga0496121_0051348 3300048924 Bacteria 3473
481 Ga0496121_0055708 3300048924 Bacteria 3291
482 Ga0496121_0407929 3300048924 Bacteria 888
483 Ga0496121_0453996 3300048924 Bacteria 825
484 Ga0496122_0132771 3300048925 Bacteria 1578
485 Ga0496123_0194890 3300048926 Bacteria 1044
486 Ga0496124_0053485 3300048927 Bacteria 3422
487 Ga0496124_0094461 3300048927 Bacteria 2432
488 Ga0496125_0010362 3300048928 Bacteria 9430
489 Ga0496125_0107839 3300048928 Bacteria 2028
490 Ga0496126_0079669 3300048929 Bacteria 2899
491 Ga0496126_0116717 3300048929 Bacteria 2319
492 Ga0496126_0123836 3300048929 Bacteria 2239
493 Ga0496126_0168255 3300048929 Bacteria 1869
494 Ga0496126_0181616 3300048929 Bacteria 1787
495 Ga0496126_0288515 3300048929 Bacteria 1358
496 Ga0495682_0014877 3300049460 Bacteria 2948
497 Ga0501032_0048084 3300049569 Bacteria 2880
498 Ga0501033_0125707 3300049570 Bacteria 1859
499 Ga0501034_0049390 3300049571 Bacteria 4244
500 Ga0501034_0141769 3300049571 Bacteria 2382
501 Ga0501034_0319258 3300049571 Bacteria 1486
502 Ga0501036_0050449 3300049572 Bacteria 3524
503 Ga0501036_0228148 3300049572 Bacteria 1563
504 Ga0501036_0347969 3300049572 Bacteria 1238
505 Ga0501037_0035305 3300049573 Bacteria 3687
506 Ga0501037_0269792 3300049573 Bacteria 1188
507 Ga0501038_0098623 3300049574 Bacteria 2436
508 Ga0501038_0188112 3300049574 Bacteria 1663
509 Ga0501038_0414373 3300049574 Bacteria 1040
510 Ga0501039_0240597 3300049575 Bacteria 1423
511 Ga0501043_0079711 3300049579 Bacteria 2572
512 Ga0501043_0205664 3300049579 Bacteria 1526
513 Ga0501043_0268155 3300049579 Bacteria 1311
514 Ga0501046_0029243 3300049580 Bacteria 4481
515 Ga0501047_0123187 3300049581 Bacteria 2473
516 Ga0501047_0221784 3300049581 Bacteria 1747
517 Ga0501070_0118301 3300049586 Bacteria 2190
518 Ga0501075_0276160 3300049591 Bacteria 1281
519 Ga0501076_0153359 3300049592 Bacteria 1875
520 Ga0501080_0047829 3300049742 Bacteria 3982
521 Ga0501035_0055738 3300049822 Bacteria 3528
522 Ga0501044_0070676 3300049823 Bacteria 3550
523 Ga0501044_0102125 3300049823 Bacteria 2884
524 Ga0501044_0230757 3300049823 Bacteria 1798
525 Ga0501044_0266741 3300049823 Bacteria 1649
526 Ga0501044_0848449 3300049823 Bacteria 790
527 nmdc:mga00v17_47055_c1 3300050491 Bacteria 2612
528 nmdc:mga0yw44_116848_c1 3300050492 Bacteria 1715
529 nmdc:mga0yw44_166163_c1 3300050492 Bacteria 1447
530 nmdc:mga0yw44_60307_c1 3300050492 Bacteria 2324
531 nmdc:mga0yw44_65034_c1 3300050492 Bacteria 2246
532 nmdc:mga0k408_4612_c1 3300050493 Bacteria 5915
533 nmdc:mga06z11_12993_c1 3300050494 Bacteria 3639
534 nmdc:mga04h51_24000_c1 3300050495 Bacteria 1863
535 nmdc:mga04h51_29132_c1 3300050495 Bacteria 1727
536 nmdc:mga07m45_14648_c1 3300050496 Bacteria 4182
537 nmdc:mga05p37_31595_c1 3300050507 Bacteria 6468
538 nmdc:mga08y16_140643_c1 3300050511 Bacteria 2509
539 nmdc:mga0n895_36988_c1 3300050512 Bacteria 4718
540 nmdc:mga0sz30_111989_c1 3300050516 Bacteria 1197
541 Ga0500635_0006652 3300053080 Bacteria 3095
542 Ga0495619_0032494 3300053085 Bacteria 3387
543 Ga0495619_0132565 3300053085 Bacteria 1713
544 Ga0495619_0256637 3300053085 Bacteria 1211
545 Ga0500578_0075763 3300053086 Bacteria 2143
546 Ga0500643_000028 3300053087 Bacteria 245672
547 Ga0500583_0022614 3300053092 Bacteria 2636
548 Ga0500651_0038098 3300053093 Bacteria 3029
549 Ga0500566_0000245 3300053094 Bacteria 28976
550 Ga0500641_0134635 3300053096 Bacteria 1067
551 Ga0500650_0112593 3300053098 Bacteria 1270
552 Ga0500555_002075 3300053103 Bacteria 5892
553 Ga0500572_004309 3300053111 Bacteria 3231
554 Ga0500572_004788 3300053111 Bacteria 3067
555 Ga0500595_022059 3300053119 Bacteria 2262
556 Ga0500608_061852 3300053122 Bacteria 1788
557 Ga0500642_0001807 3300053130 Bacteria 6174
558 Ga0500658_0030694 3300053134 Bacteria 2098
559 Ga0500559_0000103 3300053136 Bacteria 66422
560 Ga0500568_0008444 3300053139 Bacteria 4959
561 Ga0500577_0061990 3300053142 Bacteria 1441
562 Ga0500604_0006950 3300053151 Bacteria 2996
563 Ga0500616_0029749 3300053153 Bacteria 3004
564 Ga0500620_055743 3300053155 Bacteria 1335
565 Ga0500622_0041342 3300053156 Bacteria 2400
566 Ga0500627_0022685 3300053158 Bacteria 2548
567 Ga0500638_058212 3300053162 Bacteria 1861
568 Ga0500636_0000054 3300053177 Bacteria 54446
569 Ga0500576_037237 3300053725 Bacteria 2199
570 Ga0500601_000834 3300053737 Bacteria 3791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2879083081 2879085064 171
2 3300047317 Ga0495604_0347300 Ga0495604_0347300_300_974 180
3 3300044735 Ga0466968_0321553 Ga0466968_0321553_38_712 185
4 3300046810 Ga0495660_0301660 Ga0495660_0301660_76_711 187
5 3300048918 Ga0496115_0069485 Ga0496115_0069485_1359_2072 192
6 3300048927 Ga0496124_0053485 Ga0496124_0053485_1737_2450 192
7 3300048929 Ga0496126_0116717 Ga0496126_0116717_711_1424 192
8 3300049569 Ga0501032_0048084 Ga0501032_0048084_672_1370 194
9 3300049570 Ga0501033_0125707 Ga0501033_0125707_201_899 194
10 3300049571 Ga0501034_0049390 Ga0501034_0049390_113_811 194
11 3300049572 Ga0501036_0228148 Ga0501036_0228148_506_1204 194
12 3300049573 Ga0501037_0035305 Ga0501037_0035305_1560_2258 194
13 3300049574 Ga0501038_0098623 Ga0501038_0098623_875_1573 194
14 3300049579 Ga0501043_0079711 Ga0501043_0079711_714_1412 194
15 3300049822 Ga0501035_0055738 Ga0501035_0055738_2373_3071 194
16 3300049823 Ga0501044_0230757 Ga0501044_0230757_1015_1713 194
17 iso_pu_bacteria 2595698237 2596375737 194
18 3300046462 Ga0495651_0017692 Ga0495651_0017692_3049_3771 195
19 3300046463 Ga0495653_0287713 Ga0495653_0287713_271_993 195
20 3300046529 Ga0495652_0089837 Ga0495652_0089837_1573_2295 195
21 3300046533 Ga0495640_0024790 Ga0495640_0024790_3031_3753 195
22 3300046642 Ga0495634_0056964 Ga0495634_0056964_1715_2437 195
23 3300046689 Ga0495613_0018736 Ga0495613_0018736_209_931 195
24 3300046690 Ga0495624_0110500 Ga0495624_0110500_781_1503 195
25 3300046809 Ga0495600_0098844 Ga0495600_0098844_373_1095 195
26 3300047321 Ga0495676_0176228 Ga0495676_0176228_153_875 195
