F477104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 320 | 715 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10207612|Ga0163163_102076122 |
| Length | 289 |
| Sequence | LGLAPTNREDAVPTDARVLALAIGFAGFMVQAASAQSPGTAAKQESVPMSEAAKSELAPTGVLRAGINLSNFLLVTGKSASGDPQGVSPDMAAEIAKRLGVPVKYVPYKTPGELADMAGTDAWDIGLIGAEPQRAEKIAFTAAYCEIEATYLVPAGSALKAIADVDKPGVRIAVTGRSAYGLWLDRNIKAATLVRSDTLDSAYEQFVKDKLDALAGLRPRLISDVKKLPGARILDGQFTAVQQAVGTSPKNAAGIAFLRKFVEEAKASGFVKQLIERHKVVGLSVAPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 316 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 320 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.28 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.02 |
| Nodule | 0 |
| Rhizoplane | 4.74 |
| Rhizosphere | 86.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000858 | 3300003203 | Bacteria | 14329 |
| 2 | Ga0070676_10145408 | 3300005328 | Bacteria | 1513 |
| 3 | Ga0070683_100076900 | 3300005329 | Bacteria | 3121 |
| 4 | Ga0070670_100049840 | 3300005331 | Bacteria | 3600 |
| 5 | Ga0070666_10096579 | 3300005335 | Unclassified | 2034 |
| 6 | Ga0070666_10382643 | 3300005335 | Bacteria | 1010 |
| 7 | Ga0070680_100015728 | 3300005336 | Bacteria | 5940 |
| 8 | Ga0070680_100018914 | 3300005336 | Bacteria | 5450 |
| 9 | Ga0070660_100035269 | 3300005339 | Bacteria | 3786 |
| 10 | Ga0070660_100057536 | 3300005339 | Bacteria | 3012 |
| 11 | Ga0070689_100021465 | 3300005340 | Bacteria | 4808 |
| 12 | Ga0070691_10008931 | 3300005341 | Bacteria | 4587 |
| 13 | Ga0070691_10200059 | 3300005341 | Bacteria | 1049 |
| 14 | Ga0070661_100002004 | 3300005344 | Bacteria | 14094 |
| 15 | Ga0070661_100030028 | 3300005344 | Bacteria | 3925 |
| 16 | Ga0070668_100060882 | 3300005347 | Bacteria | 2924 |
| 17 | Ga0070668_100094942 | 3300005347 | Bacteria | 2355 |
| 18 | Ga0070671_100086224 | 3300005355 | Bacteria | 2626 |
| 19 | Ga0070671_100144601 | 3300005355 | Bacteria | 2007 |
| 20 | Ga0070671_100288743 | 3300005355 | Bacteria | 1396 |
| 21 | Ga0070673_100038692 | 3300005364 | Bacteria | 3644 |
| 22 | Ga0070673_100243700 | 3300005364 | Bacteria | 1564 |
| 23 | Ga0070673_100580153 | 3300005364 | Bacteria | 1021 |
| 24 | Ga0070659_100125331 | 3300005366 | Bacteria | 2084 |
| 25 | Ga0070667_100067343 | 3300005367 | Bacteria | 3044 |
| 26 | Ga0070667_100428968 | 3300005367 | Bacteria | 1206 |
| 27 | Ga0070703_10144566 | 3300005406 | Bacteria | 887 |
| 28 | Ga0070709_10211631 | 3300005434 | Unclassified | 1378 |
| 29 | Ga0070714_100076874 | 3300005435 | Bacteria | 2899 |
| 30 | Ga0070714_100092897 | 3300005435 | Bacteria | 2645 |
| 31 | Ga0070714_100202842 | 3300005435 | Bacteria | 1815 |
| 32 | Ga0070714_100572269 | 3300005435 | Bacteria | 1083 |
| 33 | Ga0070713_100111353 | 3300005436 | Bacteria | 2387 |
| 34 | Ga0070710_10090443 | 3300005437 | Bacteria | 1804 |
| 35 | Ga0070710_10444076 | 3300005437 | Bacteria | 878 |
| 36 | Ga0070711_100024542 | 3300005439 | Bacteria | 3934 |
| 37 | Ga0070711_100077683 | 3300005439 | Bacteria | 2357 |
| 38 | Ga0070711_100124939 | 3300005439 | Bacteria | 1909 |
| 39 | Ga0070711_100301821 | 3300005439 | Bacteria | 1274 |
| 40 | Ga0070705_100126502 | 3300005440 | Bacteria | 1660 |
| 41 | Ga0070700_100019718 | 3300005441 | Bacteria | 3896 |
| 42 | Ga0070700_100344132 | 3300005441 | Bacteria | 1103 |
| 43 | Ga0070694_100086279 | 3300005444 | Bacteria | 2193 |
| 44 | Ga0070708_100097355 | 3300005445 | Bacteria | 2690 |
| 45 | Ga0070708_100175035 | 3300005445 | Bacteria | 2005 |
| 46 | Ga0070708_100265081 | 3300005445 | Bacteria | 1615 |
| 47 | Ga0070708_100382449 | 3300005445 | Bacteria | 1327 |
| 48 | Ga0070678_100091429 | 3300005456 | Bacteria | 2335 |
| 49 | Ga0070678_100129144 | 3300005456 | Bacteria | 2005 |
| 50 | Ga0070662_100197155 | 3300005457 | Bacteria | 1596 |
| 51 | Ga0070681_10002271 | 3300005458 | Bacteria | 17559 |
| 52 | Ga0070681_10002726 | 3300005458 | Bacteria | 16270 |
| 53 | Ga0070681_10072999 | 3300005458 | Bacteria | 3393 |
| 54 | Ga0070681_10296454 | 3300005458 | Bacteria | 1527 |
| 55 | Ga0068867_100160534 | 3300005459 | Bacteria | 1772 |
| 56 | Ga0070706_100184423 | 3300005467 | Bacteria | 1949 |
| 57 | Ga0070707_100005527 | 3300005468 | Bacteria | 11812 |
| 58 | Ga0070707_100051334 | 3300005468 | Bacteria | 3954 |
| 59 | Ga0070707_100176381 | 3300005468 | Bacteria | 2083 |
| 60 | Ga0070707_100374501 | 3300005468 | Bacteria | 1383 |
| 61 | Ga0070707_100439318 | 3300005468 | Bacteria | 1265 |
| 62 | Ga0070698_100000151 | 3300005471 | Bacteria | 62941 |
| 63 | Ga0070698_100240034 | 3300005471 | Bacteria | 1745 |
| 64 | Ga0070699_100037674 | 3300005518 | Bacteria | 4187 |
| 65 | Ga0070699_100093048 | 3300005518 | Bacteria | 2637 |
| 66 | Ga0070699_100471893 | 3300005518 | Bacteria | 1138 |
| 67 | Ga0070679_100002206 | 3300005530 | Bacteria | 17585 |
| 68 | Ga0070679_100084504 | 3300005530 | Bacteria | 3162 |
| 69 | Ga0070679_100211549 | 3300005530 | Bacteria | 1903 |
| 70 | Ga0070679_100222581 | 3300005530 | Unclassified | 1848 |
| 71 | Ga0070684_100004651 | 3300005535 | Bacteria | 10477 |
| 72 | Ga0070684_100198306 | 3300005535 | Bacteria | 1828 |
| 73 | Ga0070697_100020046 | 3300005536 | Bacteria | 5286 |
| 74 | Ga0068853_100002617 | 3300005539 | Bacteria | 13541 |
| 75 | Ga0070672_100054452 | 3300005543 | Bacteria | 3132 |
| 76 | Ga0070672_100092248 | 3300005543 | Bacteria | 2445 |
| 77 | Ga0070672_100215012 | 3300005543 | Bacteria | 1611 |
| 78 | Ga0070686_100148778 | 3300005544 | Bacteria | 1638 |
| 79 | Ga0070665_100045868 | 3300005548 | Bacteria | 4390 |
| 80 | Ga0070665_100534221 | 3300005548 | Bacteria | 1185 |
| 81 | Ga0070665_100966612 | 3300005548 | Bacteria | 864 |
| 82 | Ga0068855_100006805 | 3300005563 | Bacteria | 13870 |
| 83 | Ga0068855_100064976 | 3300005563 | Bacteria | 4254 |
| 84 | Ga0070664_100006100 | 3300005564 | Bacteria | 9745 |
| 85 | Ga0070664_100081116 | 3300005564 | Bacteria | 2795 |
| 86 | Ga0070664_100178422 | 3300005564 | Bacteria | 1887 |
| 87 | Ga0070664_100221865 | 3300005564 | Bacteria | 1692 |
| 88 | Ga0068857_100082893 | 3300005577 | Bacteria | 2865 |
| 89 | Ga0068857_100338064 | 3300005577 | Bacteria | 1393 |
| 90 | Ga0068857_100379154 | 3300005577 | Bacteria | 1313 |
