F477100

General Info

Members Datasets Scaffolds Average Seq Length
717 307 1435 367

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10015760|Ga0105237_100157603
Length 415
Sequence MQLSACRHPNVLIILFINFIHSRNDCPAAFTIAALRFIKTFSNTKNPVTMSLTSRREVLKTLALASGAACFSPNVLLAATRRKKEKLGIALVGLGYYSTDLLSPALQQTKNCYLAGIVTGTPAKAEAWKAKYNIPDKNIYNYESFDKIANNDDIDVIYVVLPPSMHKEYVIRAANAGKHVFCEKPMAITAVECKAMIDACNKNKRSLAIGYRLHHEPNTQEYTRIINNKLLGKVKKMSCAAGYTENRTNHWKQKKEMGGGVLYDMGVYAIQGARLGTGMEPVEIVSAKTSTTRPEIYKNGLDETTVAQLEFPGGVLADIKTSFGENINFLTVNCEKGDIKMEPYSGYNGLQGSSPLGSINYPYDVPWQQAKQLDDDTMAIMQGKPMLVPGEEGLRDIRIVEAIYKCAGSGQRVTI

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
207 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
208 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
209 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
215 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
216 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
268 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
269 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
270 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
271 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
272 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
280 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
291 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
301 2738541278 Niastella sp. CF465 Isolate Unclassified
302 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
303 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
304 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
305 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
306 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
307 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0.14
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 0.98
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10015760 3300009545 Bacteria 7860
2 JGI24739J22299_10007776 3300001989 Bacteria 4011
3 JGI25153J46596_10000766 3300003215 Bacteria 19670
4 JGI25153J46596_10018149 3300003215 Bacteria 2743
5 rootH1_10033439 3300003316 Bacteria 30115
6 rootH2_10010010 3300003320 Bacteria 6137
7 rootH2_10217225 3300003320 Bacteria 3628
8 rootL2_10005471 3300003322 Bacteria 3464
9 rootL2_10058065 3300003322 Bacteria 10287
10 rootL2_10068274 3300003322 Bacteria 19040
11 rootL2_10077131 3300003322 Bacteria 2174
12 rootL2_10155085 3300003322 Bacteria 6787
13 rootL2_10235208 3300003322 Bacteria 5534
14 rootL2_10282538 3300003322 Archaea 2105
15 rootL2_10302482 3300003322 Unclassified 2801
16 rootH1_10003268 3300003323 Bacteria 19976
17 rootH1_10008265 3300003323 Bacteria 10217
18 rootH1_10011937 3300003316 Bacteria 5065
19 rootH1_10011937 3300003323 Bacteria 7280
20 rootH1_10023828 3300003323 Bacteria 9527
21 rootH1_10096985 3300003323 Bacteria 3864
22 rootH1_10102452 3300003323 Bacteria 4655
23 rootH1_10105715 3300003323 Bacteria 2411
24 rootH1_10119811 3300003323 Bacteria 7048
25 rootH1_10387958 3300003323 Unclassified 1660
26 JGI25160J50197_1000863 3300003354 Bacteria 16119
27 JGI25160J50197_1021239 3300003354 Bacteria 1936
28 Ga0055526_1018304 3300003771 Bacteria 2620
29 Ga0055528_1002478 3300003790 Bacteria 9868
30 Ga0055530_10009262 3300003791 Bacteria 3812
31 Ga0055531_10000435 3300003794 Bacteria 39538
32 Ga0058863_11707405 3300004799 Bacteria 2848
33 Ga0065165_1000043 3300005262 Bacteria 203850
34 Ga0065165_1000219 3300005262 Bacteria 100119
35 Ga0065712_10145165 3300005290 Bacteria 1415
36 Ga0070658_10081100 3300005327 Bacteria 2665
37 Ga0070676_10198100 3300005328 Bacteria 1315
38 Ga0070683_100074968 3300005329 Unclassified 3160
39 Ga0070683_100340248 3300005329 Bacteria 1429
40 Ga0070690_100009302 3300005330 Bacteria 5689
41 Ga0070670_100032495 3300005331 Bacteria 4494
42 Ga0070670_100133952 3300005331 Unclassified 2141
43 Ga0070670_100156661 3300005331 Bacteria 1973
44 Ga0070677_10000400 3300005333 Bacteria 15144
45 Ga0068869_100015239 3300005334 Bacteria 5152
46 Ga0068869_100017422 3300005334 Bacteria 4868
47 Ga0068869_100021471 3300005334 Unclassified 4442
48 Ga0068869_100042642 3300005334 Bacteria 3254
49 Ga0068869_100239344 3300005334 Bacteria 1445
50 Ga0070666_10000138 3300005335 Bacteria 50719
51 Ga0070666_10045688 3300005335 Bacteria 2936
52 Ga0070680_100072172 3300005336 Unclassified 2837
53 Ga0070682_100037733 3300005337 Bacteria 2960
54 Ga0070682_100158626 3300005337 Bacteria 1560
55 Ga0068868_100002592 3300005338 Bacteria 12529
56 Ga0068868_100014395 3300005338 Bacteria 5831
57 Ga0068868_100080951 3300005338 Bacteria 2603
58 Ga0068868_100083152 3300005338 Unclassified 2569
59 Ga0068868_100165677 3300005338 Bacteria 1828
60 Ga0068868_100182786 3300005338 Bacteria 1740
61 Ga0070660_100128464 3300005339 Bacteria 2026
62 Ga0070660_100136450 3300005339 Bacteria 1966
63 Ga0070689_100000797 3300005340 Bacteria 19388
64 Ga0070689_100057636 3300005340 Bacteria 3015
65 Ga0070689_100140712 3300005340 Bacteria 1940
66 Ga0070689_100345343 3300005340 Bacteria 1247
67 Ga0070687_100082748 3300005343 Unclassified 1756
68 Ga0070661_100010000 3300005344 Bacteria 6583
69 Ga0070668_100052230 3300005347 Unclassified 3150
70 Ga0070668_100063629 3300005347 Bacteria 2860
71 Ga0070668_100069315 3300005347 Bacteria 2743
72 Ga0070668_100193559 3300005347 Bacteria 1666
73 Ga0070669_100028232 3300005353 Bacteria 4041
74 Ga0070669_100037494 3300005353 Bacteria 3517
75 Ga0070675_100006161 3300005354 Bacteria 9195
76 Ga0070675_100080373 3300005354 Bacteria 2717
77 Ga0070675_100130221 3300005354 Bacteria 2143
78 Ga0070671_100164849 3300005355 Bacteria 1874
79 Ga0070674_100009539 3300005356 Bacteria 5813
80 Ga0070674_100051483 3300005356 Bacteria 2838
81 Ga0070674_100083274 3300005356 Unclassified 2290
82 Ga0070674_100099853 3300005356 Bacteria 2112
83 Ga0070674_100141716 3300005356 Bacteria 1804
84 Ga0070673_100012837 3300005364 Bacteria 5767
85 Ga0070673_100014554 3300005364 Bacteria 5485
86 Ga0070673_100047596 3300005364 Bacteria 3337
87 Ga0070673_100375445 3300005364 Bacteria 1267
88 Ga0070688_100036747 3300005365 Unclassified 2980
89 Ga0070688_100077384 3300005365 Unclassified 2143
90 Ga0070659_100010682 3300005366 Bacteria 6763
91 Ga0070659_100032648 3300005366 Unclassified 4039
92 Ga0070659_100049299 3300005366 Bacteria 3311
93 Ga0070667_100001467 3300005367 Bacteria 21123
94 Ga0070667_100145082 3300005367 Bacteria 2081
95 Ga0070700_100048188 3300005441 Bacteria 2640
96 Ga0070700_100112425 3300005441 Bacteria 1813
97 Ga0070678_100048685 3300005456 Bacteria 3054
98 Ga0070678_100204861 3300005456 Bacteria 1631
99 Ga0070678_100224535 3300005456 Bacteria 1563
100 Ga0070678_100341033 3300005456 Unclassified 1285
101 Ga0070662_100066547 3300005457 Bacteria 2644
102 Ga0070681_10043616 3300005458 Unclassified 4491
103 Ga0068867_100009217 3300005459 Bacteria 6968
104 Ga0068867_100026116 3300005459 Bacteria 4192
105 Ga0068867_100252211 3300005459 Bacteria 1435