27 3300048088 Ga0495602_0355544 Ga0495602_0355544_317_1039 195
28 3300048089 Ga0495614_0138371 Ga0495614_0138371_39_761 195
29 3300048907 Ga0496104_0009070 Ga0496104_0009070_6268_6990 195
30 3300048908 Ga0496105_0022832 Ga0496105_0022832_3286_4008 195
31 3300048917 Ga0496114_0288360 Ga0496114_0288360_619_1341 195
32 3300048921 Ga0496118_0210880 Ga0496118_0210880_366_1088 195
33 3300048922 Ga0496119_0015983 Ga0496119_0015983_3322_4044 195
34 3300048924 Ga0496121_0407929 Ga0496121_0407929_92_814 195
35 3300031901 Ga0307406_10438749 Ga0307406_104387491 198
36 3300046454 Ga0495592_0041982 Ga0495592_0041982_560_1282 199
37 3300046462 Ga0495651_0004449 Ga0495651_0004449_9746_10468 199
38 3300046463 Ga0495653_0131375 Ga0495653_0131375_678_1400 199
39 3300046477 Ga0495664_0011915 Ga0495664_0011915_2302_3024 199
40 3300046511 Ga0495608_0009906 Ga0495608_0009906_555_1277 199
41 3300046516 Ga0495628_0159724 Ga0495628_0159724_620_1342 199
42 3300046529 Ga0495652_0005458 Ga0495652_0005458_364_1086 199
43 3300046536 Ga0495587_0008038 Ga0495587_0008038_5381_6103 199
44 3300046559 Ga0495667_0005992 Ga0495667_0005992_6862_7584 199
45 3300046675 Ga0495657_0002384 Ga0495657_0002384_6415_7137 199
46 3300046678 Ga0495599_0004607 Ga0495599_0004607_2321_3043 199
47 3300046679 Ga0495623_0010248 Ga0495623_0010248_3722_4444 199
48 3300046809 Ga0495600_0040201 Ga0495600_0040201_1870_2592 199
49 3300047317 Ga0495604_0002741 Ga0495604_0002741_10919_11641 199
50 3300047319 Ga0495674_0018174 Ga0495674_0018174_82_804 199
51 3300047322 Ga0495680_0001876 Ga0495680_0001876_12718_13440 199
52 3300047444 Ga0495675_0007387 Ga0495675_0007387_1626_2348 199
53 3300048088 Ga0495602_0134279 Ga0495602_0134279_954_1676 199
54 3300053085 Ga0495619_0132565 Ga0495619_0132565_872_1594 199
55 3300005844 Ga0068862_100742717 Ga0068862_1007427171 201
56 3300033180 Ga0307510_10119002 Ga0307510_101190022 201
57 3300025321 Ga0207656_10066768 Ga0207656_100667682 202
58 3300046506 Ga0495583_0158671 Ga0495583_0158671_164_886 202
59 3300003215 JGI25153J46596_10031294 JGI25153J46596_100312942 206
60 3300005327 Ga0070658_10021405 Ga0070658_100214058 206
61 3300005337 Ga0070682_100110140 Ga0070682_1001101402 206
62 3300005339 Ga0070660_100174060 Ga0070660_1001740601 206
63 3300005455 Ga0070663_100125401 Ga0070663_1001254014 206
64 3300005539 Ga0068853_100112148 Ga0068853_1001121482 206
65 3300025297 Ga0209758_1000711 Ga0209758_100071118 206
66 3300025909 Ga0207705_10128946 Ga0207705_101289462 206
67 3300025919 Ga0207657_10125678 Ga0207657_101256784 206
68 3300025939 Ga0207665_10243449 Ga0207665_102434492 206
69 3300026041 Ga0207639_10160589 Ga0207639_101605892 206
70 3300026067 Ga0207678_10023768 Ga0207678_100237686 206
71 3300046459 Ga0495629_0305227 Ga0495629_0305227_196_918 206
72 3300048911 Ga0496108_0291745 Ga0496108_0291745_375_1097 206
73 3300048924 Ga0496121_0051348 Ga0496121_0051348_1222_1944 207
74 3300033180 Ga0307510_10121417 Ga0307510_101214173 208
75 3300046665 Ga0495661_0171062 Ga0495661_0171062_149_871 208
76 3300048929 Ga0496126_0123836 Ga0496126_0123836_1178_1900 208
77 3300053085 Ga0495619_0032494 Ga0495619_0032494_509_1231 208
78 3300053119 Ga0500595_022059 Ga0500595_022059_1484_2206 208
79 3300005347 Ga0070668_100027658 Ga0070668_1000276586 209
80 3300005355 Ga0070671_100032245 Ga0070671_1000322452 209
81 3300005367 Ga0070667_100272519 Ga0070667_1002725192 209
82 3300005455 Ga0070663_100478155 Ga0070663_1004781551 209
83 3300005548 Ga0070665_100045145 Ga0070665_1000451455 209
84 3300005563 Ga0068855_100452592 Ga0068855_1004525922 209
85 3300005616 Ga0068852_100185761 Ga0068852_1001857613 209
86 3300005617 Ga0068859_100359204 Ga0068859_1003592042 209
87 3300005618 Ga0068864_100162154 Ga0068864_1001621542 209
88 3300005841 Ga0068863_100524593 Ga0068863_1005245932 209
89 3300005842 Ga0068858_100909184 Ga0068858_1009091841 209
90 3300005843 Ga0068860_100084953 Ga0068860_1000849534 209
91 3300006048 Ga0075363_100265134 Ga0075363_1002651342 209
92 3300006051 Ga0075364_10132972 Ga0075364_101329722 209
93 3300006195 Ga0075366_10008044 Ga0075366_100080448 209
94 3300006353 Ga0075370_10028282 Ga0075370_100282822 209
95 3300006931 Ga0097620_100359228 Ga0097620_1003592282 209
96 3300009093 Ga0105240_10589561 Ga0105240_105895611 209
97 3300009101 Ga0105247_10060123 Ga0105247_100601234 209
98 3300009177 Ga0105248_10144863 Ga0105248_101448634 209
99 3300009545 Ga0105237_10026831 Ga0105237_100268314 209
100 3300011119 Ga0105246_10047093 Ga0105246_100470932 209
101 3300013297 Ga0157378_10083406 Ga0157378_100834062 209
102 3300013306 Ga0163162_10205407 Ga0163162_102054071 209
103 3300013308 Ga0157375_10118303 Ga0157375_101183031 209
104 3300014325 Ga0163163_10043948 Ga0163163_100439485 209
105 3300025900 Ga0207710_10156409 Ga0207710_101564091 209
106 3300025901 Ga0207688_10040030 Ga0207688_100400302 209
107 3300025904 Ga0207647_10008109 Ga0207647_100081094 209
108 3300025914 Ga0207671_10107617 Ga0207671_101076172 209
109 3300025927 Ga0207687_10540199 Ga0207687_105401992 209
110 3300025931 Ga0207644_10018254 Ga0207644_100182543 209
111 3300025941 Ga0207711_10388580 Ga0207711_103885801 209
112 3300025949 Ga0207667_10605322 Ga0207667_106053222 209
113 3300025986 Ga0207658_10250106 Ga0207658_102501062 209
114 3300026035 Ga0207703_10181953 Ga0207703_101819532 209
115 3300026067 Ga0207678_10040824 Ga0207678_100408243 209
116 3300026088 Ga0207641_10273095 Ga0207641_102730952 209
117 3300026095 Ga0207676_10520631 Ga0207676_105206312 209
118 3300026116 Ga0207674_10057340 Ga0207674_100573404 209
119 3300026121 Ga0207683_10373030 Ga0207683_103730302 209
120 3300026142 Ga0207698_10785239 Ga0207698_107852391 209
121 3300027866 Ga0209813_10024296 Ga0209813_100242962 209
122 3300028381 Ga0268264_10224515 Ga0268264_102245151 209
123 3300046474 Ga0495605_0171754 Ga0495605_0171754_188_910 209
124 3300046507 Ga0495606_0251381 Ga0495606_0251381_136_858 209