| 91 | Ga0068857_100786425 | 3300005577 | Bacteria | 908 |
| 92 | Ga0068854_100203316 | 3300005578 | Bacteria | 1558 |
| 93 | Ga0068856_100005989 | 3300005614 | Bacteria | 11971 |
| 94 | Ga0068856_100092197 | 3300005614 | Bacteria | 3014 |
| 95 | Ga0068856_100121296 | 3300005614 | Bacteria | 2616 |
| 96 | Ga0068856_100145805 | 3300005614 | Bacteria | 2375 |
| 97 | Ga0068856_100245538 | 3300005614 | Bacteria | 1805 |
| 98 | Ga0070702_100136597 | 3300005615 | Bacteria | 1556 |
| 99 | Ga0068852_100002176 | 3300005616 | Bacteria | 13431 |
| 100 | Ga0068852_100226473 | 3300005616 | Bacteria | 1780 |
| 101 | Ga0068859_100060184 | 3300005617 | Bacteria | 3827 |
| 102 | Ga0068859_100114911 | 3300005617 | Bacteria | 2756 |
| 103 | Ga0068861_100096125 | 3300005719 | Bacteria | 2347 |
| 104 | Ga0068858_100265659 | 3300005842 | Bacteria | 1632 |
| 105 | Ga0068860_100091970 | 3300005843 | Bacteria | 2890 |
| 106 | Ga0068860_100123087 | 3300005843 | Bacteria | 2485 |
| 107 | Ga0068862_100248007 | 3300005844 | Bacteria | 1622 |
| 108 | Ga0068862_100255562 | 3300005844 | Bacteria | 1598 |
| 109 | Ga0068862_100298786 | 3300005844 | Bacteria | 1481 |
| 110 | Ga0081455_10000058 | 3300005937 | Bacteria | 119171 |
| 111 | Ga0081455_10014280 | 3300005937 | Bacteria | 7794 |
| 112 | Ga0081455_10014867 | 3300005937 | Bacteria | 7590 |
| 113 | Ga0081455_10040186 | 3300005937 | Bacteria | 4127 |
| 114 | Ga0081540_1000040 | 3300005983 | Bacteria | 136968 |
| 115 | Ga0081540_1016800 | 3300005983 | Bacteria | 4561 |
| 116 | Ga0081539_10000118 | 3300005985 | Bacteria | 184562 |
| 117 | Ga0081539_10003667 | 3300005985 | Bacteria | 18436 |
| 118 | Ga0081539_10106698 | 3300005985 | Bacteria | 1417 |
| 119 | Ga0070717_10078984 | 3300006028 | Bacteria | 2758 |
| 120 | Ga0070717_10174947 | 3300006028 | Bacteria | 1868 |
| 121 | Ga0070717_10293321 | 3300006028 | Bacteria | 1444 |
| 122 | Ga0070717_10359992 | 3300006028 | Bacteria | 1302 |
| 123 | Ga0075365_10002405 | 3300006038 | Bacteria | 9164 |
| 124 | Ga0075365_10128891 | 3300006038 | Bacteria | 1750 |
| 125 | Ga0075365_10129417 | 3300006038 | Bacteria | 1746 |
| 126 | Ga0075365_10389289 | 3300006038 | Bacteria | 983 |
| 127 | Ga0075368_10003668 | 3300006042 | Bacteria | 5150 |
| 128 | Ga0075368_10021831 | 3300006042 | Bacteria | 2433 |
| 129 | Ga0075368_10087405 | 3300006042 | Bacteria | 1273 |
| 130 | Ga0075363_100027715 | 3300006048 | Bacteria | 2907 |
| 131 | Ga0075364_10010124 | 3300006051 | Bacteria | 5687 |
| 132 | Ga0075432_10102773 | 3300006058 | Bacteria | 1058 |
| 133 | Ga0070715_10026516 | 3300006163 | Bacteria | 2307 |
| 134 | Ga0070712_100038899 | 3300006175 | Bacteria | 3253 |
| 135 | Ga0070712_100070508 | 3300006175 | Bacteria | 2497 |
| 136 | Ga0070712_100105208 | 3300006175 | Bacteria | 2095 |
| 137 | Ga0070712_100139468 | 3300006175 | Bacteria | 1848 |
| 138 | Ga0070712_100215231 | 3300006175 | Bacteria | 1517 |
| 139 | Ga0075362_10082341 | 3300006177 | Bacteria | 1485 |
| 140 | Ga0075362_10224942 | 3300006177 | Bacteria | 918 |
| 141 | Ga0075367_10083007 | 3300006178 | Bacteria | 1941 |
| 142 | Ga0075369_10001810 | 3300006186 | Bacteria | 7447 |
| 143 | Ga0075428_100026575 | 3300006844 | Bacteria | 6408 |
| 144 | Ga0075428_100112351 | 3300006844 | Bacteria | 2967 |
| 145 | Ga0075428_100145913 | 3300006844 | Bacteria | 2572 |
| 146 | Ga0075428_100450658 | 3300006844 | Bacteria | 1378 |
| 147 | Ga0075428_100579662 | 3300006844 | Bacteria | 1199 |
| 148 | Ga0075430_100059928 | 3300006846 | Bacteria | 3199 |
| 149 | Ga0075430_100147098 | 3300006846 | Bacteria | 1962 |
| 150 | Ga0075430_100236636 | 3300006846 | Bacteria | 1513 |
| 151 | Ga0075430_100339119 | 3300006846 | Bacteria | 1242 |
| 152 | Ga0075430_100544122 | 3300006846 | Bacteria | 957 |
| 153 | Ga0075431_100003740 | 3300006847 | Bacteria | 14780 |
| 154 | Ga0075431_100007662 | 3300006847 | Bacteria | 10752 |
| 155 | Ga0075431_100035511 | 3300006847 | Bacteria | 5132 |
| 156 | Ga0075431_100035737 | 3300006847 | Bacteria | 5116 |
| 157 | Ga0075431_100048763 | 3300006847 | Bacteria | 4368 |
| 158 | Ga0075431_100110767 | 3300006847 | Bacteria | 2833 |
| 159 | Ga0075433_10002457 | 3300006852 | Bacteria | 14094 |
| 160 | Ga0075433_10040255 | 3300006852 | Bacteria | 4045 |
| 161 | Ga0075433_10100652 | 3300006852 | Bacteria | 2559 |
| 162 | Ga0075434_100001552 | 3300006871 | Bacteria | 19464 |
| 163 | Ga0075429_100238900 | 3300006880 | Bacteria | 1591 |
| 164 | Ga0075429_100353646 | 3300006880 | Bacteria | 1286 |
| 165 | Ga0075436_100085191 | 3300006914 | Bacteria | 2193 |
| 166 | Ga0097620_100060186 | 3300006931 | Bacteria | 3827 |
| 167 | Ga0097620_100114908 | 3300006931 | Bacteria | 2756 |
| 168 | Ga0097620_100885767 | 3300006931 | Bacteria | 978 |
| 169 | Ga0075435_100005800 | 3300007076 | Bacteria | 8676 |
| 170 | Ga0075435_100026923 | 3300007076 | Bacteria | 4492 |
| 171 | Ga0075435_100158186 | 3300007076 | Bacteria | 1908 |
| 172 | Ga0099794_10292543 | 3300007265 | Bacteria | 843 |
| 173 | Ga0099795_10151714 | 3300007788 | Bacteria | 949 |
| 174 | Ga0105240_10002630 | 3300009093 | Bacteria | 28616 |
| 175 | Ga0105240_10019378 | 3300009093 | Bacteria | 9090 |
| 176 | Ga0105240_10176907 | 3300009093 | Bacteria | 2522 |
| 177 | Ga0105240_10318233 | 3300009093 | Unclassified | 1774 |
| 178 | Ga0105240_10514520 | 3300009093 | Bacteria | 1329 |
| 179 | Ga0105240_11070846 | 3300009093 | Bacteria | 859 |
| 180 | Ga0111539_10003980 | 3300009094 | Bacteria | 19415 |
| 181 | Ga0111539_10008813 | 3300009094 | Bacteria | 12790 |
| 182 | Ga0111539_10036498 | 3300009094 | Bacteria | 5942 |
| 183 | Ga0111539_10175139 | 3300009094 | Bacteria | 2506 |
| 184 | Ga0111539_10191067 | 3300009094 | Bacteria | 2389 |
| 185 | Ga0105245_10142083 | 3300009098 | Bacteria | 2262 |
| 186 | Ga0105245_10512308 | 3300009098 | Unclassified | 1217 |
| 187 | Ga0105245_10730848 | 3300009098 | Bacteria | 1025 |
| 188 | Ga0114129_10288183 | 3300009147 | Bacteria | 2192 |
| 189 | Ga0114129_10390679 | 3300009147 | Bacteria | 1835 |
| 190 | Ga0114129_11641492 | 3300009147 | Bacteria | 786 |
| 191 | Ga0105243_10244828 | 3300009148 | Bacteria | 1597 |
| 192 | Ga0105243_10700195 | 3300009148 | Bacteria | 987 |