106 Ga0070685_10022566 3300005466 Bacteria 3432
107 Ga0070685_10034947 3300005466 Bacteria 2834
108 Ga0070699_100107997 3300005518 Bacteria 2442
109 Ga0070679_100032976 3300005530 Bacteria 5125
110 Ga0070684_100002054 3300005535 Bacteria 14821
111 Ga0070684_100043586 3300005535 Bacteria 3875
112 Ga0070684_100290550 3300005535 Bacteria 1499
113 Ga0068853_100048688 3300005539 Unclassified 3642
114 Ga0068853_100070352 3300005539 Bacteria 3046
115 Ga0068853_100232818 3300005539 Bacteria 1686
116 Ga0070672_100036103 3300005543 Bacteria 3763
117 Ga0070672_100045621 3300005543 Bacteria 3391
118 Ga0070672_100061580 3300005543 Bacteria 2959
119 Ga0070672_100211327 3300005543 Unclassified 1625
120 Ga0070672_100261311 3300005543 Bacteria 1460
121 Ga0070686_100058855 3300005544 Bacteria 2474
122 Ga0070696_100172879 3300005546 Bacteria 1598
123 Ga0070693_100043222 3300005547 Bacteria 2544
124 Ga0070665_100000016 3300005548 Bacteria 451538
125 Ga0070665_100003454 3300005548 Bacteria 16836
126 Ga0070665_100052967 3300005548 Bacteria 4070
127 Ga0070665_100362309 3300005548 Bacteria 1456
128 Ga0070704_100258070 3300005549 Bacteria 1434
129 Ga0068855_100002311 3300005563 Bacteria 23570
130 Ga0068855_100013738 3300005563 Bacteria 9760
131 Ga0068855_100076505 3300005563 Unclassified 3884
132 Ga0068855_100226959 3300005563 Unclassified 2093
133 Ga0070664_100011247 3300005564 Bacteria 7260
134 Ga0070664_100013959 3300005564 Bacteria 6550
135 Ga0070664_100182491 3300005564 Bacteria 1866
136 Ga0068857_100103626 3300005577 Bacteria 2554
137 Ga0068857_100216660 3300005577 Bacteria 1748
138 Ga0068854_100028862 3300005578 Unclassified 3837
139 Ga0070702_100002295 3300005615 Bacteria 8198
140 Ga0070702_100013127 3300005615 Bacteria 4174
141 Ga0068852_100062071 3300005616 Bacteria 3249
142 Ga0068852_100433798 3300005616 Bacteria 1298
143 Ga0068859_100000086 3300005617 Bacteria 85696
144 Ga0068859_100019258 3300005617 Bacteria 6857
145 Ga0068859_100058356 3300005617 Bacteria 3887
146 Ga0068859_100328809 3300005617 Bacteria 1623
147 Ga0068864_100013839 3300005618 Bacteria 6685
148 Ga0068864_100017294 3300005618 Bacteria 6010
149 Ga0068864_100053363 3300005618 Bacteria 3487
150 Ga0068864_100074765 3300005618 Unclassified 2956
151 Ga0068866_10049789 3300005718 Bacteria 2125
152 Ga0068866_10053909 3300005718 Bacteria 2058
153 Ga0068866_10054269 3300005718 Bacteria 2053
154 Ga0068861_100003410 3300005719 Bacteria 10545
155 Ga0068861_100003537 3300005719 Bacteria 10386
156 Ga0068861_100033659 3300005719 Unclassified 3783
157 Ga0068861_100046232 3300005719 Bacteria 3281
158 Ga0068861_100057903 3300005719 Bacteria 2961
159 Ga0068861_100086968 3300005719 Bacteria 2458
160 Ga0068861_100413759 3300005719 Bacteria 1200
161 Ga0068851_10005291 3300005834 Bacteria 5857
162 Ga0068870_10029303 3300005840 Bacteria 2771
163 Ga0068863_100009150 3300005841 Bacteria 9667
164 Ga0068863_100010890 3300005841 Bacteria 8818
165 Ga0068863_100017951 3300005841 Bacteria 6771
166 Ga0068863_100041315 3300005841 Bacteria 4384
167 Ga0068863_100124869 3300005841 Bacteria 2455
168 Ga0068863_100128733 3300005841 Bacteria 2416
169 Ga0068863_100301641 3300005841 Bacteria 1554
170 Ga0068858_100017405 3300005842 Bacteria 6742
171 Ga0068860_100000006 3300005843 Bacteria 461966
172 Ga0068860_100002840 3300005843 Bacteria 17998
173 Ga0068860_100012354 3300005843 Bacteria 8413
174 Ga0068860_100024871 3300005843 Bacteria 5781
175 Ga0068860_100085545 3300005843 Bacteria 3001
176 Ga0068860_100154901 3300005843 Bacteria 2208
177 Ga0068860_100205263 3300005843 Unclassified 1911
178 Ga0068862_100013075 3300005844 Bacteria 6866
179 Ga0068862_100188425 3300005844 Bacteria 1855
180 Ga0068862_100360587 3300005844 Bacteria 1351
181 Ga0081455_10008109 3300005937 Bacteria 10962
182 Ga0081539_10000816 3300005985 Bacteria 60353
183 Ga0081539_10008031 3300005985 Bacteria 9351
184 Ga0075364_10000088 3300006051 Bacteria 36693
185 Ga0075366_10070479 3300006195 Unclassified 2082
186 Ga0097621_100006601 3300006237 Bacteria 8240
187 Ga0097621_100008063 3300006237 Bacteria 7563
188 Ga0097621_100029627 3300006237 Bacteria 4325
189 Ga0097621_100070868 3300006237 Unclassified 2879
190 Ga0097621_100110567 3300006237 Bacteria 2321
191 Ga0097621_100115064 3300006237 Bacteria 2276
192 Ga0068871_100001606 3300006358 Bacteria 15201
193 Ga0068871_100019167 3300006358 Bacteria 5221
194 Ga0068871_100028555 3300006358 Bacteria 4374
195 Ga0068871_100177883 3300006358 Bacteria 1827
196 Ga0068871_100206891 3300006358 Bacteria 1696
197 Ga0068871_100215039 3300006358 Bacteria 1664
198 Ga0068871_100229040 3300006358 Bacteria 1612
199 Ga0068871_100259740 3300006358 Bacteria 1515
200 Ga0075428_100013628 3300006844 Bacteria 9053
201 Ga0075428_100045822 3300006844 Bacteria 4805
202 Ga0075428_100106726 3300006844 Bacteria 3053
203 Ga0075428_100186233 3300006844 Bacteria 2246
204 Ga0075428_100199519 3300006844 Bacteria 2163
205 Ga0075430_100014626 3300006846 Bacteria 6684
206 Ga0075431_100014855 3300006847 Bacteria 7882
207 Ga0075431_100018946 3300006847 Bacteria 7012
208 Ga0075429_100000105 3300006880 Bacteria 47284
209 Ga0075429_100000606 3300006880 Bacteria 27574
210 Ga0075429_100181704 3300006880 Unclassified 1843
211 Ga0068865_100028700 3300006881 Bacteria 3685
212 Ga0068865_100045075 3300006881 Bacteria 3022
213 Ga0068865_100130124 3300006881 Bacteria 1885
214 Ga0068865_100130575 3300006881 Bacteria 1882
215 Ga0097620_100000086 3300006931 Bacteria 85696
216 Ga0097620_100019258 3300006931 Bacteria 6857
217 Ga0097620_100058359 3300006931 Bacteria 3887
218 Ga0097620_100328781 3300006931 Bacteria 1623
219 Ga0105240_10000328 3300009093 Bacteria 89466
220 Ga0105240_10008271 3300009093 Bacteria 14892
221 Ga0105240_10016663 3300009093 Bacteria 9940
222 Ga0105240_10023977 3300009093 Bacteria 8060
223 Ga0105240_10039408 3300009093 Bacteria 6050
224 Ga0111539_10005241 3300009094 Bacteria 16795
225 Ga0111539_10012104 3300009094 Bacteria 10823
226 Ga0111539_10033434 3300009094 Bacteria 6242
227 Ga0111539_10057540 3300009094 Bacteria 4616
228 Ga0111539_10446284 3300009094 Bacteria 1506
229 Ga0105247_10004124 3300009101 Bacteria 9325
230 Ga0114129_10002392 3300009147 Bacteria 26071
231 Ga0114129_10055251 3300009147 Bacteria 5566
232 Ga0114129_10112735 3300009147 Bacteria 3750
233 Ga0105243_10069969 3300009148 Unclassified 2832
234 Ga0105243_10125853 3300009148 Bacteria 2168
235 Ga0105241_10000403 3300009174 Bacteria 32619
236 Ga0105241_10001753 3300009174 Bacteria 16461
237 Ga0105241_10097566 3300009174 Bacteria 2330
238 Ga0105241_10175695 3300009174 Bacteria 1772
239 Ga0105241_10196839 3300009174 Bacteria 1681
240 Ga0105242_10238637 3300009176 Unclassified 1633
241 Ga0105242_10271125 3300009176 Unclassified 1537
242 Ga0105248_10665160 3300009177 Unclassified 1175
243 Ga0105237_10002164 3300009545 Bacteria 24675
244 Ga0105237_10002660 3300009545 Bacteria 21961
245 Ga0105237_10007945 3300009545 Bacteria 11560