125 3300046522 Ga0495643_0045119 Ga0495643_0045119_1597_2319 209
126 3300046524 Ga0495648_0008955 Ga0495648_0008955_5634_6356 209
127 3300046542 Ga0495597_0110098 Ga0495597_0110098_325_1047 209
128 3300046616 Ga0495668_0084179 Ga0495668_0084179_951_1673 209
129 3300046660 Ga0495625_0225759 Ga0495625_0225759_150_881 209
130 3300046692 Ga0495671_0044614 Ga0495671_0044614_607_1329 209
131 3300046694 Ga0495649_0126376 Ga0495649_0126376_95_817 209
132 3300046794 Ga0495589_0132937 Ga0495589_0132937_268_990 209
133 3300047323 Ga0495683_0227434 Ga0495683_0227434_97_819 209
134 3300047443 Ga0495687_016979 Ga0495687_016979_1682_2404 209
135 3300048905 Ga0496102_0065986 Ga0496102_0065986_272_994 209
136 3300048906 Ga0496103_0080553 Ga0496103_0080553_187_909 209
137 3300048907 Ga0496104_0103508 Ga0496104_0103508_214_936 209
138 3300048908 Ga0496105_0039456 Ga0496105_0039456_1654_2376 209
139 3300048911 Ga0496108_0013488 Ga0496108_0013488_1403_2125 209
140 3300048912 Ga0496109_0023442 Ga0496109_0023442_671_1393 209
141 3300048913 Ga0496110_0015752 Ga0496110_0015752_2370_3092 209
142 3300048916 Ga0496113_0055910 Ga0496113_0055910_1806_2528 209
143 3300048919 Ga0496116_0032538 Ga0496116_0032538_887_1609 209
144 3300048920 Ga0496117_0061833 Ga0496117_0061833_1726_2448 209
145 3300048927 Ga0496124_0094461 Ga0496124_0094461_1549_2271 209
146 3300048928 Ga0496125_0107839 Ga0496125_0107839_234_956 209
147 3300049460 Ga0495682_0014877 Ga0495682_0014877_589_1311 209
148 3300050491 nmdc:mga00v17_47055_c1 nmdc:mga00v17_47055_c1_1644_2366 209
149 3300050492 nmdc:mga0yw44_60307_c1 nmdc:mga0yw44_60307_c1_702_1424 209
150 3300050493 nmdc:mga0k408_4612_c1 nmdc:mga0k408_4612_c1_197_919 209
151 3300050495 nmdc:mga04h51_24000_c1 nmdc:mga04h51_24000_c1_322_1044 209
152 3300050496 nmdc:mga07m45_14648_c1 nmdc:mga07m45_14648_c1_1549_2271 209
153 iso_pu_bacteria 2545555834 2545673716 211
154 iso_pu_bacteria 2738541281 2738743864 211
155 iso_pu_bacteria 2738543032 2739353094 211
156 iso_pu_bacteria 2829745981 2829746323 211
157 iso_pu_bacteria 2842698319 2842700357 211
158 iso_pu_bacteria 2861691609 2861695196 211
159 iso_pu_bacteria 2889306138 2889310631 211
160 iso_pu_bacteria 2902330777 2902334781 211
161 iso_pu_bacteria 2902405164 2902405245 211
162 iso_pu_bacteria 2928125067 2928129282 211
163 iso_pu_bacteria 3003665799 3003670310 211
164 iso_pu_bacteria 641522639 641642101 211
165 iso_pu_bacteria 643348564 643598436 211
166 iso_pu_bacteria 8056875544 8056878878 211
167 3300048912 Ga0496109_0508779 Ga0496109_0508779_214_933 212
168 3300048923 Ga0496120_0035858 Ga0496120_0035858_1069_1782 212
169 iso_pu_bacteria 2507262055 2507504486 212
170 iso_pu_bacteria 2508501009 2508545910 212
171 iso_pu_bacteria 2508501042 2508694742 212
172 iso_pu_bacteria 2511231028 2511400263 212
173 iso_pu_bacteria 2513237092 2513624281 212
174 iso_pu_bacteria 2513237095 2513649244 212
175 iso_pu_bacteria 2513237096 2513656158 212
176 iso_pu_bacteria 2513237102 2513701642 212
177 iso_pu_bacteria 2513237137 2513861585 212
178 iso_pu_bacteria 2513237139 2513874130 212
179 iso_pu_bacteria 2513237141 2513894773 212
180 iso_pu_bacteria 2513237145 2513917662 212
181 iso_pu_bacteria 2517093001 2517103028 212
182 iso_pu_bacteria 2517572143 2517889801 212
183 iso_pu_bacteria 2524023228 2524533024 212
184 iso_pu_bacteria 2582581866 2585395012 212
185 iso_pu_bacteria 2602042107 2603862373 212
186 iso_pu_bacteria 2617270735 2617350255 212
187 iso_pu_bacteria 2643221651 2644290307 212
188 iso_pu_bacteria 2667528175 2671119648 212
189 iso_pu_bacteria 2671180139 2671692074 212
190 iso_pu_bacteria 2724679232 2725946869 212
191 iso_pu_bacteria 2728368998 2728748323 212
192 iso_pu_bacteria 2791355196 2793059256 212
193 iso_pu_bacteria 2791355197 2793070199 212
194 iso_pu_bacteria 2802429603 2805920849 212
195 iso_pu_bacteria 2816332527 2818240633 212
196 iso_pu_bacteria 2824600985 2824603802 212
197 iso_pu_bacteria 2824617872 2824618796 212
198 iso_pu_bacteria 2824626560 2824628902 212
199 iso_pu_bacteria 2824635225 2824638413 212
200 iso_pu_bacteria 2824644064 2824648045 212
201 iso_pu_bacteria 2824696289 2824696948 212
202 iso_pu_bacteria 2824696289 2824699392 212
203 iso_pu_bacteria 2824714736 2824722614 212
204 iso_pu_bacteria 2824723954 2824726004 212
205 iso_pu_bacteria 2824773399 2824778048 212
206 iso_pu_bacteria 2841941048 2841946091 212
207 iso_pu_bacteria 2841957949 2841963877 212
208 iso_pu_bacteria 2842038055 2842041635 212
209 iso_pu_bacteria 2842045827 2842049677 212
210 iso_pu_bacteria 2844315083 2844321469 212
211 iso_pu_bacteria 2844315083 2844322117 212
212 iso_pu_bacteria 2844315083 2844322796 212
213 iso_pu_bacteria 2847939898 2847943167 212
214 iso_pu_bacteria 2849076700 2849076907 212
215 iso_pu_bacteria 2874612657 2874620425 212
216 iso_pu_bacteria 2874620515 2874621915 212
217 iso_pu_bacteria 2874628541 2874629591 212
218 iso_pu_bacteria 2881364244 2881364579 212
219 iso_pu_bacteria 2881665667 2881673322 212
220 iso_pu_bacteria 2885374607 2885375450 212
221 iso_pu_bacteria 2888378607 2888378917 212
222 iso_pu_bacteria 2888378607 2888387313 212
223 iso_pu_bacteria 2888388044 2888391394 212
224 iso_pu_bacteria 2903727486 2903727952 212
225 iso_pu_bacteria 2903727486 2903734563 212
226 iso_pu_bacteria 2903727486 2903734688 212
227 iso_pu_bacteria 2903748898 2903750755 212
228 iso_pu_bacteria 2904666416 2904669492 212
229 iso_pu_bacteria 2904690495 2904695182 212
230 iso_pu_bacteria 2904699407 2904711307 212
231 iso_pu_bacteria 2906602504 2906602564 212
232 iso_pu_bacteria 2906602504 2906605001 212
233 iso_pu_bacteria 2906602504 2906609535 212
234 iso_pu_bacteria 2906610324 2906612471 212
235 iso_pu_bacteria 2906626472 2906629676 212
236 iso_pu_bacteria 2906635258 2906642494 212
237 iso_pu_bacteria 2906660503 2906661052 212
238 iso_pu_bacteria 2908739725 2908745740 212
239 iso_pu_bacteria 2908756301 2908757588 212
240 iso_pu_bacteria 2922393267 2922397889 212
241 iso_pu_bacteria 2922425934 2922433026 212