| 193 | Ga0105241_10046486 | 3300009174 | Bacteria | 3296 |
| 194 | Ga0105241_10702071 | 3300009174 | Bacteria | 923 |
| 195 | Ga0105248_10036725 | 3300009177 | Bacteria | 5479 |
| 196 | Ga0105248_10273665 | 3300009177 | Bacteria | 1901 |
| 197 | Ga0105248_10878700 | 3300009177 | Bacteria | 1012 |
| 198 | Ga0105237_10149731 | 3300009545 | Bacteria | 2330 |
| 199 | Ga0105237_10664275 | 3300009545 | Bacteria | 1049 |
| 200 | Ga0105238_10001395 | 3300009551 | Bacteria | 24233 |
| 201 | Ga0105238_10131003 | 3300009551 | Bacteria | 2486 |
| 202 | Ga0105238_10281596 | 3300009551 | Bacteria | 1644 |
| 203 | Ga0105249_10242527 | 3300009553 | Bacteria | 1782 |
| 204 | Ga0105249_10562662 | 3300009553 | Bacteria | 1192 |
| 205 | Ga0105249_10899084 | 3300009553 | Bacteria | 952 |
| 206 | Ga0099796_10083298 | 3300010159 | Bacteria | 1176 |
| 207 | Ga0099796_10178150 | 3300010159 | Bacteria | 852 |
| 208 | Ga0105239_10372967 | 3300010375 | Bacteria | 1613 |
| 209 | Ga0157373_10018195 | 3300013100 | Bacteria | 5117 |
| 210 | Ga0157371_10020398 | 3300013102 | Bacteria | 4877 |
| 211 | Ga0157371_10357717 | 3300013102 | Bacteria | 1063 |
| 212 | Ga0157370_10028222 | 3300013104 | Bacteria | 5524 |
| 213 | Ga0157370_10110453 | 3300013104 | Bacteria | 2570 |
| 214 | Ga0157370_10722170 | 3300013104 | Unclassified | 909 |
| 215 | Ga0157369_10027627 | 3300013105 | Bacteria | 6287 |
| 216 | Ga0157369_10579116 | 3300013105 | Bacteria | 1159 |
| 217 | Ga0157374_10285474 | 3300013296 | Bacteria | 1630 |
| 218 | Ga0157378_10442262 | 3300013297 | Bacteria | 1289 |
| 219 | Ga0163162_10023969 | 3300013306 | Bacteria | 6022 |
| 220 | Ga0157372_10005959 | 3300013307 | Bacteria | 12957 |
| 221 | Ga0157372_10106475 | 3300013307 | Bacteria | 3207 |
| 222 | Ga0157375_10050936 | 3300013308 | Bacteria | 4064 |
| 223 | Ga0163163_10207612 | 3300014325 | Bacteria | 2007 |
| 224 | Ga0157380_10099565 | 3300014326 | Bacteria | 2418 |
| 225 | Ga0157380_10112989 | 3300014326 | Bacteria | 2286 |
| 226 | Ga0157380_10473160 | 3300014326 | Bacteria | 1210 |
| 227 | Ga0182008_10015135 | 3300014497 | Bacteria | 4031 |
| 228 | Ga0157379_10060599 | 3300014968 | Plasmid | 3383 |
| 229 | Ga0157376_10195768 | 3300014969 | Bacteria | 1856 |
| 230 | Ga0157376_10564736 | 3300014969 | Bacteria | 1128 |
| 231 | Ga0163161_10230834 | 3300017792 | Bacteria | 1436 |
| 232 | Ga0213873_10061209 | 3300021358 | Bacteria | 1020 |
| 233 | Ga0213872_10025640 | 3300021361 | Bacteria | 2710 |
| 234 | Ga0213872_10062346 | 3300021361 | Bacteria | 1685 |
| 235 | Ga0213872_10073160 | 3300021361 | Bacteria | 1544 |
| 236 | Ga0213876_10139037 | 3300021384 | Bacteria | 1292 |
| 237 | Ga0213875_10000424 | 3300021388 | Bacteria | 37012 |
| 238 | Ga0213875_10009829 | 3300021388 | Bacteria | 4823 |
| 239 | Ga0213875_10014253 | 3300021388 | Bacteria | 3882 |
| 240 | Ga0213875_10099822 | 3300021388 | Bacteria | 1355 |
| 241 | Ga0213875_10217217 | 3300021388 | Bacteria | 901 |
| 242 | Ga0207682_10119475 | 3300025893 | Bacteria | 1168 |
| 243 | Ga0207692_10044804 | 3300025898 | Bacteria | 2209 |
| 244 | Ga0207680_10086233 | 3300025903 | Bacteria | 1985 |
| 245 | Ga0207680_10328879 | 3300025903 | Bacteria | 1070 |
| 246 | Ga0207685_10013744 | 3300025905 | Bacteria | 2513 |
| 247 | Ga0207699_10058486 | 3300025906 | Bacteria | 2306 |
| 248 | Ga0207699_10126046 | 3300025906 | Unclassified | 1663 |
| 249 | Ga0207705_10029840 | 3300025909 | Bacteria | 3888 |
| 250 | Ga0207705_10190201 | 3300025909 | Bacteria | 1552 |
| 251 | Ga0207705_10346648 | 3300025909 | Bacteria | 1144 |
| 252 | Ga0207684_10068225 | 3300025910 | Bacteria | 3022 |
| 253 | Ga0207684_10082279 | 3300025910 | Bacteria | 2741 |
| 254 | Ga0207707_10041726 | 3300025912 | Bacteria | 4007 |
| 255 | Ga0207707_10100127 | 3300025912 | Bacteria | 2533 |
| 256 | Ga0207707_10264987 | 3300025912 | Bacteria | 1490 |
| 257 | Ga0207695_10197134 | 3300025913 | Unclassified | 1929 |
| 258 | Ga0207695_10228426 | 3300025913 | Bacteria | 1766 |
| 259 | Ga0207695_10324475 | 3300025913 | Bacteria | 1429 |
| 260 | Ga0207693_10015426 | 3300025915 | Bacteria | 6128 |
| 261 | Ga0207693_10021995 | 3300025915 | Bacteria | 5069 |
| 262 | Ga0207693_10055956 | 3300025915 | Bacteria | 3093 |
| 263 | Ga0207693_10171102 | 3300025915 | Bacteria | 1710 |
| 264 | Ga0207693_10192495 | 3300025915 | Bacteria | 1605 |
| 265 | Ga0207693_10202988 | 3300025915 | Bacteria | 1559 |
| 266 | Ga0207693_10282938 | 3300025915 | Bacteria | 1299 |
| 267 | Ga0207693_10397448 | 3300025915 | Bacteria | 1078 |
| 268 | Ga0207660_10355704 | 3300025917 | Bacteria | 1174 |
| 269 | Ga0207657_10029903 | 3300025919 | Bacteria | 4951 |
| 270 | Ga0207657_10296615 | 3300025919 | Bacteria | 1281 |
| 271 | Ga0207649_10003790 | 3300025920 | Bacteria | 8245 |
| 272 | Ga0207649_10025800 | 3300025920 | Bacteria | 3431 |
| 273 | Ga0207652_10006133 | 3300025921 | Bacteria | 9720 |
| 274 | Ga0207652_10113529 | 3300025921 | Bacteria | 2405 |
| 275 | Ga0207652_10127613 | 3300025921 | Bacteria | 2266 |
| 276 | Ga0207652_10145332 | 3300025921 | Bacteria | 2122 |
| 277 | Ga0207646_10008706 | 3300025922 | Bacteria | 10125 |
| 278 | Ga0207646_10117167 | 3300025922 | Bacteria | 2392 |
| 279 | Ga0207646_10438130 | 3300025922 | Bacteria | 1179 |
| 280 | Ga0207646_10465218 | 3300025922 | Bacteria | 1140 |
| 281 | Ga0207694_10071122 | 3300025924 | Bacteria | 2718 |
| 282 | Ga0207694_10241427 | 3300025924 | Bacteria | 1477 |
| 283 | Ga0207650_10047749 | 3300025925 | Bacteria | 3155 |
| 284 | Ga0207659_10097934 | 3300025926 | Bacteria | 2204 |
| 285 | Ga0207687_10088115 | 3300025927 | Bacteria | 2257 |
| 286 | Ga0207687_10164414 | 3300025927 | Bacteria | 1706 |
| 287 | Ga0207700_10029099 | 3300025928 | Bacteria | 3894 |
| 288 | Ga0207700_10056886 | 3300025928 | Bacteria | 2946 |
| 289 | Ga0207700_10214060 | 3300025928 | Bacteria | 1631 |
| 290 | Ga0207700_10261306 | 3300025928 | Bacteria | 1483 |
| 291 | Ga0207664_10036468 | 3300025929 | Bacteria | 3801 |
| 292 | Ga0207664_10130575 | 3300025929 | Bacteria | 2114 |
| 293 | Ga0207664_10311048 | 3300025929 | Bacteria | 1388 |
| 294 | Ga0207664_10503124 | 3300025929 | Bacteria | 1085 |
| 295 | Ga0207644_10008559 | 3300025931 | Bacteria | 6693 |