246 Ga0105237_10018209 3300009545 Bacteria 7269
247 Ga0105237_10036552 3300009545 Bacteria 4971
248 Ga0105237_10068168 3300009545 Bacteria 3552
249 Ga0105237_10113106 3300009545 Bacteria 2707
250 Ga0105238_10127922 3300009551 Bacteria 2518
251 Ga0105238_10286858 3300009551 Bacteria 1628
252 Ga0105249_10009844 3300009553 Bacteria 8378
253 Ga0105249_10013748 3300009553 Bacteria 7148
254 Ga0105249_10101072 3300009553 Bacteria 2712
255 Ga0105249_10168166 3300009553 Bacteria 2124
256 Ga0105249_10218971 3300009553 Bacteria 1872
257 Ga0105239_10000101 3300010375 Bacteria 119610
258 Ga0105239_10005300 3300010375 Bacteria 15146
259 Ga0105239_10015372 3300010375 Bacteria 8479
260 Ga0105239_10020208 3300010375 Bacteria 7346
261 Ga0105239_10023231 3300010375 Bacteria 6833
262 Ga0105239_10478336 3300010375 Bacteria 1415
263 Ga0105246_10007061 3300011119 Bacteria 6875
264 Ga0105246_10018901 3300011119 Bacteria 4395
265 Ga0105246_10033670 3300011119 Bacteria 3408
266 Ga0157373_10003137 3300013100 Bacteria 12489
267 Ga0157373_10019920 3300013100 Bacteria 4880
268 Ga0157373_10038045 3300013100 Unclassified 3448
269 Ga0157371_10182197 3300013102 Bacteria 1502
270 Ga0157370_10015201 3300013104 Bacteria 7838
271 Ga0157370_10015874 3300013104 Bacteria 7641
272 Ga0157369_10029201 3300013105 Bacteria 6096
273 Ga0157369_10036494 3300013105 Bacteria 5384
274 Ga0157374_10000029 3300013296 Bacteria 211547
275 Ga0157374_10002518 3300013296 Bacteria 15459
276 Ga0157374_10009357 3300013296 Bacteria 8407
277 Ga0157374_10022675 3300013296 Bacteria 5603
278 Ga0157374_10228827 3300013296 Bacteria 1826
279 Ga0157374_10229327 3300013296 Unclassified 1824
280 Ga0157374_10274678 3300013296 Bacteria 1662
281 Ga0157374_10457765 3300013296 Unclassified 1278
282 Ga0157378_10002981 3300013297 Bacteria 15034
283 Ga0157378_10014684 3300013297 Bacteria 6861
284 Ga0157378_10036566 3300013297 Bacteria 4346
285 Ga0157378_10045202 3300013297 Bacteria 3912
286 Ga0157378_10062832 3300013297 Bacteria 3317
287 Ga0157378_10195028 3300013297 Unclassified 1913
288 Ga0157378_10279760 3300013297 Unclassified 1608
289 Ga0163162_10000355 3300013306 Bacteria 41762
290 Ga0163162_10003500 3300013306 Bacteria 15011
291 Ga0163162_10006493 3300013306 Bacteria 11324
292 Ga0163162_10032916 3300013306 Bacteria 5149
293 Ga0163162_10101459 3300013306 Bacteria 2969
294 Ga0163162_10190355 3300013306 Bacteria 2179
295 Ga0163162_10236468 3300013306 Bacteria 1957
296 Ga0157372_10006751 3300013307 Bacteria 12201
297 Ga0157372_10035569 3300013307 Bacteria 5484
298 Ga0157372_10105613 3300013307 Bacteria 3221
299 Ga0157372_10220850 3300013307 Bacteria 2197
300 Ga0157372_10235796 3300013307 Bacteria 2122
301 Ga0157375_10000207 3300013308 Bacteria 54636
302 Ga0157375_10046071 3300013308 Bacteria 4249
303 Ga0157375_10066270 3300013308 Bacteria 3604
304 Ga0157375_10106141 3300013308 Bacteria 2900
305 Ga0157375_10127200 3300013308 Bacteria 2664
306 Ga0157375_10142343 3300013308 Bacteria 2526
307 Ga0157375_10159336 3300013308 Unclassified 2398
308 Ga0157375_10167901 3300013308 Bacteria 2340
309 Ga0157375_10184107 3300013308 Bacteria 2241
310 Ga0157375_10235105 3300013308 Bacteria 1992
311 Ga0163163_10075457 3300014325 Bacteria 3365
312 Ga0163163_10177947 3300014325 Unclassified 2174
313 Ga0163163_10192403 3300014325 Bacteria 2088
314 Ga0157380_10000443 3300014326 Bacteria 25341
315 Ga0157380_10002654 3300014326 Bacteria 12120
316 Ga0157380_10011948 3300014326 Bacteria 6282
317 Ga0157380_10013569 3300014326 Bacteria 5948
318 Ga0157380_10048129 3300014326 Bacteria 3357
319 Ga0157380_10172883 3300014326 Bacteria 1890
320 Ga0157380_10178839 3300014326 Unclassified 1862
321 Ga0157380_10261892 3300014326 Bacteria 1571
322 Ga0157380_10450270 3300014326 Bacteria 1236
323 Ga0157377_10025096 3300014745 Bacteria 3176
324 Ga0157377_10072696 3300014745 Bacteria 1991
325 Ga0157379_10024379 3300014968 Bacteria 5371
326 Ga0157379_10216518 3300014968 Bacteria 1735
327 Ga0157379_10323816 3300014968 Bacteria 1407
328 Ga0157379_10329740 3300014968 Unclassified 1394
329 Ga0157376_10002108 3300014969 Bacteria 13383
330 Ga0157376_10021073 3300014969 Bacteria 5057
331 Ga0157376_10088629 3300014969 Bacteria 2673
332 Ga0157376_10164905 3300014969 Bacteria 2012
333 Ga0157376_10311592 3300014969 Bacteria 1493
334 Ga0157376_10330992 3300014969 Bacteria 1451
335 Ga0182005_1000280 3300015265 Bacteria 32088
336 Ga0163161_10004389 3300017792 Bacteria 9834
337 Ga0163161_10004778 3300017792 Bacteria 9431
338 Ga0163161_10144685 3300017792 Bacteria 1802
339 Ga0213876_10005477 3300021384 Bacteria 6969
340 Ga0209436_101063 3300025208 Bacteria 10401
341 Ga0209646_1000003 3300025246 Bacteria 1160860
342 Ga0209646_1001862 3300025246 Bacteria 5193
343 Ga0209026_1000614 3300025250 Bacteria 22834
344 Ga0209673_1000962 3300025273 Bacteria 35913
345 Ga0209676_1000584 3300025292 Bacteria 54694
346 Ga0209564_1003078 3300025295 Bacteria 11823
347 Ga0209758_1002110 3300025297 Bacteria 21061
348 Ga0209758_1011568 3300025297 Bacteria 5085
349 Ga0209050_1000561 3300025298 Bacteria 60726
350 Ga0207426_1000093 3300025302 Bacteria 277663
351 Ga0207426_1000187 3300025302 Bacteria 153809
352 Ga0207426_1015489 3300025302 Bacteria 2761
353 Ga0209257_1000005 3300025304 Bacteria 1592528
354 Ga0209257_1010390 3300025304 Bacteria 4720
355 Ga0207682_10013064 3300025893 Bacteria 3237
356 Ga0207682_10069148 3300025893 Bacteria 1493
357 Ga0207642_10016957 3300025899 Bacteria 2758
358 Ga0207642_10078093 3300025899 Bacteria 1599
359 Ga0207688_10014165 3300025901 Bacteria 4338
360 Ga0207680_10193039 3300025903 Bacteria 1383
361 Ga0207647_10020994 3300025904 Bacteria 4367
362 Ga0207645_10000193 3300025907 Bacteria 49552
363 Ga0207645_10000279 3300025907 Bacteria 42459
364 Ga0207645_10001124 3300025907 Bacteria 22129
365 Ga0207645_10007389 3300025907 Bacteria 7770
366 Ga0207643_10002695 3300025908 Bacteria 9596
367 Ga0207643_10008261 3300025908 Bacteria 5588
368 Ga0207643_10022145 3300025908 Bacteria 3497
369 Ga0207643_10022803 3300025908 Bacteria 3450
370 Ga0207643_10038307 3300025908 Bacteria 2692
371 Ga0207654_10028214 3300025911 Bacteria 3059
372 Ga0207695_10001513 3300025913 Bacteria 38611
373 Ga0207695_10002144 3300025913 Bacteria 29897
374 Ga0207695_10044421 3300025913 Unclassified 4726
375 Ga0207695_10046762 3300025913 Bacteria 4584
376 Ga0207695_10137474 3300025913 Bacteria 2395
377 Ga0207671_10002804 3300025914 Bacteria 18168
378 Ga0207671_10003963 3300025914 Bacteria 14397
379 Ga0207671_10005605 3300025914 Bacteria 11520
380 Ga0207671_10008668 3300025914 Bacteria 8586
381 Ga0207671_10019962 3300025914 Bacteria 5111
382 Ga0207671_10025430 3300025914 Bacteria 4447
383 Ga0207671_10130845 3300025914 Bacteria 1926
384 Ga0207662_10049696 3300025918 Bacteria 2488
385 Ga0207657_10005188 3300025919 Bacteria 13665
386 Ga0207657_10092518 3300025919 Bacteria 2520
387 Ga0207657_10167202 3300025919 Bacteria 1783