242 iso_pu_bacteria 2932794094 2932800651 212
243 iso_pu_bacteria 2932801729 2932808382 212
244 iso_pu_bacteria 2935608549 2935613110 212
245 iso_pu_bacteria 2935630451 2935632984 212
246 iso_pu_bacteria 2935648319 2935654066 212
247 iso_pu_bacteria 2935656913 2935662832 212
248 iso_pu_bacteria 2935819856 2935825038 212
249 iso_pu_bacteria 2935847175 2935852257 212
250 iso_pu_bacteria 2935883170 2935883489 212
251 iso_pu_bacteria 2935908558 2935910690 212
252 iso_pu_bacteria 2935916978 2935921870 212
253 iso_pu_bacteria 2935926038 2935929991 212
254 iso_pu_bacteria 2935934488 2935937659 212
255 iso_pu_bacteria 2935942939 2935949763 212
256 iso_pu_bacteria 2935951376 2935956859 212
257 iso_pu_bacteria 2935959822 2935965321 212
258 iso_pu_bacteria 2935967501 2935970884 212
259 iso_pu_bacteria 2935984226 2935984371 212
260 iso_pu_bacteria 2936011229 2936016971 212
261 iso_pu_bacteria 2936019824 2936025621 212
262 iso_pu_bacteria 2936028420 2936034463 212
263 iso_pu_bacteria 2936046547 2936052503 212
264 iso_pu_bacteria 2936055302 2936055451 212
265 iso_pu_bacteria 2941507105 2941509714 212
266 iso_pu_bacteria 2941515067 2941517543 212
267 iso_pu_bacteria 2941523033 2941526504 212
268 iso_pu_bacteria 2996893221 2996895624 212
269 iso_pu_bacteria 3005474847 3005476002 212
270 iso_pu_bacteria 3005483717 3005490797 212
271 iso_pu_bacteria 3005587118 3005589948 212
272 iso_pu_bacteria 3005594810 3005601836 212
273 iso_pu_bacteria 3005594810 3005602609 212
274 iso_pu_bacteria 3005594810 3005603286 212
275 iso_pu_bacteria 3005710791 3005717573 212
276 iso_pu_bacteria 3005718088 3005724622 212
277 iso_pu_bacteria 3005718088 3005725758 212
278 iso_pu_bacteria 3005718088 3005726079 212
279 iso_pu_bacteria 8006933436 8006937310 212
280 iso_pu_bacteria 8006973647 8006977342 212
281 iso_pu_bacteria 8016583857 8016587520 212
282 iso_pu_bacteria 8016630954 8016636757 212
283 iso_pu_bacteria 8019555841 8019561319 212
284 iso_pu_bacteria 8019565922 8019571402 212
285 iso_pu_bacteria 8019687851 8019695454 212
286 iso_pu_bacteria 8056967851 8056974618 212
287 iso_pu_bacteria 8056967851 8056976544 212
288 3300009093 Ga0105240_10071393 Ga0105240_100713934 213
289 3300009093 Ga0105240_10126225 Ga0105240_101262254 213
290 3300025913 Ga0207695_10018587 Ga0207695_100185879 213
291 3300025913 Ga0207695_10236341 Ga0207695_102363413 213
292 3300039438 Ga0436360_0963720 Ga0436360_0963720_68_784 213
293 3300044735 Ga0466968_0022068 Ga0466968_0022068_1721_2437 213
294 3300044842 Ga0466957_0440237 Ga0466957_0440237_146_862 213
295 3300049571 Ga0501034_0141769 Ga0501034_0141769_978_1697 213
296 3300049571 Ga0501034_0319258 Ga0501034_0319258_686_1405 213
297 3300049572 Ga0501036_0050449 Ga0501036_0050449_1475_2194 213
298 3300049574 Ga0501038_0188112 Ga0501038_0188112_383_1102 213
299 3300049581 Ga0501047_0221784 Ga0501047_0221784_392_1111 213
300 3300049742 Ga0501080_0047829 Ga0501080_0047829_3150_3869 213
301 3300049823 Ga0501044_0102125 Ga0501044_0102125_38_757 213
302 3300049823 Ga0501044_0266741 Ga0501044_0266741_530_1249 213
303 iso_pu_bacteria 2643221618 2644104210 213
304 iso_pu_bacteria 2643221626 2644149581 213
305 iso_pu_bacteria 2643221655 2644307084 213
306 iso_pu_bacteria 2643221659 2644331569 213
307 iso_pu_bacteria 2643221698 2644544547 213
308 iso_pu_bacteria 2643221712 2644619321 213
309 iso_pu_bacteria 2844163670 2844168734 213
310 iso_pu_bacteria 2894817345 2894817595 213
311 iso_pu_bacteria 2941499720 2941506266 213
312 3300005337 Ga0070682_100734482 Ga0070682_1007344821 214
313 3300005436 Ga0070713_100406852 Ga0070713_1004068522 214
314 3300039447 Ga0436361_0617095 Ga0436361_0617095_2003_2719 214
315 3300001991 JGI24743J22301_10003527 JGI24743J22301_100035273 215
316 3300002070 JGI24750J21931_1000926 JGI24750J21931_10009266 215
317 3300002077 JGI24744J21845_10000165 JGI24744J21845_100001653 215
318 3300003214 JGI25165J46597_1009366 JGI25165J46597_10093662 215
319 3300003215 JGI25153J46596_10001308 JGI25153J46596_1000130813 215
320 3300003215 JGI25153J46596_10002547 JGI25153J46596_1000254710 215
321 3300003215 JGI25153J46596_10003542 JGI25153J46596_100035426 215
322 3300003354 JGI25160J50197_1001680 JGI25160J50197_10016809 215
323 3300003354 JGI25160J50197_1003442 JGI25160J50197_10034424 215
324 3300003354 JGI25160J50197_1005384 JGI25160J50197_10053846 215
325 3300003794 Ga0055531_10007525 Ga0055531_100075257 215
326 3300004625 Ga0055543_1007516 Ga0055543_10075164 215
327 3300005262 Ga0065165_1000370 Ga0065165_10003705 215
328 3300005262 Ga0065165_1008717 Ga0065165_10087174 215
329 3300005262 Ga0065165_1012184 Ga0065165_10121842 215
330 3300005327 Ga0070658_10226254 Ga0070658_102262543 215
331 3300005328 Ga0070676_10101803 Ga0070676_101018032 215
332 3300005329 Ga0070683_100135003 Ga0070683_1001350033 215
333 3300005330 Ga0070690_100004755 Ga0070690_1000047552 215
334 3300005331 Ga0070670_100008567 Ga0070670_1000085675 215
335 3300005333 Ga0070677_10180098 Ga0070677_101800981 215
336 3300005334 Ga0068869_100028404 Ga0068869_1000284044 215
337 3300005335 Ga0070666_10049837 Ga0070666_100498375 215
338 3300005338 Ga0068868_100064683 Ga0068868_1000646832 215
339 3300005340 Ga0070689_100025542 Ga0070689_1000255422 215
340 3300005340 Ga0070689_100286403 Ga0070689_1002864032 215
341 3300005341 Ga0070691_10179934 Ga0070691_101799342 215
342 3300005347 Ga0070668_100099603 Ga0070668_1000996032 215
343 3300005347 Ga0070668_100209875 Ga0070668_1002098752 215
344 3300005353 Ga0070669_100081406 Ga0070669_1000814063 215
345 3300005354 Ga0070675_100045440 Ga0070675_1000454405 215
346 3300005355 Ga0070671_100029320 Ga0070671_1000293206 215
347 3300005356 Ga0070674_100043548 Ga0070674_1000435483 215
348 3300005364 Ga0070673_100696505 Ga0070673_1006965051 215
349 3300005365 Ga0070688_100018986 Ga0070688_1000189865 215
350 3300005366 Ga0070659_100066592 Ga0070659_1000665922 215
351 3300005367 Ga0070667_100046765 Ga0070667_1000467656 215