| 296 | Ga0207644_10367805 | 3300025931 | Bacteria | 1171 |
| 297 | Ga0207644_10395037 | 3300025931 | Bacteria | 1129 |
| 298 | Ga0207690_10053769 | 3300025932 | Bacteria | 2704 |
| 299 | Ga0207706_10019719 | 3300025933 | Bacteria | 6065 |
| 300 | Ga0207706_10271632 | 3300025933 | Bacteria | 1479 |
| 301 | Ga0207709_10066020 | 3300025935 | Bacteria | 2277 |
| 302 | Ga0207670_10049145 | 3300025936 | Bacteria | 2820 |
| 303 | Ga0207670_10179831 | 3300025936 | Bacteria | 1592 |
| 304 | Ga0207665_10050650 | 3300025939 | Bacteria | 2793 |
| 305 | Ga0207691_10005919 | 3300025940 | Bacteria | 11807 |
| 306 | Ga0207691_10115744 | 3300025940 | Bacteria | 2380 |
| 307 | Ga0207711_10020650 | 3300025941 | Bacteria | 5496 |
| 308 | Ga0207711_10276244 | 3300025941 | Bacteria | 1546 |
| 309 | Ga0207661_10019962 | 3300025944 | Bacteria | 5002 |
| 310 | Ga0207661_10370031 | 3300025944 | Bacteria | 1296 |
| 311 | Ga0207661_10717491 | 3300025944 | Bacteria | 920 |
| 312 | Ga0207679_10028203 | 3300025945 | Bacteria | 3892 |
| 313 | Ga0207679_10052364 | 3300025945 | Bacteria | 2993 |
| 314 | Ga0207679_10248931 | 3300025945 | Bacteria | 1510 |
| 315 | Ga0207679_10300607 | 3300025945 | Bacteria | 1383 |
| 316 | Ga0207679_10545839 | 3300025945 | Bacteria | 1039 |
| 317 | Ga0207667_10031492 | 3300025949 | Bacteria | 5725 |
| 318 | Ga0207667_10234870 | 3300025949 | Bacteria | 1877 |
| 319 | Ga0207667_10384343 | 3300025949 | Bacteria | 1430 |
| 320 | Ga0207667_10777094 | 3300025949 | Bacteria | 956 |
| 321 | Ga0207668_10083105 | 3300025972 | Bacteria | 2329 |
| 322 | Ga0207703_10254752 | 3300026035 | Bacteria | 1584 |
| 323 | Ga0207639_10003687 | 3300026041 | Bacteria | 10295 |
| 324 | Ga0207678_10154512 | 3300026067 | Bacteria | 1959 |
| 325 | Ga0207678_10642033 | 3300026067 | Bacteria | 932 |
| 326 | Ga0207708_10008880 | 3300026075 | Bacteria | 7439 |
| 327 | Ga0207708_10366322 | 3300026075 | Bacteria | 1185 |
| 328 | Ga0207708_10406907 | 3300026075 | Bacteria | 1126 |
| 329 | Ga0207702_10014050 | 3300026078 | Bacteria | 6648 |
| 330 | Ga0207702_10049619 | 3300026078 | Plasmid | 3542 |
| 331 | Ga0207702_10057572 | 3300026078 | Bacteria | 3304 |
| 332 | Ga0207702_10155645 | 3300026078 | Bacteria | 2083 |
| 333 | Ga0207641_10038460 | 3300026088 | Bacteria | 4000 |
| 334 | Ga0207648_10165786 | 3300026089 | Bacteria | 1952 |
| 335 | Ga0207648_10218927 | 3300026089 | Bacteria | 1692 |
| 336 | Ga0207648_10607214 | 3300026089 | Bacteria | 1009 |
| 337 | Ga0207676_10645730 | 3300026095 | Bacteria | 1021 |
| 338 | Ga0207676_10791329 | 3300026095 | Bacteria | 925 |
| 339 | Ga0207674_10000005 | 3300026116 | Bacteria | 237935 |
| 340 | Ga0207674_10012502 | 3300026116 | Bacteria | 9484 |
| 341 | Ga0207674_10084065 | 3300026116 | Bacteria | 3181 |
| 342 | Ga0207674_10108400 | 3300026116 | Bacteria | 2754 |
| 343 | Ga0207674_10789946 | 3300026116 | Bacteria | 916 |
| 344 | Ga0207675_100033679 | 3300026118 | Bacteria | 4773 |
| 345 | Ga0207675_100082428 | 3300026118 | Bacteria | 3017 |
| 346 | Ga0207683_10305156 | 3300026121 | Bacteria | 1456 |
| 347 | Ga0207698_10076754 | 3300026142 | Bacteria | 2676 |
| 348 | Ga0207698_10336881 | 3300026142 | Unclassified | 1419 |
| 349 | Ga0209813_10001131 | 3300027866 | Bacteria | 5943 |
| 350 | Ga0207428_10000820 | 3300027907 | Bacteria | 35016 |
| 351 | Ga0207428_10023160 | 3300027907 | Bacteria | 5226 |
| 352 | Ga0207428_10109523 | 3300027907 | Bacteria | 2127 |
| 353 | Ga0207428_10183983 | 3300027907 | Bacteria | 1577 |
| 354 | Ga0207428_10477781 | 3300027907 | Unclassified | 907 |
| 355 | Ga0268265_10191522 | 3300028380 | Bacteria | 1766 |
| 356 | Ga0268265_10515605 | 3300028380 | Bacteria | 1129 |
| 357 | Ga0268265_10606819 | 3300028380 | Bacteria | 1047 |
| 358 | Ga0268264_10217565 | 3300028381 | Bacteria | 1757 |
| 359 | Ga0265338_10110649 | 3300028800 | Bacteria | 2213 |
| 360 | Ga0265762_1033348 | 3300030760 | Bacteria | 985 |
| 361 | Ga0265760_10020451 | 3300031090 | Bacteria | 1911 |
| 362 | Ga0265339_10000047 | 3300031249 | Bacteria | 110601 |
| 363 | Ga0265316_10308211 | 3300031344 | Bacteria | 1152 |
| 364 | Ga0307408_100335510 | 3300031548 | Bacteria | 1278 |
| 365 | Ga0265313_10000069 | 3300031595 | Bacteria | 100065 |
| 366 | Ga0265313_10121941 | 3300031595 | Unclassified | 1136 |
| 367 | Ga0316576_10109279 | 3300031727 | Bacteria | 2072 |
| 368 | Ga0307406_10370964 | 3300031901 | Bacteria | 1125 |
| 369 | Ga0307416_100241314 | 3300032002 | Bacteria | 1751 |
| 370 | Ga0373950_0010782 | 3300034818 | Bacteria | 1483 |
| 371 | Ga0373926_0073934 | 3300035083 | Bacteria | 1255 |
| 372 | Ga0373934_0093214 | 3300035086 | Bacteria | 1215 |
| 373 | Ga0373940_0004606 | 3300035088 | Bacteria | 2925 |
| 374 | Ga0373940_0010882 | 3300035088 | Bacteria | 2150 |
| 375 | Ga0373940_0106758 | 3300035088 | Bacteria | 855 |
| 376 | Ga0373923_0044031 | 3300035111 | Bacteria | 1849 |
| 377 | Ga0373923_0071502 | 3300035111 | Bacteria | 1490 |
| 378 | Ga0373936_0092067 | 3300035113 | Bacteria | 1272 |
| 379 | Ga0373939_0002275 | 3300035114 | Bacteria | 4540 |
| 380 | Ga0373939_0012130 | 3300035114 | Bacteria | 2191 |
| 381 | Ga0373941_0013366 | 3300035115 | Bacteria | 2169 |
| 382 | Ga0373953_0007043 | 3300035117 | Bacteria | 3744 |
| 383 | Ga0373953_0053349 | 3300035117 | Bacteria | 1639 |
| 384 | Ga0373954_0053704 | 3300035118 | Bacteria | 1894 |
| 385 | Ga0373956_0183323 | 3300035119 | Bacteria | 990 |
| 386 | Ga0373957_0043487 | 3300035120 | Unclassified | 1698 |
| 387 | Ga0373957_0066338 | 3300035120 | Bacteria | 1405 |
| 388 | Ga0373946_0077574 | 3300035171 | Bacteria | 1448 |
| 389 | Ga0373946_0089460 | 3300035171 | Bacteria | 1362 |
| 390 | Ga0373955_0013905 | 3300035172 | Bacteria | 3905 |
| 391 | Ga0373955_0037958 | 3300035172 | Bacteria | 2564 |
| 392 | Ga0373942_0016762 | 3300035207 | Bacteria | 1800 |
| 393 | Ga0373942_0081450 | 3300035207 | Bacteria | 962 |
| 394 | Ga0373961_0010010 | 3300035241 | Bacteria | 2331 |
| 395 | Ga0373961_0019586 | 3300035241 | Bacteria | 1780 |
| 396 | Ga0373962_0014124 | 3300035242 | Bacteria | 2031 |
| 397 | Ga0316574_0250935 | 3300035398 | Unclassified | 1131 |
| 398 | Ga0373924_0044852 | 3300035410 | Bacteria | 1818 |