388 Ga0207649_10068462 3300025920 Bacteria 2257
389 Ga0207649_10112130 3300025920 Bacteria 1824
390 Ga0207652_10000093 3300025921 Bacteria 98248
391 Ga0207681_10018827 3300025923 Bacteria 4355
392 Ga0207681_10122224 3300025923 Bacteria 1911
393 Ga0207681_10258681 3300025923 Bacteria 1362
394 Ga0207694_10206118 3300025924 Bacteria 1601
395 Ga0207650_10106496 3300025925 Bacteria 2165
396 Ga0207659_10006163 3300025926 Bacteria 7334
397 Ga0207659_10031482 3300025926 Unclassified 3632
398 Ga0207659_10283410 3300025926 Bacteria 1355
399 Ga0207659_10300091 3300025926 Bacteria 1319
400 Ga0207700_10078365 3300025928 Bacteria 2570
401 Ga0207690_10014232 3300025932 Bacteria 4801
402 Ga0207706_10037886 3300025933 Bacteria 4279
403 Ga0207706_10082970 3300025933 Unclassified 2817
404 Ga0207686_10002379 3300025934 Bacteria 10261
405 Ga0207686_10175111 3300025934 Bacteria 1516
406 Ga0207670_10002207 3300025936 Bacteria 10177
407 Ga0207670_10034377 3300025936 Bacteria 3275
408 Ga0207670_10280269 3300025936 Bacteria 1299
409 Ga0207669_10019354 3300025937 Unclassified 3543
410 Ga0207704_10013780 3300025938 Bacteria 4061
411 Ga0207704_10062827 3300025938 Bacteria 2311
412 Ga0207704_10072127 3300025938 Bacteria 2194
413 Ga0207704_10124733 3300025938 Unclassified 1770
414 Ga0207704_10159396 3300025938 Bacteria 1604
415 Ga0207691_10020637 3300025940 Bacteria 6228
416 Ga0207691_10033523 3300025940 Unclassified 4780
417 Ga0207691_10034558 3300025940 Bacteria 4700
418 Ga0207691_10063680 3300025940 Bacteria 3344
419 Ga0207691_10065070 3300025940 Bacteria 3302
420 Ga0207691_10066517 3300025940 Bacteria 3260
421 Ga0207691_10078777 3300025940 Unclassified 2966
422 Ga0207691_10107322 3300025940 Bacteria 2486
423 Ga0207689_10001574 3300025942 Bacteria 21618
424 Ga0207689_10005101 3300025942 Bacteria 11812
425 Ga0207689_10006249 3300025942 Bacteria 10556
426 Ga0207689_10016558 3300025942 Bacteria 6239
427 Ga0207689_10027543 3300025942 Bacteria 4755
428 Ga0207689_10029959 3300025942 Bacteria 4538
429 Ga0207689_10041176 3300025942 Bacteria 3822
430 Ga0207689_10046666 3300025942 Bacteria 3580
431 Ga0207689_10051265 3300025942 Bacteria 3402
432 Ga0207689_10114379 3300025942 Bacteria 2218
433 Ga0207661_10016817 3300025944 Bacteria 5400
434 Ga0207661_10017076 3300025944 Bacteria 5362
435 Ga0207661_10050302 3300025944 Bacteria 3320
436 Ga0207679_10006182 3300025945 Bacteria 7560
437 Ga0207679_10040417 3300025945 Bacteria 3338
438 Ga0207679_10298365 3300025945 Bacteria 1388
439 Ga0207667_10003174 3300025949 Bacteria 20328
440 Ga0207667_10134411 3300025949 Bacteria 2547
441 Ga0207667_10211102 3300025949 Unclassified 1990
442 Ga0207651_10011488 3300025960 Bacteria 4961
443 Ga0207651_10037260 3300025960 Bacteria 3185
444 Ga0207651_10099594 3300025960 Unclassified 2153
445 Ga0207712_10007096 3300025961 Bacteria 7066
446 Ga0207712_10008345 3300025961 Bacteria 6543
447 Ga0207712_10064471 3300025961 Bacteria 2612
448 Ga0207712_10349203 3300025961 Bacteria 1229
449 Ga0207668_10032790 3300025972 Bacteria 3437
450 Ga0207640_10201131 3300025981 Bacteria 1510
451 Ga0207658_10008348 3300025986 Bacteria 7052
452 Ga0207677_10193738 3300026023 Bacteria 1610
453 Ga0207703_10013272 3300026035 Bacteria 6417
454 Ga0207639_10036027 3300026041 Unclassified 3664
455 Ga0207639_10185266 3300026041 Bacteria 1774
456 Ga0207678_10016529 3300026067 Bacteria 6479
457 Ga0207708_10014031 3300026075 Bacteria 5985
458 Ga0207708_10030440 3300026075 Bacteria 4092
459 Ga0207708_10050880 3300026075 Bacteria 3154
460 Ga0207702_10011501 3300026078 Bacteria 7373
461 Ga0207702_10146011 3300026078 Bacteria 2146
462 Ga0207702_10229277 3300026078 Bacteria 1735
463 Ga0207641_10000061 3300026088 Bacteria 160161
464 Ga0207641_10001165 3300026088 Bacteria 26454
465 Ga0207641_10107164 3300026088 Bacteria 2471
466 Ga0207641_10409354 3300026088 Bacteria 1304
467 Ga0207648_10004327 3300026089 Bacteria 14627
468 Ga0207648_10007665 3300026089 Bacteria 10566
469 Ga0207648_10066730 3300026089 Bacteria 3137
470 Ga0207648_10077588 3300026089 Unclassified 2896
471 Ga0207648_10099073 3300026089 Bacteria 2552
472 Ga0207648_10198308 3300026089 Bacteria 1780
473 Ga0207648_10203134 3300026089 Bacteria 1758
474 Ga0207676_10012851 3300026095 Bacteria 6012
475 Ga0207676_10265381 3300026095 Bacteria 1552
476 Ga0207674_10006014 3300026116 Bacteria 14353
477 Ga0207674_10069011 3300026116 Bacteria 3555
478 Ga0207674_10094746 3300026116 Bacteria 2972
479 Ga0207674_10121792 3300026116 Bacteria 2575
480 Ga0207674_10147747 3300026116 Unclassified 2308
481 Ga0207675_100003242 3300026118 Bacteria 15948
482 Ga0207675_100013361 3300026118 Bacteria 7661
483 Ga0207675_100034715 3300026118 Bacteria 4704
484 Ga0207675_100038225 3300026118 Bacteria 4478
485 Ga0207675_100096291 3300026118 Unclassified 2786
486 Ga0207675_100105919 3300026118 Bacteria 2651
487 Ga0207675_100153605 3300026118 Bacteria 2192
488 Ga0207683_10001985 3300026121 Bacteria 18106
489 Ga0207683_10002587 3300026121 Bacteria 15805
490 Ga0207683_10005259 3300026121 Bacteria 11109
491 Ga0207683_10028416 3300026121 Bacteria 4836
492 Ga0207698_10032736 3300026142 Bacteria 3769
493 Ga0207698_10053125 3300026142 Bacteria 3108
494 Ga0207698_10075351 3300026142 Bacteria 2696
495 Ga0209974_10024879 3300027876 Bacteria 1981
496 Ga0207428_10186678 3300027907 Unclassified 1564
497 Ga0207428_10212738 3300027907 Bacteria 1452
498 Ga0268266_10000149 3300028379 Bacteria 134809
499 Ga0268266_10081142 3300028379 Bacteria 2827
500 Ga0268266_10133298 3300028379 Bacteria 2224
501 Ga0268265_10049918 3300028380 Bacteria 3150
502 Ga0268265_10169008 3300028380 Bacteria 1866
503 Ga0268265_10357801 3300028380 Bacteria 1335
504 Ga0268264_10000064 3300028381 Bacteria 301274
505 Ga0268264_10005438 3300028381 Bacteria 10791
506 Ga0268264_10017824 3300028381 Bacteria 5812
507 Ga0268264_10037388 3300028381 Bacteria 4003
508 Ga0268264_10040678 3300028381 Bacteria 3841
509 Ga0268264_10128374 3300028381 Bacteria 2244
510 Ga0268264_10135630 3300028381 Bacteria 2188
511 Ga0268264_10274058 3300028381 Bacteria 1577
512 Ga0265336_10041509 3300028666 Bacteria 1406
513 Ga0307515_10031913 3300028794 Bacteria 8750
514 Ga0307515_10072264 3300028794 Bacteria 4660
515 Ga0265320_10001749 3300031240 Bacteria 15394
516 Ga0307513_10017090 3300031456 Bacteria 8717
517 Ga0307513_10021862 3300031456 Bacteria 7538
518 Ga0307513_10158870 3300031456 Bacteria 2156
519 Ga0307509_10032616 3300031507 Bacteria 5739
520 Ga0307509_10060648 3300031507 Bacteria 3997
521 Ga0307509_10097570 3300031507 Bacteria 2987
522 Ga0307509_10128864 3300031507 Bacteria 2490
523 Ga0307408_100065279 3300031548 Bacteria 2669
524 Ga0307508_10000052 3300031616 Bacteria 129344
525 Ga0307508_10000425 3300031616 Bacteria 50122
526 Ga0316576_10025408 3300031727 Unclassified 4147
527 Ga0316576_10059748 3300031727 Unclassified 2791
528 Ga0316578_10138094 3300031728 Bacteria 1468