352 3300005367 Ga0070667_100238893 Ga0070667_1002388933 215
353 3300005434 Ga0070709_10001375 Ga0070709_100013755 215
354 3300005435 Ga0070714_100083302 Ga0070714_1000833023 215
355 3300005436 Ga0070713_100032505 Ga0070713_1000325056 215
356 3300005437 Ga0070710_10021417 Ga0070710_100214174 215
357 3300005437 Ga0070710_10032712 Ga0070710_100327123 215
358 3300005439 Ga0070711_100002720 Ga0070711_1000027204 215
359 3300005439 Ga0070711_100087251 Ga0070711_1000872511 215
360 3300005441 Ga0070700_100006014 Ga0070700_1000060142 215
361 3300005444 Ga0070694_100074711 Ga0070694_1000747114 215
362 3300005445 Ga0070708_100561638 Ga0070708_1005616381 215
363 3300005455 Ga0070663_100121239 Ga0070663_1001212393 215
364 3300005459 Ga0068867_100119256 Ga0068867_1001192561 215
365 3300005466 Ga0070685_10010088 Ga0070685_100100884 215
366 3300005468 Ga0070707_100170276 Ga0070707_1001702761 215
367 3300005535 Ga0070684_100139066 Ga0070684_1001390661 215
368 3300005536 Ga0070697_100050464 Ga0070697_1000504643 215
369 3300005536 Ga0070697_100171037 Ga0070697_1001710373 215
370 3300005539 Ga0068853_100042589 Ga0068853_1000425893 215
371 3300005543 Ga0070672_100002676 Ga0070672_1000026764 215
372 3300005544 Ga0070686_100031603 Ga0070686_1000316033 215
373 3300005546 Ga0070696_100045475 Ga0070696_1000454754 215
374 3300005548 Ga0070665_100040108 Ga0070665_1000401084 215
375 3300005548 Ga0070665_100084358 Ga0070665_1000843582 215
376 3300005564 Ga0070664_100003633 Ga0070664_1000036336 215
377 3300005577 Ga0068857_100292677 Ga0068857_1002926773 215
378 3300005578 Ga0068854_100010172 Ga0068854_1000101726 215
379 3300005578 Ga0068854_100461363 Ga0068854_1004613632 215
380 3300005614 Ga0068856_100177572 Ga0068856_1001775722 215
381 3300005614 Ga0068856_100364837 Ga0068856_1003648372 215
382 3300005615 Ga0070702_100589668 Ga0070702_1005896681 215
383 3300005616 Ga0068852_100011009 Ga0068852_1000110095 215
384 3300005616 Ga0068852_100240589 Ga0068852_1002405892 215
385 3300005618 Ga0068864_100008924 Ga0068864_1000089244 215
386 3300005718 Ga0068866_10108429 Ga0068866_101084293 215
387 3300005719 Ga0068861_100081663 Ga0068861_1000816631 215
388 3300005719 Ga0068861_100162437 Ga0068861_1001624373 215
389 3300005834 Ga0068851_10129018 Ga0068851_101290182 215
390 3300005840 Ga0068870_10077738 Ga0068870_100777382 215
391 3300005841 Ga0068863_100913919 Ga0068863_1009139192 215
392 3300005842 Ga0068858_100217242 Ga0068858_1002172422 215
393 3300005843 Ga0068860_100198345 Ga0068860_1001983451 215
394 3300005844 Ga0068862_100101439 Ga0068862_1001014392 215
395 3300006038 Ga0075365_10238945 Ga0075365_102389452 215
396 3300006042 Ga0075368_10113012 Ga0075368_101130121 215
397 3300006163 Ga0070715_10001698 Ga0070715_100016986 215
398 3300006163 Ga0070715_10067122 Ga0070715_100671222 215
399 3300006173 Ga0070716_100005769 Ga0070716_1000057697 215
400 3300006173 Ga0070716_100036674 Ga0070716_1000366741 215
401 3300006175 Ga0070712_100070198 Ga0070712_1000701982 215
402 3300006175 Ga0070712_100469162 Ga0070712_1004691621 215
403 3300006177 Ga0075362_10058211 Ga0075362_100582113 215
404 3300006178 Ga0075367_10041348 Ga0075367_100413484 215
405 3300006186 Ga0075369_10038354 Ga0075369_100383542 215
406 3300006195 Ga0075366_10025744 Ga0075366_100257446 215
407 3300006237 Ga0097621_100012720 Ga0097621_1000127206 215
408 3300006358 Ga0068871_100023661 Ga0068871_1000236614 215
409 3300006871 Ga0075434_100046483 Ga0075434_1000464835 215
410 3300006881 Ga0068865_100004145 Ga0068865_1000041451 215
411 3300006942 Ga0099824_1002047 Ga0099824_100204718 215
412 3300006942 Ga0099824_1018951 Ga0099824_10189516 215
413 3300006943 Ga0099822_1004737 Ga0099822_100473715 215
414 3300007265 Ga0099794_10010337 Ga0099794_100103375 215
415 3300009036 Ga0105244_10092099 Ga0105244_100920992 215
416 3300009094 Ga0111539_10138127 Ga0111539_101381272 215
417 3300009094 Ga0111539_10341581 Ga0111539_103415813 215
418 3300009098 Ga0105245_10003624 Ga0105245_100036243 215
419 3300009101 Ga0105247_10121513 Ga0105247_101215132 215
420 3300009147 Ga0114129_10033500 Ga0114129_100335005 215
421 3300009174 Ga0105241_10083696 Ga0105241_100836962 215
422 3300009176 Ga0105242_10205664 Ga0105242_102056642 215
423 3300009177 Ga0105248_10051723 Ga0105248_100517232 215
424 3300009545 Ga0105237_10100206 Ga0105237_101002066 215
425 3300009545 Ga0105237_10772377 Ga0105237_107723771 215
426 3300009553 Ga0105249_10106531 Ga0105249_101065314 215
427 3300009553 Ga0105249_10204875 Ga0105249_102048753 215
428 3300009553 Ga0105249_10406203 Ga0105249_104062032 215
429 3300010375 Ga0105239_10135986 Ga0105239_101359865 215
430 3300011119 Ga0105246_10032958 Ga0105246_100329583 215
431 3300013296 Ga0157374_10192459 Ga0157374_101924593 215
432 3300013296 Ga0157374_10364885 Ga0157374_103648852 215
433 3300013297 Ga0157378_10389292 Ga0157378_103892921 215
434 3300013306 Ga0163162_10062435 Ga0163162_100624352 215
435 3300013306 Ga0163162_10071107 Ga0163162_100711073 215
436 3300013306 Ga0163162_10207504 Ga0163162_102075041 215
437 3300014325 Ga0163163_10002774 Ga0163163_100027746 215
438 3300014745 Ga0157377_10138168 Ga0157377_101381682 215
439 3300014968 Ga0157379_10049160 Ga0157379_100491603 215
440 3300014968 Ga0157379_10407601 Ga0157379_104076012 215
441 3300021320 Ga0214544_1000030 Ga0214544_100003041 215
442 3300021320 Ga0214544_1001366 Ga0214544_10013663 215
443 3300021321 Ga0214542_1000026 Ga0214542_100002641 215
444 3300021321 Ga0214542_1001752 Ga0214542_10017524 215
445 3300021324 Ga0214545_1000015 Ga0214545_100001541 215
446 3300021324 Ga0214545_1000519 Ga0214545_100051927 215
447 3300021327 Ga0214543_1000036 Ga0214543_100003641 215
448 3300021327 Ga0214543_1002074 Ga0214543_100207436 215
449 3300025230 Ga0209563_100438 Ga0209563_10043813 215
450 3300025253 Ga0209677_105312 Ga0209677_1053126 215
451 3300025261 Ga0209233_1006433 Ga0209233_10064332 215
452 3300025261 Ga0209233_1007514 Ga0209233_10075143 215
453 3300025273 Ga0209673_1013733 Ga0209673_10137335 215