| 399 | Ga0373924_0113203 | 3300035410 | Unclassified | 1174 |
| 400 | Ga0373931_0007066 | 3300035691 | Bacteria | 5278 |
| 401 | Ga0373931_0013645 | 3300035691 | Bacteria | 3960 |
| 402 | Ga0373931_0050747 | 3300035691 | Bacteria | 2208 |
| 403 | Ga0373931_0183971 | 3300035691 | Bacteria | 1239 |
| 404 | Ga0373931_0258801 | 3300035691 | Bacteria | 1061 |
| 405 | Ga0373935_0033555 | 3300035692 | Bacteria | 3195 |
| 406 | Ga0373935_0073612 | 3300035692 | Bacteria | 2207 |
| 407 | Ga0373935_0082099 | 3300035692 | Bacteria | 2097 |
| 408 | Ga0373935_0285236 | 3300035692 | Bacteria | 1163 |
| 409 | Ga0373927_0044150 | 3300035695 | Bacteria | 2884 |
| 410 | Ga0373927_0071306 | 3300035695 | Bacteria | 2249 |
| 411 | Ga0373927_0163066 | 3300035695 | Bacteria | 1461 |
| 412 | Ga0373927_0191689 | 3300035695 | Bacteria | 1341 |
| 413 | Ga0373927_0310970 | 3300035695 | Bacteria | 1037 |
| 414 | Ga0373933_0004861 | 3300035724 | Bacteria | 7334 |
| 415 | Ga0373933_0011796 | 3300035724 | Bacteria | 4826 |
| 416 | Ga0373933_0016852 | 3300035724 | Bacteria | 4094 |
| 417 | Ga0373933_0097211 | 3300035724 | Bacteria | 1823 |
| 418 | Ga0373933_0162416 | 3300035724 | Bacteria | 1419 |
| 419 | Ga0373947_0016322 | 3300035725 | Bacteria | 4268 |
| 420 | Ga0373947_0197397 | 3300035725 | Bacteria | 1315 |
| 421 | Ga0373947_0284726 | 3300035725 | Unclassified | 1099 |
| 422 | Ga0373947_0378709 | 3300035725 | Bacteria | 952 |
| 423 | Ga0373937_0000761 | 3300036401 | Bacteria | 27843 |
| 424 | Ga0373937_0136329 | 3300036401 | Bacteria | 2295 |
| 425 | Ga0373937_0374780 | 3300036401 | Bacteria | 1349 |
| 426 | Ga0316584_0147376 | 3300036712 | Bacteria | 1753 |
| 427 | Ga0373925_0037185 | 3300037068 | Bacteria | 3593 |
| 428 | Ga0373925_0050679 | 3300037068 | Bacteria | 3097 |
| 429 | Ga0373925_0109152 | 3300037068 | Bacteria | 2136 |
| 430 | Ga0373925_0533388 | 3300037068 | Bacteria | 965 |
| 431 | Ga0373925_0685459 | 3300037068 | Bacteria | 845 |
| 432 | Ga0395899_0024032 | 3300037312 | Bacteria | 4609 |
| 433 | Ga0395899_0069251 | 3300037312 | Bacteria | 2584 |
| 434 | Ga0395899_0088176 | 3300037312 | Bacteria | 2251 |
| 435 | Ga0395900_0021639 | 3300037418 | Bacteria | 6574 |
| 436 | Ga0395900_0077801 | 3300037418 | Bacteria | 3408 |
| 437 | Ga0395900_0168974 | 3300037418 | Bacteria | 2227 |
| 438 | Ga0395898_0022898 | 3300037466 | Bacteria | 6317 |
| 439 | Ga0395905_0603119 | 3300037471 | Bacteria | 1000 |
| 440 | Ga0436364_0108726 | 3300037853 | Bacteria | 1264 |
| 441 | Ga0436364_0141915 | 3300037853 | Bacteria | 16587 |
| 442 | Ga0436364_0286343 | 3300037853 | Bacteria | 1598 |
| 443 | Ga0436364_0663275 | 3300037853 | Bacteria | 97909 |
| 444 | Ga0436364_0668296 | 3300037853 | Bacteria | 132076 |
| 445 | Ga0436364_1070480 | 3300037853 | Bacteria | 1140 |
| 446 | Ga0436364_1100698 | 3300037853 | Bacteria | 2819 |
| 447 | Ga0436364_1147233 | 3300037853 | Bacteria | 1375 |
| 448 | Ga0436364_1324861 | 3300037853 | Bacteria | 2239 |
| 449 | Ga0436364_1427712 | 3300037853 | Bacteria | 1088 |
| 450 | Ga0436364_1502786 | 3300037853 | Bacteria | 3112 |
| 451 | Ga0395901_0004105 | 3300038443 | Bacteria | 14682 |
| 452 | Ga0395901_0027696 | 3300038443 | Bacteria | 5826 |
| 453 | Ga0436365_0585284 | 3300039437 | Bacteria | 1374 |
| 454 | Ga0436365_0750241 | 3300039437 | Bacteria | 3919 |
| 455 | Ga0436365_0758860 | 3300039437 | Bacteria | 2253 |
| 456 | Ga0436365_0941153 | 3300039437 | Bacteria | 2382 |
| 457 | Ga0436365_1479190 | 3300039437 | Bacteria | 1623 |
| 458 | Ga0436360_0427988 | 3300039438 | Bacteria | 1983 |
| 459 | Ga0436360_0923341 | 3300039438 | Bacteria | 4418 |
| 460 | Ga0436360_0981069 | 3300039438 | Bacteria | 3532 |
| 461 | Ga0436360_1116770 | 3300039438 | Bacteria | 1047 |
| 462 | Ga0436360_1179304 | 3300039438 | Bacteria | 1252 |
| 463 | Ga0436360_1203512 | 3300039438 | Bacteria | 1343 |
| 464 | Ga0436360_1369054 | 3300039438 | Bacteria | 4584 |
| 465 | Ga0436361_0537570 | 3300039447 | Bacteria | 1563 |
| 466 | Ga0436361_0661457 | 3300039447 | Bacteria | 3507 |
| 467 | Ga0436361_0819334 | 3300039447 | Bacteria | 1666 |
| 468 | Ga0436361_0895546 | 3300039447 | Bacteria | 3935 |
| 469 | Ga0436363_0337004 | 3300039450 | Bacteria | 755 |
| 470 | Ga0436363_0630022 | 3300039450 | Bacteria | 1215 |
| 471 | Ga0436363_1370045 | 3300039450 | Bacteria | 1051 |
| 472 | Ga0436362_0018763 | 3300039453 | Bacteria | 2619 |
| 473 | Ga0436362_0151417 | 3300039453 | Bacteria | 1687 |
| 474 | Ga0436362_0821186 | 3300039453 | Bacteria | 1967 |
| 475 | Ga0436362_0905187 | 3300039453 | Bacteria | 956 |
| 476 | Ga0451807_1379513 | 3300041486 | Unclassified | 1370 |
| 477 | Ga0451577_0058318 | 3300042876 | Bacteria | 3442 |
| 478 | Ga0466963_0034271 | 3300044694 | Bacteria | 3303 |
| 479 | Ga0466963_0063652 | 3300044694 | Bacteria | 2469 |
| 480 | Ga0466963_0139486 | 3300044694 | Bacteria | 1679 |
| 481 | Ga0453684_0221968 | 3300044712 | Bacteria | 2189 |
| 482 | Ga0466957_0029268 | 3300044842 | Bacteria | 3283 |
| 483 | Ga0466960_0159009 | 3300044901 | Bacteria | 1212 |
| 484 | Ga0451576_0000231 | 3300045051 | Bacteria | 136040 |
| 485 | Ga0466958_0278385 | 3300045836 | Unclassified | 1072 |
| 486 | Ga0466967_0017620 | 3300045976 | Bacteria | 5679 |
| 487 | Ga0466967_0047199 | 3300045976 | Bacteria | 3754 |
| 488 | Ga0466967_0434529 | 3300045976 | Bacteria | 1281 |
| 489 | Ga0466967_0541993 | 3300045976 | Bacteria | 1145 |
| 490 | Ga0466967_0820418 | 3300045976 | Bacteria | 924 |
| 491 | Ga0495592_0207647 | 3300046454 | Unclassified | 1317 |
| 492 | Ga0495592_0296424 | 3300046454 | Bacteria | 1052 |
| 493 | Ga0495592_0457795 | 3300046454 | Bacteria | 798 |
| 494 | Ga0495603_0060560 | 3300046455 | Bacteria | 2237 |
| 495 | Ga0495629_0009132 | 3300046459 | Bacteria | 7262 |
| 496 | Ga0495629_0050778 | 3300046459 | Bacteria | 2904 |
| 497 | Ga0495629_0324725 | 3300046459 | Bacteria | 1052 |
| 498 | Ga0495651_0001110 | 3300046462 | Bacteria | 20796 |
| 499 | Ga0495651_0035681 | 3300046462 | Bacteria | 3871 |
| 500 | Ga0495651_0210964 | 3300046462 | Bacteria | 1351 |
| 501 | Ga0495653_0015948 | 3300046463 | Bacteria | 6125 |
| 502 | Ga0495580_0033025 | 3300046472 | Bacteria | 3730 |