529 Ga0307405_10151283 3300031731 Unclassified 1632
530 Ga0307413_10001643 3300031824 Bacteria 8666
531 Ga0307410_10128870 3300031852 Unclassified 1856
532 Ga0307406_10064141 3300031901 Bacteria 2383
533 Ga0307406_10110878 3300031901 Bacteria 1889
534 Ga0307407_10004105 3300031903 Bacteria 6127
535 Ga0307407_10044350 3300031903 Bacteria 2506
536 Ga0307407_10053432 3300031903 Bacteria 2324
537 Ga0307412_10031068 3300031911 Bacteria 3369
538 Ga0307412_10231195 3300031911 Unclassified 1424
539 Ga0307409_100008128 3300031995 Bacteria 6338
540 Ga0307409_100008129 3300031995 Bacteria 6338
541 Ga0307416_100002761 3300032002 Bacteria 10193
542 Ga0307416_100129054 3300032002 Bacteria 2271
543 Ga0307416_100328727 3300032002 Unclassified 1535
544 Ga0307414_10000021 3300032004 Bacteria 213521
545 Ga0307414_10009337 3300032004 Bacteria 5629
546 Ga0307414_10028590 3300032004 Bacteria 3618
547 Ga0307414_10168513 3300032004 Bacteria 1748
548 Ga0307414_10191614 3300032004 Bacteria 1655
549 Ga0307411_10173876 3300032005 Unclassified 1627
550 Ga0307415_100075560 3300032126 Bacteria 2385
551 Ga0373928_0000580 3300035084 Bacteria 7191
552 Ga0373953_0074295 3300035117 Bacteria 1406
553 Ga0373943_0100061 3300035170 Bacteria 1515
554 Ga0373927_0019622 3300035695 Bacteria 4432
555 Ga0373947_0047085 3300035725 Bacteria 2583
556 Ga0316582_0008001 3300036647 Archaea 5657
557 Ga0395899_0000001 3300037312 Bacteria 1750322
558 Ga0395900_0055523 3300037418 Unclassified 4078
559 Ga0395905_0000737 3300037471 Bacteria 43081
560 Ga0395905_0080252 3300037471 Bacteria 3058
561 Ga0395905_0097874 3300037471 Unclassified 2755
562 Ga0436365_1354401 3300039437 Bacteria 12100
563 Ga0451789_0136231 3300041443 Bacteria 1215
564 Ga0451791_1150138 3300041451 Bacteria 3013
565 Ga0451797_0598084 3300041453 Bacteria 1185
566 Ga0451798_0094830 3300041458 Bacteria 1867
567 Ga0451807_1542018 3300041486 Bacteria 2092
568 Ga0451807_2585360 3300041486 Bacteria 5257
569 Ga0451853_2458528 3300041512 Bacteria 1580
570 Ga0439442_007186 3300042002 Bacteria 2240
571 Ga0439449_0023577 3300042007 Bacteria 2301
572 Ga0439457_014352 3300042014 Unclassified 1773
573 Ga0450898_014017 3300042134 Bacteria 1343
574 Ga0450899_003069 3300042135 Bacteria 1801
575 Ga0451577_0007245 3300042876 Bacteria 10930
576 Ga0451577_0011066 3300042876 Bacteria 8569
577 Ga0451577_0479263 3300042876 Bacteria 1129
578 Ga0466969_0000399 3300044656 Bacteria 23843
579 Ga0466972_0000027 3300044658 Bacteria 174082
580 Ga0466972_0000038 3300044658 Bacteria 135937
581 Ga0466972_0001168 3300044658 Bacteria 12577
582 Ga0466972_0012027 3300044658 Bacteria 4348
583 Ga0466972_0051935 3300044658 Bacteria 1977
584 Ga0466966_0019820 3300044684 Bacteria 4423
585 Ga0453684_0000549 3300044712 Bacteria 141927
586 Ga0453684_0028193 3300044712 Bacteria 8024
587 Ga0453684_0076844 3300044712 Unclassified 4190
588 Ga0453684_0122492 3300044712 Bacteria 3137
589 Ga0453684_0147300 3300044712 Bacteria 2802
590 Ga0466968_0039794 3300044735 Bacteria 1980
591 Ga0466959_0000011 3300045049 Bacteria 173387
592 Ga0451576_0003363 3300045051 Bacteria 22150
593 Ga0495627_017509 3300046453 Bacteria 2433
594 Ga0495590_0003661 3300046457 Bacteria 6257
595 Ga0495638_0000020 3300046460 Bacteria 372434
596 Ga0495638_0108767 3300046460 Bacteria 1649
597 Ga0495664_0062271 3300046477 Unclassified 2222
598 Ga0495664_0132110 3300046477 Bacteria 1512
599 Ga0495616_0003820 3300046513 Bacteria 9602
600 Ga0495632_0153839 3300046519 Bacteria 1062
601 Ga0495648_0001120 3300046524 Bacteria 27151
602 Ga0495587_0019757 3300046536 Bacteria 4165
603 Ga0495587_0073474 3300046536 Bacteria 1987
604 Ga0495633_0018045 3300046558 Bacteria 3589
605 Ga0495668_0007170 3300046616 Bacteria 7165
606 Ga0495611_0000099 3300046648 Bacteria 60428
607 Ga0495625_0084319 3300046660 Bacteria 2207
608 Ga0495625_0114616 3300046660 Bacteria 1840
609 Ga0495604_0091570 3300047317 Unclassified 2255
610 Ga0495672_0010307 3300047320 Bacteria 6677
611 Ga0495672_0013741 3300047320 Bacteria 5571
612 Ga0495672_0128448 3300047320 Bacteria 1337
613 Ga0495687_000158 3300047443 Bacteria 103129
614 Ga0495675_0069091 3300047444 Unclassified 2231
615 Ga0495684_0070533 3300047471 Bacteria 2657
616 Ga0496104_0171454 3300048907 Bacteria 2081
617 Ga0496124_0162877 3300048927 Bacteria 1737
618 Ga0501298_016836 3300049521 Bacteria 1329
619 Ga0501031_0116488 3300049568 Bacteria 1745
620 Ga0501032_0002056 3300049569 Bacteria 15891
621 Ga0501033_0000748 3300049570 Bacteria 29907
622 Ga0501034_0019490 3300049571 Bacteria 6938
623 Ga0501034_0142306 3300049571 Bacteria 2377
624 Ga0501034_0291970 3300049571 Unclassified 1568
625 Ga0501036_0034543 3300049572 Bacteria 4277
626 Ga0501037_0002859 3300049573 Bacteria 12519
627 Ga0501037_0153501 3300049573 Bacteria 1644
628 Ga0501038_0001234 3300049574 Bacteria 23204
629 Ga0501038_0015182 3300049574 Bacteria 7007
630 Ga0501042_0031920 3300049578 Bacteria 3727
631 Ga0501043_0009431 3300049579 Bacteria 7661
632 Ga0501043_0010043 3300049579 Bacteria 7425
633 Ga0501043_0195902 3300049579 Bacteria 1569
634 Ga0501046_0002099 3300049580 Bacteria 18888
635 Ga0501047_0005561 3300049581 Bacteria 11865
636 Ga0501047_0035937 3300049581 Bacteria 4787
637 Ga0501047_0098430 3300049581 Bacteria 2803
638 Ga0501047_0141165 3300049581 Bacteria 2287
639 Ga0501047_0190767 3300049581 Bacteria 1913
640 Ga0501048_0053093 3300049582 Bacteria 2883
641 Ga0501067_0006365 3300049583 Bacteria 6540
642 Ga0501068_0000585 3300049584 Bacteria 18482
643 Ga0501070_0016579 3300049586 Bacteria 6188
644 Ga0501071_0008837 3300049587 Bacteria 6678
645 Ga0501072_0144945 3300049588 Bacteria 1894
646 Ga0501073_0011782 3300049589 Bacteria 6383
647 Ga0501074_0009290 3300049590 Bacteria 7140
648 Ga0501076_0052809 3300049592 Bacteria 3220
649 Ga0501077_0000980 3300049593 Bacteria 17208
650 Ga0501202_000294 3300049652 Bacteria 6851
651 Ga0501217_029450 3300049661 Bacteria 1343
652 Ga0501223_003903 3300049663 Bacteria 3219
653 Ga0501223_016989 3300049663 Bacteria 1437
654 Ga0501224_004619 3300049664 Bacteria 1959
655 Ga0501235_004698 3300049669 Bacteria 2955
656 Ga0501242_004225 3300049674 Bacteria 1589
657 Ga0501243_000060 3300049675 Bacteria 10743
658 Ga0501257_025025 3300049686 Bacteria 1419
659 Ga0501257_032032 3300049686 Bacteria 1270
660 Ga0501225_0001832 3300049705 Bacteria 6659
661 Ga0501225_0003149 3300049705 Bacteria 5040
662 Ga0501225_0005591 3300049705 Bacteria 3683
663 Ga0501234_003841 3300049707 Unclassified 2363
664 Ga0501079_0000653 3300049741 Bacteria 23159
665 Ga0501080_0001948 3300049742 Bacteria 17823
666 Ga0501080_0206044 3300049742 Bacteria 1804
667 Ga0501083_0093390 3300049744 Bacteria 1986
668 Ga0501264_000050 3300049761 Bacteria 16836
669 Ga0501266_003291 3300049763 Bacteria 2009
670 Ga0501035_0000115 3300049822 Bacteria 98344
671 Ga0501035_0017694 3300049822 Bacteria 6573
672 Ga0501035_0068866 3300049822 Bacteria 3137
673 Ga0501035_0285520 3300049822 Bacteria 1394