454 3300025295 Ga0209564_1010432 Ga0209564_10104326 215
455 3300025295 Ga0209564_1013885 Ga0209564_10138852 215
456 3300025297 Ga0209758_1000030 Ga0209758_1000030409 215
457 3300025297 Ga0209758_1000801 Ga0209758_10008017 215
458 3300025297 Ga0209758_1000893 Ga0209758_100089328 215
459 3300025297 Ga0209758_1001645 Ga0209758_100164513 215
460 3300025297 Ga0209758_1002462 Ga0209758_10024627 215
461 3300025299 Ga0209256_1002674 Ga0209256_100267416 215
462 3300025299 Ga0209256_1062115 Ga0209256_10621151 215
463 3300025302 Ga0207426_1000271 Ga0207426_100027172 215
464 3300025302 Ga0207426_1008000 Ga0207426_10080003 215
465 3300025304 Ga0209257_1000662 Ga0209257_10006629 215
466 3300025898 Ga0207692_10003134 Ga0207692_100031343 215
467 3300025898 Ga0207692_10156810 Ga0207692_101568102 215
468 3300025899 Ga0207642_10005329 Ga0207642_100053295 215
469 3300025899 Ga0207642_10084055 Ga0207642_100840552 215
470 3300025900 Ga0207710_10093623 Ga0207710_100936232 215
471 3300025901 Ga0207688_10000210 Ga0207688_100002109 215
472 3300025904 Ga0207647_10016728 Ga0207647_100167284 215
473 3300025905 Ga0207685_10010493 Ga0207685_100104933 215
474 3300025906 Ga0207699_10003346 Ga0207699_100033463 215
475 3300025907 Ga0207645_10004480 Ga0207645_1000448012 215
476 3300025908 Ga0207643_10000142 Ga0207643_1000014236 215
477 3300025909 Ga0207705_10369888 Ga0207705_103698882 215
478 3300025915 Ga0207693_10002151 Ga0207693_100021515 215
479 3300025915 Ga0207693_10042766 Ga0207693_100427664 215
480 3300025915 Ga0207693_10159731 Ga0207693_101597311 215
481 3300025915 Ga0207693_10491291 Ga0207693_104912912 215
482 3300025916 Ga0207663_10001035 Ga0207663_100010356 215
483 3300025916 Ga0207663_10435076 Ga0207663_104350762 215
484 3300025918 Ga0207662_10032599 Ga0207662_100325994 215
485 3300025919 Ga0207657_10046650 Ga0207657_100466506 215
486 3300025920 Ga0207649_10013542 Ga0207649_100135425 215
487 3300025921 Ga0207652_10479839 Ga0207652_104798391 215
488 3300025922 Ga0207646_10046025 Ga0207646_100460252 215
489 3300025923 Ga0207681_10062623 Ga0207681_100626232 215
490 3300025925 Ga0207650_10002372 Ga0207650_100023723 215
491 3300025925 Ga0207650_10017521 Ga0207650_100175214 215
492 3300025926 Ga0207659_10070440 Ga0207659_100704402 215
493 3300025928 Ga0207700_10087229 Ga0207700_100872292 215
494 3300025928 Ga0207700_10130759 Ga0207700_101307592 215
495 3300025928 Ga0207700_10321432 Ga0207700_103214321 215
496 3300025929 Ga0207664_10003571 Ga0207664_100035714 215
497 3300025931 Ga0207644_10153755 Ga0207644_101537553 215
498 3300025932 Ga0207690_10079489 Ga0207690_100794892 215
499 3300025933 Ga0207706_10170076 Ga0207706_101700763 215
500 3300025934 Ga0207686_10463152 Ga0207686_104631521 215
501 3300025935 Ga0207709_10005119 Ga0207709_100051195 215
502 3300025936 Ga0207670_10026050 Ga0207670_100260503 215
503 3300025937 Ga0207669_10019691 Ga0207669_100196913 215
504 3300025938 Ga0207704_10002563 Ga0207704_100025633 215
505 3300025939 Ga0207665_10003044 Ga0207665_1000304410 215
506 3300025939 Ga0207665_10040353 Ga0207665_100403535 215
507 3300025939 Ga0207665_10210597 Ga0207665_102105972 215
508 3300025940 Ga0207691_10001552 Ga0207691_1000155222 215
509 3300025941 Ga0207711_10549480 Ga0207711_105494802 215
510 3300025942 Ga0207689_10001664 Ga0207689_1000166412 215
511 3300025944 Ga0207661_10073459 Ga0207661_100734592 215
512 3300025945 Ga0207679_10054346 Ga0207679_100543463 215
513 3300025960 Ga0207651_10787236 Ga0207651_107872361 215
514 3300025961 Ga0207712_10067571 Ga0207712_100675714 215
515 3300025961 Ga0207712_10794891 Ga0207712_107948911 215
516 3300025972 Ga0207668_10183590 Ga0207668_101835902 215
517 3300026035 Ga0207703_10005307 Ga0207703_100053073 215
518 3300026035 Ga0207703_10931557 Ga0207703_109315571 215
519 3300026041 Ga0207639_10708770 Ga0207639_107087701 215
520 3300026067 Ga0207678_10237441 Ga0207678_102374413 215
521 3300026075 Ga0207708_10011317 Ga0207708_100113172 215
522 3300026078 Ga0207702_10013844 Ga0207702_100138445 215
523 3300026088 Ga0207641_10002866 Ga0207641_1000286618 215
524 3300026089 Ga0207648_10002204 Ga0207648_1000220413 215
525 3300026095 Ga0207676_10002677 Ga0207676_100026773 215
526 3300026116 Ga0207674_10314174 Ga0207674_103141742 215
527 3300026118 Ga0207675_100000323 Ga0207675_10000032314 215
528 3300026121 Ga0207683_10003902 Ga0207683_100039024 215
529 3300026142 Ga0207698_10006113 Ga0207698_100061135 215
530 3300026142 Ga0207698_10087346 Ga0207698_100873464 215
531 3300027296 Ga0209389_1000055 Ga0209389_100005517 215
532 3300027357 Ga0209589_1000005 Ga0209589_1000005243 215
533 3300027357 Ga0209589_1000024 Ga0209589_1000024111 215
534 3300027361 Ga0209489_100005 Ga0209489_100005243 215
535 3300027361 Ga0209489_100123 Ga0209489_100123108 215
536 3300027363 Ga0209700_100006 Ga0209700_100006243 215
537 3300027866 Ga0209813_10024464 Ga0209813_100244641 215
538 3300028380 Ga0268265_10376455 Ga0268265_103764552 215
539 3300028381 Ga0268264_10065025 Ga0268264_100650254 215
540 3300028556 Ga0265337_1006988 Ga0265337_10069882 215
541 3300028563 Ga0265319_1048560 Ga0265319_10485602 215
542 3300028577 Ga0265318_10028598 Ga0265318_100285984 215
543 3300028653 Ga0265323_10000560 Ga0265323_1000056016 215
544 3300028654 Ga0265322_10013558 Ga0265322_100135583 215
545 3300028666 Ga0265336_10000550 Ga0265336_1000055018 215
546 3300028800 Ga0265338_10000231 Ga0265338_1000023195 215
547 3300031711 Ga0265314_10051359 Ga0265314_100513593 215
548 3300031712 Ga0265342_10003396 Ga0265342_1000339613 215
549 3300033180 Ga0307510_10108546 Ga0307510_101085462 215
550 3300033442 Ga0315911_1000005 Ga0315911_1000005189 215
551 3300035083 Ga0373926_0004957 Ga0373926_0004957_2304_3023 215
552 3300035089 Ga0373944_0003369 Ga0373944_0003369_2892_3611 215
553 3300035111 Ga0373923_0137980 Ga0373923_0137980_369_1088 215
554 3300035116 Ga0373945_0020207 Ga0373945_0020207_236_955 215
555 3300035170 Ga0373943_0006773 Ga0373943_0006773_683_1402 215