| 503 | Ga0495580_0331218 | 3300046472 | Bacteria | 1034 |
| 504 | Ga0495582_0201455 | 3300046473 | Bacteria | 1137 |
| 505 | Ga0495664_0003048 | 3300046477 | Bacteria | 9072 |
| 506 | Ga0495664_0203852 | 3300046477 | Unclassified | 1198 |
| 507 | Ga0495664_0451982 | 3300046477 | Bacteria | 769 |
| 508 | Ga0495594_0091952 | 3300046499 | Bacteria | 1701 |
| 509 | Ga0495608_0002474 | 3300046511 | Bacteria | 13250 |
| 510 | Ga0495608_0003631 | 3300046511 | Bacteria | 11079 |
| 511 | Ga0495608_0010040 | 3300046511 | Bacteria | 6604 |
| 512 | Ga0495608_0346536 | 3300046511 | Unclassified | 915 |
| 513 | Ga0495618_0004450 | 3300046514 | Bacteria | 8617 |
| 514 | Ga0495618_0243946 | 3300046514 | Bacteria | 1129 |
| 515 | Ga0495628_0026011 | 3300046516 | Bacteria | 4778 |
| 516 | Ga0495628_0162703 | 3300046516 | Bacteria | 1695 |
| 517 | Ga0495630_0188579 | 3300046517 | Bacteria | 1573 |
| 518 | Ga0495642_0092971 | 3300046528 | Bacteria | 1278 |
| 519 | Ga0495652_0008869 | 3300046529 | Bacteria | 9150 |
| 520 | Ga0495640_0013010 | 3300046533 | Bacteria | 6339 |
| 521 | Ga0495640_0013014 | 3300046533 | Bacteria | 6337 |
| 522 | Ga0495640_0089210 | 3300046533 | Bacteria | 2037 |
| 523 | Ga0495640_0095657 | 3300046533 | Bacteria | 1955 |
| 524 | Ga0495640_0302616 | 3300046533 | Bacteria | 993 |
| 525 | Ga0495587_0003059 | 3300046536 | Bacteria | 11171 |
| 526 | Ga0495587_0003972 | 3300046536 | Bacteria | 9806 |
| 527 | Ga0495587_0126345 | 3300046536 | Bacteria | 1463 |
| 528 | Ga0495645_0026353 | 3300046543 | Bacteria | 4219 |
| 529 | Ga0495645_0130339 | 3300046543 | Bacteria | 1763 |
| 530 | Ga0495645_0197727 | 3300046543 | Bacteria | 1366 |
| 531 | Ga0495645_0327354 | 3300046543 | Bacteria | 993 |
| 532 | Ga0495667_0002458 | 3300046559 | Bacteria | 12367 |
| 533 | Ga0495667_0095069 | 3300046559 | Bacteria | 1930 |
| 534 | Ga0495667_0217275 | 3300046559 | Bacteria | 1221 |
| 535 | Ga0495634_0021446 | 3300046642 | Bacteria | 4566 |
| 536 | Ga0495634_0315460 | 3300046642 | Bacteria | 942 |
| 537 | Ga0495635_0134069 | 3300046663 | Bacteria | 1688 |
| 538 | Ga0495635_0263073 | 3300046663 | Bacteria | 1161 |
| 539 | Ga0495599_0006436 | 3300046678 | Bacteria | 7084 |
| 540 | Ga0495599_0194900 | 3300046678 | Bacteria | 1245 |
| 541 | Ga0495623_0054108 | 3300046679 | Bacteria | 2533 |
| 542 | Ga0495623_0056199 | 3300046679 | Unclassified | 2478 |
| 543 | Ga0495646_0024219 | 3300046680 | Bacteria | 3823 |
| 544 | Ga0495646_0092056 | 3300046680 | Unclassified | 1749 |
| 545 | Ga0495658_0044840 | 3300046683 | Bacteria | 2479 |
| 546 | Ga0495658_0364690 | 3300046683 | Bacteria | 919 |
| 547 | Ga0495669_0003664 | 3300046684 | Bacteria | 6327 |
| 548 | Ga0495613_0160950 | 3300046689 | Bacteria | 1597 |
| 549 | Ga0495613_0243124 | 3300046689 | Bacteria | 1258 |
| 550 | Ga0495613_0326434 | 3300046689 | Bacteria | 1058 |
| 551 | Ga0495670_0149208 | 3300046691 | Bacteria | 1226 |
| 552 | Ga0495600_0001916 | 3300046809 | Bacteria | 11682 |
| 553 | Ga0495600_0033817 | 3300046809 | Unclassified | 3319 |
| 554 | Ga0495600_0213057 | 3300046809 | Bacteria | 1237 |
| 555 | Ga0495581_0114871 | 3300047315 | Bacteria | 1566 |
| 556 | Ga0495581_0430511 | 3300047315 | Bacteria | 769 |
| 557 | Ga0495604_0016624 | 3300047317 | Bacteria | 5884 |
| 558 | Ga0495604_0237929 | 3300047317 | Bacteria | 1246 |
| 559 | Ga0495604_0309282 | 3300047317 | Unclassified | 1059 |
| 560 | Ga0495636_0223409 | 3300047318 | Bacteria | 865 |
| 561 | Ga0495674_0002245 | 3300047319 | Bacteria | 18988 |
| 562 | Ga0495676_0373977 | 3300047321 | Bacteria | 949 |
| 563 | Ga0495680_0001116 | 3300047322 | Bacteria | 29627 |
| 564 | Ga0495680_0109017 | 3300047322 | Bacteria | 2054 |
| 565 | Ga0495675_0008949 | 3300047444 | Bacteria | 6225 |
| 566 | Ga0495675_0009772 | 3300047444 | Bacteria | 5983 |
| 567 | Ga0495684_0080283 | 3300047471 | Bacteria | 2476 |
| 568 | Ga0495684_0215571 | 3300047471 | Bacteria | 1410 |
| 569 | Ga0495602_0000398 | 3300048088 | Bacteria | 40599 |
| 570 | Ga0495602_0003277 | 3300048088 | Bacteria | 16722 |
| 571 | Ga0495602_0083357 | 3300048088 | Bacteria | 2679 |
| 572 | Ga0496100_0189029 | 3300048903 | Bacteria | 1494 |
| 573 | Ga0496100_0317406 | 3300048903 | Bacteria | 1170 |
| 574 | Ga0496101_0226698 | 3300048904 | Bacteria | 1452 |
| 575 | Ga0496102_0130395 | 3300048905 | Bacteria | 2352 |
| 576 | Ga0496102_0252018 | 3300048905 | Bacteria | 1665 |
| 577 | Ga0496104_0000182 | 3300048907 | Bacteria | 56117 |
| 578 | Ga0496104_0157687 | 3300048907 | Bacteria | 2178 |
| 579 | Ga0496104_0161275 | 3300048907 | Bacteria | 2151 |
| 580 | Ga0496104_0256037 | 3300048907 | Bacteria | 1663 |
| 581 | Ga0496104_0951254 | 3300048907 | Bacteria | 763 |
| 582 | Ga0496105_0018209 | 3300048908 | Bacteria | 5640 |
| 583 | Ga0496106_0042250 | 3300048909 | Bacteria | 3419 |
| 584 | Ga0496107_0084564 | 3300048910 | Bacteria | 2315 |
| 585 | Ga0496108_0014116 | 3300048911 | Bacteria | 6516 |
| 586 | Ga0496108_0144705 | 3300048911 | Bacteria | 2049 |
| 587 | Ga0496108_0338840 | 3300048911 | Unclassified | 1312 |
| 588 | Ga0496109_0004093 | 3300048912 | Bacteria | 12190 |
| 589 | Ga0496109_0084299 | 3300048912 | Bacteria | 2932 |
| 590 | Ga0496109_0311928 | 3300048912 | Bacteria | 1484 |
| 591 | Ga0496110_0009439 | 3300048913 | Bacteria | 7902 |
| 592 | Ga0496110_0062738 | 3300048913 | Bacteria | 3283 |
| 593 | Ga0496111_0006863 | 3300048914 | Bacteria | 7430 |
| 594 | Ga0496111_0069536 | 3300048914 | Bacteria | 2560 |
| 595 | Ga0496111_0089794 | 3300048914 | Bacteria | 2251 |
| 596 | Ga0496112_0022376 | 3300048915 | Bacteria | 6025 |
| 597 | Ga0496112_0045592 | 3300048915 | Bacteria | 4298 |
| 598 | Ga0496112_0072626 | 3300048915 | Bacteria | 3401 |
| 599 | Ga0496112_0142143 | 3300048915 | Unclassified | 2369 |
| 600 | Ga0496112_0231401 | 3300048915 | Bacteria | 1803 |
| 601 | Ga0496113_0008368 | 3300048916 | Bacteria | 6739 |
| 602 | Ga0496113_0770174 | 3300048916 | Bacteria | 766 |
| 603 | Ga0496115_0219333 | 3300048918 | Bacteria | 1570 |
| 604 | Ga0496115_0368809 | 3300048918 | Unclassified | 1169 |
| 605 | Ga0496119_0021644 | 3300048922 | Bacteria | 4636 |
| 606 | Ga0496120_0010331 | 3300048923 | Bacteria | 6525 |