674 Ga0501044_0000027 3300049823 Bacteria 181388
675 Ga0501044_0007409 3300049823 Bacteria 12068
676 Ga0501044_0165502 3300049823 Bacteria 2185
677 Ga0501044_0272675 3300049823 Bacteria 1627
678 Ga0501212_011777 3300049851 Bacteria 1265
679 nmdc:mga00v17_582_c2 3300050491 Bacteria 10150
680 nmdc:mga05p37_2387_c1 3300050507 Bacteria 21852
681 nmdc:mga05p37_42353_c1 3300050507 Bacteria 5594
682 nmdc:mga09592_236206_c1 3300050508 Bacteria 1584
683 nmdc:mga09592_46734_c1 3300050508 Unclassified 3647
684 nmdc:mga0qj67_25750_c1 3300050509 Bacteria 4549
685 nmdc:mga06r32_57778_c1 3300050510 Unclassified 3727
686 nmdc:mga06r32_84417_c1 3300050510 Bacteria 3095
687 nmdc:mga08y16_160734_c1 3300050511 Bacteria 2334
688 nmdc:mga08y16_198554_c1 3300050511 Bacteria 2079
689 nmdc:mga08y16_205082_c1 3300050511 Bacteria 2043
690 nmdc:mga08y16_48682_c1 3300050511 Unclassified 4435
691 nmdc:mga08y16_8382_c1 3300050511 Bacteria 10814
692 Ga0500578_0000009 3300053086 Bacteria 219807
693 Ga0500646_0043331 3300053090 Bacteria 1274
694 Ga0500583_0000036 3300053092 Bacteria 95404
695 Ga0500583_0000666 3300053092 Bacteria 10123
696 Ga0500583_0001637 3300053092 Bacteria 6517
697 Ga0500583_0036919 3300053092 Bacteria 2191
698 Ga0500651_0019024 3300053093 Bacteria 4260
699 Ga0500568_0000346 3300053139 Bacteria 36068
700 Ga0500568_0098148 3300053139 Bacteria 1100
701 Ga0500588_0057524 3300053146 Bacteria 1234
702 Ga0500616_0000007 3300053153 Bacteria 836875
703 Ga0500616_0008695 3300053153 Bacteria 6269
704 Ga0500622_0001640 3300053156 Bacteria 17525
705 Ga0500622_0006324 3300053156 Bacteria 6908
706 Ga0500622_0026835 3300053156 Bacteria 3038
707 Ga0501084_0044840 3300054114 Bacteria 3702
708 Ga0501082_0020527 3300060353 Bacteria 5694
709 2522550415 2522125168 Bacteria 7376607
710 2738726859 2738541278 Bacteria 9755573
711 2819576038 2818991442 Bacteria 8318214
712 2910250516 2910245624 Bacteria 6935613
713 2911142416 2911138879 Bacteria 5811561
714 2911142533 2911138879 Bacteria 5811561
715 2919692801 2919692658 Bacteria 5943958
716 2919697628 2919692658 Bacteria 5943958
717 2929926459 2929921140 Bacteria 8649150
718 8003156813 8003151029 Bacteria 8187759
719 Ga0105237_10015760
720 JGI24739J22299_10007776
721 JGI25153J46596_10000766
722 JGI25153J46596_10018149
723 rootH1_10033439
724 rootH2_10010010
725 rootH2_10217225
726 rootL2_10005471
727 rootL2_10058065
728 rootL2_10068274
729 rootL2_10077131
730 rootL2_10155085
731 rootL2_10235208
732 rootL2_10282538
733 rootL2_10302482
734 rootH1_10003268
735 rootH1_10008265
736 rootH1_10011937
737 rootH1_10023828
738 rootH1_10096985
739 rootH1_10102452
740 rootH1_10105715
741 rootH1_10119811
742 rootH1_10387958
743 JGI25160J50197_1000863
744 JGI25160J50197_1021239
745 Ga0055526_1018304
746 Ga0055528_1002478
747 Ga0055530_10009262
748 Ga0055531_10000435
749 Ga0058863_11707405
750 Ga0065165_1000043
751 Ga0065165_1000219
752 Ga0065712_10145165
753 Ga0070658_10081100
754 Ga0070676_10198100
755 Ga0070683_100074968
756 Ga0070683_100340248
757 Ga0070690_100009302
758 Ga0070670_100032495
759 Ga0070670_100133952
760 Ga0070670_100156661
761 Ga0070677_10000400
762 Ga0068869_100015239
763 Ga0068869_100017422
764 Ga0068869_100021471
765 Ga0068869_100042642
766 Ga0068869_100239344
767 Ga0070666_10000138
768 Ga0070666_10045688
769 Ga0070680_100072172
770 Ga0070682_100037733
771 Ga0070682_100158626
772 Ga0068868_100002592
773 Ga0068868_100014395
774 Ga0068868_100080951
775 Ga0068868_100083152
776 Ga0068868_100165677
777 Ga0068868_100182786
778 Ga0070660_100128464
779 Ga0070660_100136450
780 Ga0070689_100000797
781 Ga0070689_100057636
782 Ga0070689_100140712
783 Ga0070689_100345343
784 Ga0070687_100082748
785 Ga0070661_100010000
786 Ga0070668_100052230
787 Ga0070668_100063629
788 Ga0070668_100069315
789 Ga0070668_100193559
790 Ga0070669_100028232
791 Ga0070669_100037494
792 Ga0070675_100006161
793 Ga0070675_100080373
794 Ga0070675_100130221
795 Ga0070671_100164849
796 Ga0070674_100009539
797 Ga0070674_100051483
798 Ga0070674_100083274
799 Ga0070674_100099853
800 Ga0070674_100141716
801 Ga0070673_100012837
802 Ga0070673_100014554
803 Ga0070673_100047596
804 Ga0070673_100375445
805 Ga0070688_100036747
806 Ga0070688_100077384
807 Ga0070659_100010682
808 Ga0070659_100032648
809 Ga0070659_100049299
810 Ga0070667_100001467
811 Ga0070667_100145082
812 Ga0070700_100048188
813 Ga0070700_100112425
814 Ga0070678_100048685
815 Ga0070678_100204861
816 Ga0070678_100224535
817 Ga0070678_100341033
818 Ga0070662_100066547
819 Ga0070681_10043616
820 Ga0068867_100009217
821 Ga0068867_100026116
822 Ga0068867_100252211
823 Ga0070685_10022566
824 Ga0070685_10034947
825 Ga0070699_100107997
826 Ga0070679_100032976
827 Ga0070684_100002054
828 Ga0070684_100043586
829 Ga0070684_100290550
830 Ga0068853_100048688
831 Ga0068853_100070352
832 Ga0068853_100232818
833 Ga0070672_100036103
834 Ga0070672_100045621
835 Ga0070672_100061580
836 Ga0070672_100211327
837 Ga0070672_100261311
838 Ga0070686_100058855
839 Ga0070696_100172879
840 Ga0070693_100043222
841 Ga0070665_100000016
842 Ga0070665_100003454
843 Ga0070665_100052967
844 Ga0070665_100362309
845 Ga0070704_100258070
846 Ga0068855_100002311
847 Ga0068855_100013738
848 Ga0068855_100076505
849 Ga0068855_100226959
850 Ga0070664_100011247
851 Ga0070664_100013959
852 Ga0070664_100182491
853 Ga0068857_100103626
854 Ga0068857_100216660
855 Ga0068854_100028862
856 Ga0070702_100002295
857 Ga0070702_100013127
858 Ga0068852_100062071
859 Ga0068852_100433798
860 Ga0068859_100000086
861 Ga0068859_100019258
862 Ga0068859_100058356
863 Ga0068859_100328809
864 Ga0068864_100013839
865 Ga0068864_100017294
866 Ga0068864_100053363
867 Ga0068864_100074765
868 Ga0068866_10049789
869 Ga0068866_10053909
870 Ga0068866_10054269
871 Ga0068861_100003410
872 Ga0068861_100003537
873 Ga0068861_100033659
874 Ga0068861_100046232
875 Ga0068861_100057903
876 Ga0068861_100086968
877 Ga0068861_100413759
878 Ga0068851_10005291
879 Ga0068870_10029303
880 Ga0068863_100009150
881 Ga0068863_100010890
882 Ga0068863_100017951
883 Ga0068863_100041315
884 Ga0068863_100124869
885 Ga0068863_100128733
886 Ga0068863_100301641
887 Ga0068858_100017405
888 Ga0068860_100000006
889 Ga0068860_100002840
890 Ga0068860_100012354
891 Ga0068860_100024871
892 Ga0068860_100085545
893 Ga0068860_100154901
894 Ga0068860_100205263
895 Ga0068862_100013075
896 Ga0068862_100188425
897 Ga0068862_100360587
898 Ga0081455_10008109
899 Ga0081539_10000816
900 Ga0081539_10008031
901 Ga0075364_10000088
902 Ga0075366_10070479
903 Ga0097621_100006601
904 Ga0097621_100008063
905 Ga0097621_100029627
906 Ga0097621_100070868
907 Ga0097621_100110567
908 Ga0097621_100115064
909 Ga0068871_100001606
910 Ga0068871_100019167
911 Ga0068871_100028555
912 Ga0068871_100177883
913 Ga0068871_100206891
914 Ga0068871_100215039
915 Ga0068871_100229040
916 Ga0068871_100259740
917 Ga0075428_100013628
918 Ga0075428_100045822
919 Ga0075428_100106726