556 3300035171 Ga0373946_0003782 Ga0373946_0003782_1295_2014 215
557 3300035172 Ga0373955_0088679 Ga0373955_0088679_923_1642 215
558 3300035691 Ga0373931_0232386 Ga0373931_0232386_77_796 215
559 3300035695 Ga0373927_0127668 Ga0373927_0127668_161_880 215
560 3300035724 Ga0373933_0287642 Ga0373933_0287642_56_778 215
561 3300036401 Ga0373937_0069895 Ga0373937_0069895_695_1417 215
562 3300036401 Ga0373937_0240286 Ga0373937_0240286_182_904 215
563 3300037068 Ga0373925_0038880 Ga0373925_0038880_390_1109 215
564 3300037312 Ga0395899_0092194 Ga0395899_0092194_834_1568 215
565 3300037466 Ga0395898_0420009 Ga0395898_0420009_231_965 215
566 3300041459 Ga0451800_0183093 Ga0451800_0183093_146_865 215
567 3300046455 Ga0495603_0101268 Ga0495603_0101268_345_1064 215
568 3300046458 Ga0495591_049249 Ga0495591_049249_405_1124 215
569 3300046459 Ga0495629_0003519 Ga0495629_0003519_2174_2896 215
570 3300046459 Ga0495629_0058978 Ga0495629_0058978_1308_2027 215
571 3300046460 Ga0495638_0011267 Ga0495638_0011267_424_1146 215
572 3300046462 Ga0495651_0029243 Ga0495651_0029243_2820_3542 215
573 3300046462 Ga0495651_0077253 Ga0495651_0077253_600_1322 215
574 3300046471 Ga0495650_0048658 Ga0495650_0048658_420_1142 215
575 3300046475 Ga0495639_0014122 Ga0495639_0014122_1513_2232 215
576 3300046476 Ga0495662_0025954 Ga0495662_0025954_46_765 215
577 3300046491 Ga0495584_0022986 Ga0495584_0022986_434_1153 215
578 3300046491 Ga0495584_0186578 Ga0495584_0186578_238_960 215
579 3300046499 Ga0495594_0051286 Ga0495594_0051286_1121_1840 215
580 3300046515 Ga0495620_0051491 Ga0495620_0051491_472_1194 215
581 3300046518 Ga0495631_0141581 Ga0495631_0141581_58_777 215
582 3300046522 Ga0495643_0119948 Ga0495643_0119948_565_1284 215
583 3300046524 Ga0495648_0005796 Ga0495648_0005796_1828_2550 215
584 3300046524 Ga0495648_0006342 Ga0495648_0006342_810_1532 215
585 3300046524 Ga0495648_0130312 Ga0495648_0130312_192_914 215
586 3300046524 Ga0495648_0180898 Ga0495648_0180898_133_855 215
587 3300046543 Ga0495645_0397472 Ga0495645_0397472_28_747 215
588 3300046557 Ga0495622_0016125 Ga0495622_0016125_2262_2981 215
589 3300046558 Ga0495633_0104325 Ga0495633_0104325_227_946 215
590 3300046615 Ga0495656_0116660 Ga0495656_0116660_210_929 215
591 3300046615 Ga0495656_0150005 Ga0495656_0150005_169_888 215
592 3300046616 Ga0495668_0187246 Ga0495668_0187246_257_979 215
593 3300046642 Ga0495634_0095921 Ga0495634_0095921_1153_1872 215
594 3300046648 Ga0495611_0054223 Ga0495611_0054223_897_1619 215
595 3300046665 Ga0495661_0078682 Ga0495661_0078682_308_1030 215
596 3300046674 Ga0495588_0092409 Ga0495588_0092409_323_1042 215
597 3300046675 Ga0495657_0014532 Ga0495657_0014532_2097_2819 215
598 3300046679 Ga0495623_0078167 Ga0495623_0078167_539_1261 215
599 3300046680 Ga0495646_0171954 Ga0495646_0171954_453_1175 215
600 3300046680 Ga0495646_0212958 Ga0495646_0212958_170_889 215
601 3300046681 Ga0495647_0004011 Ga0495647_0004011_2478_3197 215
602 3300046683 Ga0495658_0039268 Ga0495658_0039268_1498_2217 215
603 3300046690 Ga0495624_0014569 Ga0495624_0014569_3197_3916 215
604 3300047315 Ga0495581_0175635 Ga0495581_0175635_96_815 215
605 3300047320 Ga0495672_0037854 Ga0495672_0037854_1363_2085 215
606 3300047321 Ga0495676_0078201 Ga0495676_0078201_176_895 215
607 3300047321 Ga0495676_0254294 Ga0495676_0254294_406_1125 215
608 3300047445 Ga0495677_0095652 Ga0495677_0095652_14_733 215
609 3300047673 Ga0495593_0042988 Ga0495593_0042988_1177_1899 215
610 3300048903 Ga0496100_0004974 Ga0496100_0004974_5039_5758 215
611 3300048903 Ga0496100_0079257 Ga0496100_0079257_1322_2044 215
612 3300048903 Ga0496100_0188935 Ga0496100_0188935_22_741 215
613 3300048905 Ga0496102_0026073 Ga0496102_0026073_2238_2957 215
614 3300048905 Ga0496102_0046145 Ga0496102_0046145_62_781 215
615 3300048905 Ga0496102_0578633 Ga0496102_0578633_309_1031 215
616 3300048905 Ga0496102_0730495 Ga0496102_0730495_55_777 215
617 3300048906 Ga0496103_0014250 Ga0496103_0014250_1933_2652 215
618 3300048906 Ga0496103_0020368 Ga0496103_0020368_2675_3394 215
619 3300048907 Ga0496104_0007659 Ga0496104_0007659_2567_3286 215
620 3300048907 Ga0496104_0013563 Ga0496104_0013563_962_1681 215
621 3300048907 Ga0496104_0089753 Ga0496104_0089753_1242_1964 215
622 3300048908 Ga0496105_0001737 Ga0496105_0001737_905_1624 215
623 3300048908 Ga0496105_0024603 Ga0496105_0024603_2470_3189 215
624 3300048908 Ga0496105_0030575 Ga0496105_0030575_2444_3166 215
625 3300048909 Ga0496106_0020734 Ga0496106_0020734_2723_3442 215
626 3300048909 Ga0496106_0027678 Ga0496106_0027678_1282_2001 215
627 3300048910 Ga0496107_0001885 Ga0496107_0001885_3307_4026 215
628 3300048911 Ga0496108_0004524 Ga0496108_0004524_7179_7898 215
629 3300048911 Ga0496108_0012004 Ga0496108_0012004_4336_5058 215
630 3300048911 Ga0496108_0027730 Ga0496108_0027730_1581_2300 215
631 3300048912 Ga0496109_0000334 Ga0496109_0000334_39917_40636 215
632 3300048912 Ga0496109_0029067 Ga0496109_0029067_560_1282 215
633 3300048912 Ga0496109_0070692 Ga0496109_0070692_805_1524 215
634 3300048913 Ga0496110_0003537 Ga0496110_0003537_2861_3580 215
635 3300048913 Ga0496110_0007586 Ga0496110_0007586_4533_5252 215
636 3300048913 Ga0496110_0015719 Ga0496110_0015719_5182_5904 215
637 3300048914 Ga0496111_0005043 Ga0496111_0005043_3704_4423 215
638 3300048914 Ga0496111_0076502 Ga0496111_0076502_1002_1721 215
639 3300048915 Ga0496112_0002098 Ga0496112_0002098_7927_8646 215
640 3300048915 Ga0496112_0070920 Ga0496112_0070920_472_1191 215
641 3300048915 Ga0496112_0132303 Ga0496112_0132303_1170_1892 215
642 3300048916 Ga0496113_0001458 Ga0496113_0001458_10954_11673 215
643 3300048916 Ga0496113_0051808 Ga0496113_0051808_1440_2159 215
644 3300048916 Ga0496113_0052310 Ga0496113_0052310_774_1496 215
645 3300048917 Ga0496114_0003383 Ga0496114_0003383_763_1482 215
646 3300048917 Ga0496114_0024979 Ga0496114_0024979_2074_2793 215
647 3300048917 Ga0496114_0035207 Ga0496114_0035207_2701_3423 215