| 607 | Ga0496126_0019977 | 3300048929 | Bacteria | 6582 |
| 608 | Ga0501034_0015519 | 3300049571 | Bacteria | 7826 |
| 609 | Ga0501036_0585873 | 3300049572 | Bacteria | 926 |
| 610 | Ga0501037_0543421 | 3300049573 | Bacteria | 785 |
| 611 | Ga0501039_0507502 | 3300049575 | Bacteria | 947 |
| 612 | Ga0501040_0014149 | 3300049576 | Bacteria | 5252 |
| 613 | Ga0501046_0331248 | 3300049580 | Bacteria | 1108 |
| 614 | Ga0501047_0049032 | 3300049581 | Bacteria | 4078 |
| 615 | Ga0501048_0254716 | 3300049582 | Bacteria | 1247 |
| 616 | Ga0501070_0001514 | 3300049586 | Bacteria | 20720 |
| 617 | Ga0501072_0015465 | 3300049588 | Bacteria | 5850 |
| 618 | Ga0501072_0043292 | 3300049588 | Bacteria | 3538 |
| 619 | Ga0501072_0055740 | 3300049588 | Bacteria | 3115 |
| 620 | Ga0501072_0368856 | 3300049588 | Bacteria | 1140 |
| 621 | Ga0501073_0109984 | 3300049589 | Bacteria | 1912 |
| 622 | Ga0501074_0024883 | 3300049590 | Bacteria | 4349 |
| 623 | Ga0501075_0096213 | 3300049591 | Bacteria | 2247 |
| 624 | Ga0501075_0135227 | 3300049591 | Bacteria | 1878 |
| 625 | Ga0501075_0330944 | 3300049591 | Bacteria | 1161 |
| 626 | Ga0501076_0009242 | 3300049592 | Bacteria | 7272 |
| 627 | Ga0501076_0502018 | 3300049592 | Bacteria | 1000 |
| 628 | Ga0501077_0046065 | 3300049593 | Bacteria | 2771 |
| 629 | Ga0501077_0262511 | 3300049593 | Bacteria | 1098 |
| 630 | Ga0501079_0006102 | 3300049741 | Bacteria | 9033 |
| 631 | Ga0501079_0017971 | 3300049741 | Bacteria | 5399 |
| 632 | Ga0501079_0139779 | 3300049741 | Bacteria | 1886 |
| 633 | Ga0501079_0679599 | 3300049741 | Bacteria | 810 |
| 634 | Ga0501080_0109882 | 3300049742 | Bacteria | 2555 |
| 635 | Ga0501080_0318290 | 3300049742 | Unclassified | 1409 |
| 636 | Ga0501080_0346834 | 3300049742 | Unclassified | 1341 |
| 637 | Ga0501081_0016815 | 3300049743 | Bacteria | 4836 |
| 638 | Ga0501081_0182537 | 3300049743 | Bacteria | 1518 |
| 639 | Ga0501035_0313992 | 3300049822 | Bacteria | 1318 |
| 640 | Ga0501044_0141440 | 3300049823 | Bacteria | 2395 |
| 641 | Ga0501044_0444430 | 3300049823 | Bacteria | 1204 |
| 642 | Ga0501045_0249183 | 3300049824 | Bacteria | 1322 |
| 643 | nmdc:mga03683_103395_c1 | 3300050489 | Bacteria | 1254 |
| 644 | nmdc:mga03683_32200_c1 | 3300050489 | Bacteria | 2108 |
| 645 | nmdc:mga03683_58390_c1 | 3300050489 | Bacteria | 1626 |
| 646 | nmdc:mga03n38_40237_c1 | 3300050490 | Bacteria | 2031 |
| 647 | nmdc:mga00v17_49624_c1 | 3300050491 | Bacteria | 2547 |
| 648 | nmdc:mga0yw44_157233_c1 | 3300050492 | Bacteria | 1486 |
| 649 | nmdc:mga0yw44_2874_c1 | 3300050492 | Bacteria | 7483 |
| 650 | nmdc:mga0yw44_85847_c1 | 3300050492 | Bacteria | 1981 |
| 651 | nmdc:mga0yw44_9815_c1 | 3300050492 | Bacteria | 4861 |
| 652 | nmdc:mga0k408_213338_c1 | 3300050493 | Bacteria | 1153 |
| 653 | nmdc:mga06z11_103120_c1 | 3300050494 | Bacteria | 1568 |
| 654 | nmdc:mga06z11_45433_c1 | 3300050494 | Bacteria | 2220 |
| 655 | nmdc:mga06z11_65071_c1 | 3300050494 | Bacteria | 1913 |
| 656 | nmdc:mga06z11_90393_c1 | 3300050494 | Bacteria | 1661 |
| 657 | nmdc:mga04h51_5824_c1 | 3300050495 | Bacteria | 3159 |
| 658 | nmdc:mga09592_373772_c1 | 3300050508 | Bacteria | 1233 |
| 659 | nmdc:mga0qj67_21559_c1 | 3300050509 | Bacteria | 4943 |
| 660 | nmdc:mga0qj67_229684_c1 | 3300050509 | Bacteria | 1506 |
| 661 | nmdc:mga0qj67_34476_c1 | 3300050509 | Bacteria | 3954 |
| 662 | nmdc:mga0qj67_382766_c1 | 3300050509 | Bacteria | 1136 |
| 663 | nmdc:mga0qj67_39099_c1 | 3300050509 | Bacteria | 3724 |
| 664 | nmdc:mga0qj67_95065_c1 | 3300050509 | Bacteria | 2398 |
| 665 | nmdc:mga06r32_32644_c1 | 3300050510 | Bacteria | 4900 |
| 666 | nmdc:mga06r32_33534_c1 | 3300050510 | Bacteria | 4836 |
| 667 | nmdc:mga06r32_3463_c1 | 3300050510 | Bacteria | 14091 |
| 668 | nmdc:mga06r32_46521_c1 | 3300050510 | Bacteria | 4140 |
| 669 | nmdc:mga06r32_47421_c1 | 3300050510 | Bacteria | 4104 |
| 670 | nmdc:mga06r32_607844_c1 | 3300050510 | Bacteria | 1064 |
| 671 | nmdc:mga06r32_93534_c1 | 3300050510 | Bacteria | 2940 |
| 672 | nmdc:mga08y16_13096_c1 | 3300050511 | Bacteria | 8725 |
| 673 | nmdc:mga08y16_334135_c1 | 3300050511 | Bacteria | 1558 |
| 674 | nmdc:mga08y16_70455_c1 | 3300050511 | Bacteria | 3645 |
| 675 | nmdc:mga08y16_864617_c1 | 3300050511 | Unclassified | 893 |
| 676 | nmdc:mga08y16_87880_c1 | 3300050511 | Bacteria | 3239 |
| 677 | nmdc:mga0n895_207504_c1 | 3300050512 | Bacteria | 1990 |
| 678 | nmdc:mga0n895_896_c1 | 3300050512 | Bacteria | 21473 |
| 679 | nmdc:mga0rr50_455280_c1 | 3300050513 | Bacteria | 1085 |
| 680 | nmdc:mga0rr50_5196_c1 | 3300050513 | Bacteria | 7739 |
| 681 | nmdc:mga0rr50_8180_c1 | 3300050513 | Bacteria | 6494 |
| 682 | nmdc:mga08x19_15172_c1 | 3300050514 | Bacteria | 4684 |
| 683 | nmdc:mga0a205_206901_c1 | 3300050515 | Bacteria | 1851 |
| 684 | nmdc:mga0a205_2921_c1 | 3300050515 | Bacteria | 15133 |
| 685 | nmdc:mga0sz30_1852_c2 | 3300050516 | Bacteria | 1449 |
| 686 | nmdc:mga0sz30_498_c1 | 3300050516 | Bacteria | 14575 |
| 687 | Ga0495601_0000712 | 3300053077 | Bacteria | 17859 |
| 688 | Ga0495601_0002860 | 3300053077 | Bacteria | 9810 |
| 689 | Ga0495601_0297200 | 3300053077 | Bacteria | 1052 |
| 690 | Ga0495612_0001184 | 3300053078 | Bacteria | 10747 |
| 691 | Ga0495612_0118627 | 3300053078 | Bacteria | 1137 |
| 692 | Ga0495612_0199031 | 3300053078 | Unclassified | 883 |
| 693 | Ga0495595_0000196 | 3300053084 | Bacteria | 24609 |
| 694 | Ga0495595_0006523 | 3300053084 | Bacteria | 4759 |
| 695 | Ga0495595_0016485 | 3300053084 | Bacteria | 3162 |
| 696 | Ga0495595_0021033 | 3300053084 | Bacteria | 2847 |
| 697 | Ga0495595_0146977 | 3300053084 | Bacteria | 1158 |
| 698 | Ga0495595_0296113 | 3300053084 | Unclassified | 813 |
| 699 | Ga0495619_0004840 | 3300053085 | Bacteria | 8547 |
| 700 | Ga0495619_0009682 | 3300053085 | Bacteria | 6076 |
| 701 | Ga0495619_0116253 | 3300053085 | Bacteria | 1831 |
| 702 | Ga0500651_0223322 | 3300053093 | Bacteria | 1104 |
| 703 | Ga0500577_0129207 | 3300053142 | Bacteria | 1058 |
| 704 | Ga0500616_0002029 | 3300053153 | Bacteria | 17855 |
| 705 | Ga0500620_010418 | 3300053155 | Bacteria | 2446 |
| 706 | Ga0500552_000491 | 3300053733 | Bacteria | 3661 |
| 707 | Ga0501084_0071843 | 3300054114 | Bacteria | 2898 |