920 Ga0075428_100186233
921 Ga0075428_100199519
922 Ga0075430_100014626
923 Ga0075431_100014855
924 Ga0075431_100018946
925 Ga0075429_100000105
926 Ga0075429_100000606
927 Ga0075429_100181704
928 Ga0068865_100028700
929 Ga0068865_100045075
930 Ga0068865_100130124
931 Ga0068865_100130575
932 Ga0097620_100000086
933 Ga0097620_100019258
934 Ga0097620_100058359
935 Ga0097620_100328781
936 Ga0105240_10000328
937 Ga0105240_10008271
938 Ga0105240_10016663
939 Ga0105240_10023977
940 Ga0105240_10039408
941 Ga0111539_10005241
942 Ga0111539_10012104
943 Ga0111539_10033434
944 Ga0111539_10057540
945 Ga0111539_10446284
946 Ga0105247_10004124
947 Ga0114129_10002392
948 Ga0114129_10055251
949 Ga0114129_10112735
950 Ga0105243_10069969
951 Ga0105243_10125853
952 Ga0105241_10000403
953 Ga0105241_10001753
954 Ga0105241_10097566
955 Ga0105241_10175695
956 Ga0105241_10196839
957 Ga0105242_10238637
958 Ga0105242_10271125
959 Ga0105248_10665160
960 Ga0105237_10002164
961 Ga0105237_10002660
962 Ga0105237_10007945
963 Ga0105237_10018209
964 Ga0105237_10036552
965 Ga0105237_10068168
966 Ga0105237_10113106
967 Ga0105238_10127922
968 Ga0105238_10286858
969 Ga0105249_10009844
970 Ga0105249_10013748
971 Ga0105249_10101072
972 Ga0105249_10168166
973 Ga0105249_10218971
974 Ga0105239_10000101
975 Ga0105239_10005300
976 Ga0105239_10015372
977 Ga0105239_10020208
978 Ga0105239_10023231
979 Ga0105239_10478336
980 Ga0105246_10007061
981 Ga0105246_10018901
982 Ga0105246_10033670
983 Ga0157373_10003137
984 Ga0157373_10019920
985 Ga0157373_10038045
986 Ga0157371_10182197
987 Ga0157370_10015201
988 Ga0157370_10015874
989 Ga0157369_10029201
990 Ga0157369_10036494
991 Ga0157374_10000029
992 Ga0157374_10002518
993 Ga0157374_10009357
994 Ga0157374_10022675
995 Ga0157374_10228827
996 Ga0157374_10229327
997 Ga0157374_10274678
998 Ga0157374_10457765
999 Ga0157378_10002981
1000 Ga0157378_10014684
1001 Ga0157378_10036566
1002 Ga0157378_10045202
1003 Ga0157378_10062832
1004 Ga0157378_10195028
1005 Ga0157378_10279760
1006 Ga0163162_10000355
1007 Ga0163162_10003500
1008 Ga0163162_10006493
1009 Ga0163162_10032916
1010 Ga0163162_10101459
1011 Ga0163162_10190355
1012 Ga0163162_10236468
1013 Ga0157372_10006751
1014 Ga0157372_10035569
1015 Ga0157372_10105613
1016 Ga0157372_10220850
1017 Ga0157372_10235796
1018 Ga0157375_10000207
1019 Ga0157375_10046071
1020 Ga0157375_10066270
1021 Ga0157375_10106141
1022 Ga0157375_10127200
1023 Ga0157375_10142343
1024 Ga0157375_10159336
1025 Ga0157375_10167901
1026 Ga0157375_10184107
1027 Ga0157375_10235105
1028 Ga0163163_10075457
1029 Ga0163163_10177947
1030 Ga0163163_10192403
1031 Ga0157380_10000443
1032 Ga0157380_10002654
1033 Ga0157380_10011948
1034 Ga0157380_10013569
1035 Ga0157380_10048129
1036 Ga0157380_10172883
1037 Ga0157380_10178839
1038 Ga0157380_10261892
1039 Ga0157380_10450270
1040 Ga0157377_10025096
1041 Ga0157377_10072696
1042 Ga0157379_10024379
1043 Ga0157379_10216518
1044 Ga0157379_10323816
1045 Ga0157379_10329740
1046 Ga0157376_10002108
1047 Ga0157376_10021073
1048 Ga0157376_10088629
1049 Ga0157376_10164905
1050 Ga0157376_10311592
1051 Ga0157376_10330992
1052 Ga0182005_1000280
1053 Ga0163161_10004389
1054 Ga0163161_10004778
1055 Ga0163161_10144685
1056 Ga0213876_10005477
1057 Ga0209436_101063
1058 Ga0209646_1000003
1059 Ga0209646_1001862
1060 Ga0209026_1000614
1061 Ga0209673_1000962
1062 Ga0209676_1000584
1063 Ga0209564_1003078
1064 Ga0209758_1002110
1065 Ga0209758_1011568
1066 Ga0209050_1000561
1067 Ga0207426_1000093
1068 Ga0207426_1000187
1069 Ga0207426_1015489
1070 Ga0209257_1000005
1071 Ga0209257_1010390
1072 Ga0207682_10013064
1073 Ga0207682_10069148
1074 Ga0207642_10016957
1075 Ga0207642_10078093
1076 Ga0207688_10014165
1077 Ga0207680_10193039
1078 Ga0207647_10020994
1079 Ga0207645_10000193
1080 Ga0207645_10000279
1081 Ga0207645_10001124
1082 Ga0207645_10007389
1083 Ga0207643_10002695
1084 Ga0207643_10008261
1085 Ga0207643_10022145
1086 Ga0207643_10022803
1087 Ga0207643_10038307
1088 Ga0207654_10028214
1089 Ga0207695_10001513
1090 Ga0207695_10002144
1091 Ga0207695_10044421
1092 Ga0207695_10046762
1093 Ga0207695_10137474
1094 Ga0207671_10002804
1095 Ga0207671_10003963
1096 Ga0207671_10005605
1097 Ga0207671_10008668
1098 Ga0207671_10019962
1099 Ga0207671_10025430
1100 Ga0207671_10130845
1101 Ga0207662_10049696
1102 Ga0207657_10005188
1103 Ga0207657_10092518
1104 Ga0207657_10167202
1105 Ga0207649_10068462
1106 Ga0207649_10112130
1107 Ga0207652_10000093
1108 Ga0207681_10018827
1109 Ga0207681_10122224
1110 Ga0207681_10258681
1111 Ga0207694_10206118
1112 Ga0207650_10106496
1113 Ga0207659_10006163
1114 Ga0207659_10031482
1115 Ga0207659_10283410
1116 Ga0207659_10300091
1117 Ga0207700_10078365
1118 Ga0207690_10014232
1119 Ga0207706_10037886
1120 Ga0207706_10082970
1121 Ga0207686_10002379
1122 Ga0207686_10175111
1123 Ga0207670_10002207
1124 Ga0207670_10034377
1125 Ga0207670_10280269
1126 Ga0207669_10019354
1127 Ga0207704_10013780
1128 Ga0207704_10062827
1129 Ga0207704_10072127
1130 Ga0207704_10124733
1131 Ga0207704_10159396
1132 Ga0207691_10020637
1133 Ga0207691_10033523
1134 Ga0207691_10034558
1135 Ga0207691_10063680
1136 Ga0207691_10065070
1137 Ga0207691_10066517
1138 Ga0207691_10078777
1139 Ga0207691_10107322
1140 Ga0207689_10001574
1141 Ga0207689_10005101
1142 Ga0207689_10006249
1143 Ga0207689_10016558
1144 Ga0207689_10027543
1145 Ga0207689_10029959
1146 Ga0207689_10041176
1147 Ga0207689_10046666
1148 Ga0207689_10051265
1149 Ga0207689_10114379
1150 Ga0207661_10016817
1151 Ga0207661_10017076
1152 Ga0207661_10050302
1153 Ga0207679_10006182
1154 Ga0207679_10040417
1155 Ga0207679_10298365
1156 Ga0207667_10003174
1157 Ga0207667_10134411
1158 Ga0207667_10211102
1159 Ga0207651_10011488
1160 Ga0207651_10037260
1161 Ga0207651_10099594
1162 Ga0207712_10007096
1163 Ga0207712_10008345
1164 Ga0207712_10064471
1165 Ga0207712_10349203
1166 Ga0207668_10032790
1167 Ga0207640_10201131
1168 Ga0207658_10008348
1169 Ga0207677_10193738
1170 Ga0207703_10013272
1171 Ga0207639_10036027
1172 Ga0207639_10185266
1173 Ga0207678_10016529
1174 Ga0207708_10014031
1175 Ga0207708_10030440
1176 Ga0207708_10050880
1177 Ga0207702_10011501
1178 Ga0207702_10146011
1179 Ga0207702_10229277
1180 Ga0207641_10000061
1181 Ga0207641_10001165
1182 Ga0207641_10107164
1183 Ga0207641_10409354
1184 Ga0207648_10004327
1185 Ga0207648_10007665
1186 Ga0207648_10066730
1187 Ga0207648_10077588
1188 Ga0207648_10099073
1189 Ga0207648_10198308
1190 Ga0207648_10203134
1191 Ga0207676_10012851
1192 Ga0207676_10265381
1193 Ga0207674_10006014
1194 Ga0207674_10069011
1195 Ga0207674_10094746
1196 Ga0207674_10121792
1197 Ga0207674_10147747
1198 Ga0207675_100003242
1199 Ga0207675_100013361
1200 Ga0207675_100034715
1201 Ga0207675_100038225
1202 Ga0207675_100096291
1203 Ga0207675_100105919
1204 Ga0207675_100153605
1205 Ga0207683_10001985
1206 Ga0207683_10002587
1207 Ga0207683_10005259
1208 Ga0207683_10028416
1209 Ga0207698_10032736