648 3300048918 Ga0496115_0004993 Ga0496115_0004993_601_1320 215
649 3300048918 Ga0496115_0032960 Ga0496115_0032960_968_1690 215
650 3300048918 Ga0496115_0061736 Ga0496115_0061736_1064_1786 215
651 3300048918 Ga0496115_0192898 Ga0496115_0192898_689_1411 215
652 3300048919 Ga0496116_0001246 Ga0496116_0001246_3524_4246 215
653 3300048920 Ga0496117_0013506 Ga0496117_0013506_2004_2726 215
654 3300048920 Ga0496117_0169603 Ga0496117_0169603_447_1169 215
655 3300048921 Ga0496118_0045250 Ga0496118_0045250_36_758 215
656 3300048923 Ga0496120_0033190 Ga0496120_0033190_2014_2736 215
657 3300048924 Ga0496121_0055708 Ga0496121_0055708_1195_1917 215
658 3300048924 Ga0496121_0453996 Ga0496121_0453996_73_795 215
659 3300048925 Ga0496122_0132771 Ga0496122_0132771_153_875 215
660 3300048926 Ga0496123_0194890 Ga0496123_0194890_175_897 215
661 3300048928 Ga0496125_0010362 Ga0496125_0010362_3075_3797 215
662 3300048929 Ga0496126_0079669 Ga0496126_0079669_132_854 215
663 3300048929 Ga0496126_0168255 Ga0496126_0168255_588_1313 215
664 3300048929 Ga0496126_0181616 Ga0496126_0181616_77_799 215
665 3300048929 Ga0496126_0288515 Ga0496126_0288515_93_815 215
666 3300049572 Ga0501036_0347969 Ga0501036_0347969_420_1145 215
667 3300049573 Ga0501037_0269792 Ga0501037_0269792_66_797 215
668 3300049574 Ga0501038_0414373 Ga0501038_0414373_52_783 215
669 3300049575 Ga0501039_0240597 Ga0501039_0240597_657_1388 215
670 3300049579 Ga0501043_0205664 Ga0501043_0205664_160_882 215
671 3300049579 Ga0501043_0268155 Ga0501043_0268155_100_831 215
672 3300049580 Ga0501046_0029243 Ga0501046_0029243_1491_2213 215
673 3300049581 Ga0501047_0123187 Ga0501047_0123187_224_949 215
674 3300049586 Ga0501070_0118301 Ga0501070_0118301_1396_2136 215
675 3300049591 Ga0501075_0276160 Ga0501075_0276160_158_877 215
676 3300049592 Ga0501076_0153359 Ga0501076_0153359_153_872 215
677 3300049823 Ga0501044_0070676 Ga0501044_0070676_2440_3165 215
678 3300049823 Ga0501044_0848449 Ga0501044_0848449_23_754 215
679 3300050492 nmdc:mga0yw44_116848_c1 nmdc:mga0yw44_116848_c1_729_1448 215
680 3300050492 nmdc:mga0yw44_166163_c1 nmdc:mga0yw44_166163_c1_39_761 215
681 3300050492 nmdc:mga0yw44_65034_c1 nmdc:mga0yw44_65034_c1_1302_2024 215
682 3300050494 nmdc:mga06z11_12993_c1 nmdc:mga06z11_12993_c1_1591_2313 215
683 3300050495 nmdc:mga04h51_29132_c1 nmdc:mga04h51_29132_c1_928_1647 215
684 3300050507 nmdc:mga05p37_31595_c1 nmdc:mga05p37_31595_c1_3467_4186 215
685 3300050511 nmdc:mga08y16_140643_c1 nmdc:mga08y16_140643_c1_1184_1903 215
686 3300050512 nmdc:mga0n895_36988_c1 nmdc:mga0n895_36988_c1_734_1453 215
687 3300050516 nmdc:mga0sz30_111989_c1 nmdc:mga0sz30_111989_c1_432_1154 215
688 3300053080 Ga0500635_0006652 Ga0500635_0006652_621_1343 215
689 3300053085 Ga0495619_0256637 Ga0495619_0256637_177_896 215
690 3300053086 Ga0500578_0075763 Ga0500578_0075763_190_912 215
691 3300053087 Ga0500643_000028 Ga0500643_000028_164657_165379 215
692 3300053092 Ga0500583_0022614 Ga0500583_0022614_866_1588 215
693 3300053093 Ga0500651_0038098 Ga0500651_0038098_1508_2230 215
694 3300053094 Ga0500566_0000245 Ga0500566_0000245_4877_5599 215
695 3300053096 Ga0500641_0134635 Ga0500641_0134635_133_855 215
696 3300053098 Ga0500650_0112593 Ga0500650_0112593_386_1108 215
697 3300053103 Ga0500555_002075 Ga0500555_002075_1043_1765 215
698 3300053111 Ga0500572_004309 Ga0500572_004309_188_925 215
699 3300053111 Ga0500572_004788 Ga0500572_004788_2251_2973 215
700 3300053122 Ga0500608_061852 Ga0500608_061852_617_1339 215
701 3300053130 Ga0500642_0001807 Ga0500642_0001807_2986_3708 215
702 3300053134 Ga0500658_0030694 Ga0500658_0030694_908_1630 215
703 3300053136 Ga0500559_0000103 Ga0500559_0000103_16087_16824 215
704 3300053139 Ga0500568_0008444 Ga0500568_0008444_507_1229 215
705 3300053142 Ga0500577_0061990 Ga0500577_0061990_365_1087 215
706 3300053151 Ga0500604_0006950 Ga0500604_0006950_2073_2795 215
707 3300053153 Ga0500616_0029749 Ga0500616_0029749_441_1163 215
708 3300053155 Ga0500620_055743 Ga0500620_055743_29_751 215
709 3300053156 Ga0500622_0041342 Ga0500622_0041342_168_890 215
710 3300053158 Ga0500627_0022685 Ga0500627_0022685_752_1474 215
711 3300053162 Ga0500638_058212 Ga0500638_058212_943_1665 215
712 3300053177 Ga0500636_0000054 Ga0500636_0000054_44352_45074 215
713 3300053725 Ga0500576_037237 Ga0500576_037237_913_1650 215
714 3300053737 Ga0500601_000834 Ga0500601_000834_801_1523 215
715 iso_pu_bacteria 2599185156 2599335179 215
716 iso_pu_bacteria 2842922631 2842926366 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04172

LrgB

LrgB-like family

32

240

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pqg-assembly1.cif.gz_A structure of thermostabilised human ntcp in complex with nanobody 87 0.3402 93 206
5a1s-assembly2.cif.gz_A crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. 0.3341 21 185
4mc3-assembly1.cif.gz_A hedycaryol synthase in complex with nerolidol 0.3321 128 200
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.3246 105 200
5x9r-assembly1.cif.gz_A structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.3185 25 185
ID Description Score Start End Superfamily
af_Q10PQ9_270_370_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4735 105 171 1.10.472.10
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3732 9 213 1.20.1530.20
1j1jD02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.3705 1 91 1.20.58.200
1j1jD02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.3628 1 91 1.20.58.200
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3587 9 213 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A554X5Y9-F1-model_v4 Inner membrane protein YohK 0.6495 100 214 GO:0016020
AF-A0A2S5DLV4-F1-model_v4 LrgB family protein 0.5986 12 109 GO:0016020
AF-A0A7I0KM18-F1-model_v4 deleted 0.5933 118 213
AF-A0A0B0HMT7-F1-model_v4 deleted 0.5779 114 213
AF-A0A259LQD4-F1-model_v4 LrgB family protein 0.5768 1 103 GO:0016020

Feature Viewer

pLDDT pTM Quality
69 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map