1210 Ga0207698_10053125
1211 Ga0207698_10075351
1212 Ga0209974_10024879
1213 Ga0207428_10186678
1214 Ga0207428_10212738
1215 Ga0268266_10000149
1216 Ga0268266_10081142
1217 Ga0268266_10133298
1218 Ga0268265_10049918
1219 Ga0268265_10169008
1220 Ga0268265_10357801
1221 Ga0268264_10000064
1222 Ga0268264_10005438
1223 Ga0268264_10017824
1224 Ga0268264_10037388
1225 Ga0268264_10040678
1226 Ga0268264_10128374
1227 Ga0268264_10135630
1228 Ga0268264_10274058
1229 Ga0265336_10041509
1230 Ga0307515_10031913
1231 Ga0307515_10072264
1232 Ga0265320_10001749
1233 Ga0307513_10017090
1234 Ga0307513_10021862
1235 Ga0307513_10158870
1236 Ga0307509_10032616
1237 Ga0307509_10060648
1238 Ga0307509_10097570
1239 Ga0307509_10128864
1240 Ga0307408_100065279
1241 Ga0307508_10000052
1242 Ga0307508_10000425
1243 Ga0316576_10025408
1244 Ga0316576_10059748
1245 Ga0316578_10138094
1246 Ga0307405_10151283
1247 Ga0307413_10001643
1248 Ga0307410_10128870
1249 Ga0307406_10064141
1250 Ga0307406_10110878
1251 Ga0307407_10004105
1252 Ga0307407_10044350
1253 Ga0307407_10053432
1254 Ga0307412_10031068
1255 Ga0307412_10231195
1256 Ga0307409_100008128
1257 Ga0307409_100008129
1258 Ga0307416_100002761
1259 Ga0307416_100129054
1260 Ga0307416_100328727
1261 Ga0307414_10000021
1262 Ga0307414_10009337
1263 Ga0307414_10028590
1264 Ga0307414_10168513
1265 Ga0307414_10191614
1266 Ga0307411_10173876
1267 Ga0307415_100075560
1268 Ga0373928_0000580
1269 Ga0373953_0074295
1270 Ga0373943_0100061
1271 Ga0373927_0019622
1272 Ga0373947_0047085
1273 Ga0316582_0008001
1274 Ga0395899_0000001
1275 Ga0395900_0055523
1276 Ga0395905_0000737
1277 Ga0395905_0080252
1278 Ga0395905_0097874
1279 Ga0436365_1354401
1280 Ga0451789_0136231
1281 Ga0451791_1150138
1282 Ga0451797_0598084
1283 Ga0451798_0094830
1284 Ga0451807_1542018
1285 Ga0451807_2585360
1286 Ga0451853_2458528
1287 Ga0439442_007186
1288 Ga0439449_0023577
1289 Ga0439457_014352
1290 Ga0450898_014017
1291 Ga0450899_003069
1292 Ga0451577_0007245
1293 Ga0451577_0011066
1294 Ga0451577_0479263
1295 Ga0466969_0000399
1296 Ga0466972_0000027
1297 Ga0466972_0000038
1298 Ga0466972_0001168
1299 Ga0466972_0012027
1300 Ga0466972_0051935
1301 Ga0466966_0019820
1302 Ga0453684_0000549
1303 Ga0453684_0028193
1304 Ga0453684_0076844
1305 Ga0453684_0122492
1306 Ga0453684_0147300
1307 Ga0466968_0039794
1308 Ga0466959_0000011
1309 Ga0451576_0003363
1310 Ga0495627_017509
1311 Ga0495590_0003661
1312 Ga0495638_0000020
1313 Ga0495638_0108767
1314 Ga0495664_0062271
1315 Ga0495664_0132110
1316 Ga0495616_0003820
1317 Ga0495632_0153839
1318 Ga0495648_0001120
1319 Ga0495587_0019757
1320 Ga0495587_0073474
1321 Ga0495633_0018045
1322 Ga0495668_0007170
1323 Ga0495611_0000099
1324 Ga0495625_0084319
1325 Ga0495625_0114616
1326 Ga0495604_0091570
1327 Ga0495672_0010307
1328 Ga0495672_0013741
1329 Ga0495672_0128448
1330 Ga0495687_000158
1331 Ga0495675_0069091
1332 Ga0495684_0070533
1333 Ga0496104_0171454
1334 Ga0496124_0162877
1335 Ga0501298_016836
1336 Ga0501031_0116488
1337 Ga0501032_0002056
1338 Ga0501033_0000748
1339 Ga0501034_0019490
1340 Ga0501034_0142306
1341 Ga0501034_0291970
1342 Ga0501036_0034543
1343 Ga0501037_0002859
1344 Ga0501037_0153501
1345 Ga0501038_0001234
1346 Ga0501038_0015182
1347 Ga0501042_0031920
1348 Ga0501043_0009431
1349 Ga0501043_0010043
1350 Ga0501043_0195902
1351 Ga0501046_0002099
1352 Ga0501047_0005561
1353 Ga0501047_0035937
1354 Ga0501047_0098430
1355 Ga0501047_0141165
1356 Ga0501047_0190767
1357 Ga0501048_0053093
1358 Ga0501067_0006365
1359 Ga0501068_0000585
1360 Ga0501070_0016579
1361 Ga0501071_0008837
1362 Ga0501072_0144945
1363 Ga0501073_0011782
1364 Ga0501074_0009290
1365 Ga0501076_0052809
1366 Ga0501077_0000980
1367 Ga0501202_000294
1368 Ga0501217_029450
1369 Ga0501223_003903
1370 Ga0501223_016989
1371 Ga0501224_004619
1372 Ga0501235_004698
1373 Ga0501242_004225
1374 Ga0501243_000060
1375 Ga0501257_025025
1376 Ga0501257_032032
1377 Ga0501225_0001832
1378 Ga0501225_0003149
1379 Ga0501225_0005591
1380 Ga0501234_003841
1381 Ga0501079_0000653
1382 Ga0501080_0001948
1383 Ga0501080_0206044
1384 Ga0501083_0093390
1385 Ga0501264_000050
1386 Ga0501266_003291
1387 Ga0501035_0000115
1388 Ga0501035_0017694
1389 Ga0501035_0068866
1390 Ga0501035_0285520
1391 Ga0501044_0000027
1392 Ga0501044_0007409
1393 Ga0501044_0165502
1394 Ga0501044_0272675
1395 Ga0501212_011777
1396 nmdc:mga00v17_582_c2
1397 nmdc:mga05p37_2387_c1
1398 nmdc:mga05p37_42353_c1
1399 nmdc:mga09592_236206_c1
1400 nmdc:mga09592_46734_c1
1401 nmdc:mga0qj67_25750_c1
1402 nmdc:mga06r32_57778_c1
1403 nmdc:mga06r32_84417_c1
1404 nmdc:mga08y16_160734_c1
1405 nmdc:mga08y16_198554_c1
1406 nmdc:mga08y16_205082_c1
1407 nmdc:mga08y16_48682_c1
1408 nmdc:mga08y16_8382_c1
1409 Ga0500578_0000009
1410 Ga0500646_0043331
1411 Ga0500583_0000036
1412 Ga0500583_0000666
1413 Ga0500583_0001637
1414 Ga0500583_0036919
1415 Ga0500651_0019024
1416 Ga0500568_0000346
1417 Ga0500568_0098148
1418 Ga0500588_0057524
1419 Ga0500616_0000007
1420 Ga0500616_0008695
1421 Ga0500622_0001640
1422 Ga0500622_0006324
1423 Ga0500622_0026835
1424 Ga0501084_0044840
1425 Ga0501082_0020527
1426 2522550415
1427 2738726859
1428 2819576038
1429 2910250516
1430 2911142416
1431 2911142533
1432 2919692801
1433 2919697628
1434 2929926459
1435 8003156813

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

87

211

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

219

340

0.93

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

224

415

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a06-assembly1.cif.gz_C crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol 0.9431 35 365
1evj-assembly1.cif.gz_C crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9427 37 364
1h6d-assembly3.cif.gz_I oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol 0.9393 33 364
1evj-assembly2.cif.gz_B crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9362 37 364
1rye-assembly1.cif.gz_C crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.9345 37 365
ID Description Score Start End Superfamily
1h6aA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9646 33 165 3.40.50.720
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9263 37 161 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9201 37 162 3.40.50.720
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9138 38 169 3.40.50.720
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9108 38 158 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A059EDH1-F1-model_v4 Glucose-fructose oxidoreductase 0.9557 33 365 GO:0000166
GO:0016491
AF-A0A6L9L9A7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9475 33 365 GO:0000166
GO:0016491
AF-A0A4Q6BVG7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9404 52 365 GO:0000166
GO:0016491
AF-A0A2V6G7H8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9344 35 365 GO:0000166
GO:0016491
AF-A0A1G7HBR9-F1-model_v4 Predicted dehydrogenase 0.9332 32 365 GO:0000166
GO:0016491

Map