| 708 | Ga0501084_0104908 | 3300054114 | Bacteria | 2374 |
| 709 | Ga0501082_0042769 | 3300060353 | Bacteria | 3905 |
| 710 | Ga0501082_0053454 | 3300060353 | Bacteria | 3482 |
| 711 | Ga0501082_0409096 | 3300060353 | Bacteria | 1184 |
| 712 | Ga0501082_0456676 | 3300060353 | Bacteria | 1116 |
| 713 | Ga0530510_0024319 | 3300061734 | Bacteria | 4321 |
| 714 | Ga0530510_0035765 | 3300061734 | Bacteria | 3580 |
| 715 | Ga0530510_0297382 | 3300061734 | Bacteria | 1208 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0337004 | Ga0436363_0337004_83_685 | 197 |
| 2 | 3300047317 | Ga0495604_0309282 | Ga0495604_0309282_279_965 | 224 |
| 3 | 3300053084 | Ga0495595_0296113 | Ga0495595_0296113_95_781 | 224 |
| 4 | 3300053085 | Ga0495619_0116253 | Ga0495619_0116253_53_739 | 224 |
| 5 | 3300009147 | Ga0114129_10288183 | Ga0114129_102881831 | 226 |
| 6 | 3300046559 | Ga0495667_0095069 | Ga0495667_0095069_1029_1769 | 226 |
| 7 | 3300005445 | Ga0070708_100265081 | Ga0070708_1002650812 | 227 |
| 8 | 3300005468 | Ga0070707_100374501 | Ga0070707_1003745012 | 227 |
| 9 | 3300005518 | Ga0070699_100471893 | Ga0070699_1004718932 | 227 |
| 10 | 3300025910 | Ga0207684_10082279 | Ga0207684_100822792 | 227 |
| 11 | 3300025922 | Ga0207646_10438130 | Ga0207646_104381302 | 227 |
| 12 | 3300027907 | Ga0207428_10000820 | Ga0207428_100008205 | 230 |
| 13 | 3300039438 | Ga0436360_0981069 | Ga0436360_0981069_2629_3360 | 230 |
| 14 | 3300039453 | Ga0436362_0151417 | Ga0436362_0151417_789_1520 | 230 |
| 15 | 3300037068 | Ga0373925_0109152 | Ga0373925_0109152_590_1315 | 231 |
| 16 | 3300005340 | Ga0070689_100021465 | Ga0070689_1000214654 | 232 |
| 17 | 3300006177 | Ga0075362_10224942 | Ga0075362_102249422 | 232 |
| 18 | 3300035241 | Ga0373961_0019586 | Ga0373961_0019586_302_1006 | 232 |
| 19 | 3300050489 | nmdc:mga03683_32200_c1 | nmdc:mga03683_32200_c1_497_1222 | 232 |
| 20 | 3300050493 | nmdc:mga0k408_213338_c1 | nmdc:mga0k408_213338_c1_17_742 | 232 |
| 21 | 3300005445 | Ga0070708_100097355 | Ga0070708_1000973552 | 233 |
| 22 | 3300005536 | Ga0070697_100020046 | Ga0070697_1000200467 | 233 |
| 23 | 3300005328 | Ga0070676_10145408 | Ga0070676_101454082 | 234 |
| 24 | 3300005331 | Ga0070670_100049840 | Ga0070670_1000498402 | 234 |
| 25 | 3300005335 | Ga0070666_10096579 | Ga0070666_100965792 | 234 |
| 26 | 3300005355 | Ga0070671_100086224 | Ga0070671_1000862241 | 234 |
| 27 | 3300005364 | Ga0070673_100038692 | Ga0070673_1000386921 | 234 |
| 28 | 3300005367 | Ga0070667_100067343 | Ga0070667_1000673434 | 234 |
| 29 | 3300005543 | Ga0070672_100092248 | Ga0070672_1000922482 | 234 |
| 30 | 3300005548 | Ga0070665_100045868 | Ga0070665_1000458682 | 234 |
| 31 | 3300005615 | Ga0070702_100136597 | Ga0070702_1001365972 | 234 |
| 32 | 3300005617 | Ga0068859_100114911 | Ga0068859_1001149112 | 234 |
| 33 | 3300006931 | Ga0097620_100114908 | Ga0097620_1001149082 | 234 |
| 34 | 3300009098 | Ga0105245_10142083 | Ga0105245_101420832 | 234 |
| 35 | 3300014968 | Ga0157379_10060599 | Ga0157379_100605993 | 234 |
| 36 | 3300025903 | Ga0207680_10086233 | Ga0207680_100862332 | 234 |
| 37 | 3300025915 | Ga0207693_10015426 | Ga0207693_100154261 | 234 |
| 38 | 3300025925 | Ga0207650_10047749 | Ga0207650_100477494 | 234 |
| 39 | 3300025927 | Ga0207687_10164414 | Ga0207687_101644142 | 234 |
| 40 | 3300025931 | Ga0207644_10008559 | Ga0207644_100085595 | 234 |
| 41 | 3300025936 | Ga0207670_10049145 | Ga0207670_100491454 | 234 |
| 42 | 3300025940 | Ga0207691_10115744 | Ga0207691_101157442 | 234 |
| 43 | 3300025945 | Ga0207679_10545839 | Ga0207679_105458391 | 234 |
| 44 | 3300048911 | Ga0496108_0338840 | Ga0496108_0338840_206_919 | 234 |
| 45 | 3300048914 | Ga0496111_0089794 | Ga0496111_0089794_54_767 | 234 |
| 46 | iso_pu_bacteria | 2929199973 | 2929200466 | 235 |
| 47 | iso_pu_bacteria | 8055909800 | 8055914638 | 235 |
| 48 | 3300005530 | Ga0070679_100211549 | Ga0070679_1002115492 | 237 |
| 49 | 3300007265 | Ga0099794_10292543 | Ga0099794_102925431 | 237 |
| 50 | 3300021388 | Ga0213875_10014253 | Ga0213875_100142532 | 237 |
| 51 | 3300025921 | Ga0207652_10113529 | Ga0207652_101135292 | 237 |
| 52 | 3300025949 | Ga0207667_10777094 | Ga0207667_107770942 | 237 |
| 53 | 3300037853 | Ga0436364_0141915 | Ga0436364_0141915_13273_13986 | 237 |
| 54 | 3300048907 | Ga0496104_0951254 | Ga0496104_0951254_14_748 | 237 |
| 55 | 3300048913 | Ga0496110_0062738 | Ga0496110_0062738_1966_2700 | 237 |
| 56 | 3300048915 | Ga0496112_0072626 | Ga0496112_0072626_1299_2033 | 237 |
| 57 | 3300006175 | Ga0070712_100038899 | Ga0070712_1000388994 | 238 |
| 58 | 3300025915 | Ga0207693_10202988 | Ga0207693_102029882 | 238 |
| 59 | 3300030760 | Ga0265762_1033348 | Ga0265762_10333481 | 238 |
| 60 | 3300031090 | Ga0265760_10020451 | Ga0265760_100204512 | 238 |
| 61 | 3300035691 | Ga0373931_0258801 | Ga0373931_0258801_327_1043 | 238 |
| 62 | 3300039438 | Ga0436360_1179304 | Ga0436360_1179304_377_1099 | 238 |
| 63 | 3300042876 | Ga0451577_0058318 | Ga0451577_0058318_232_948 | 238 |
| 64 | 3300045051 | Ga0451576_0000231 | Ga0451576_0000231_12239_12961 | 238 |
| 65 | 3300048904 | Ga0496101_0226698 | Ga0496101_0226698_40_762 | 238 |
| 66 | 3300048905 | Ga0496102_0252018 | Ga0496102_0252018_632_1354 | 238 |
| 67 | 3300048907 | Ga0496104_0161275 | Ga0496104_0161275_845_1567 | 238 |
| 68 | 3300048910 | Ga0496107_0084564 | Ga0496107_0084564_204_926 | 238 |
| 69 | 3300048911 | Ga0496108_0144705 | Ga0496108_0144705_138_860 | 238 |
| 70 | 3300048915 | Ga0496112_0022376 | Ga0496112_0022376_2031_2753 | 238 |
| 71 | 3300048918 | Ga0496115_0219333 | Ga0496115_0219333_168_890 | 238 |
| 72 | 3300049823 | Ga0501044_0141440 | Ga0501044_0141440_1153_1884 | 238 |
| 73 | 3300053084 | Ga0495595_0006523 | Ga0495595_0006523_1145_1873 | 238 |
| 74 | 3300053085 | Ga0495619_0004840 | Ga0495619_0004840_5046_5774 | 238 |
| 75 | 3300003203 | JGI25406J46586_10000858 | JGI25406J46586_100008586 | 239 |
| 76 | 3300005329 | Ga0070683_100076900 | Ga0070683_1000769002 | 239 |
| 77 | 3300005335 | Ga0070666_10382643 | Ga0070666_103826431 | 239 |
| 78 | 3300005336 | Ga0070680_100015728 | Ga0070680_1000157284 | 239 |
| 79 | 3300005336 | Ga0070680_100018914 | Ga0070680_1000189142 | 239 |
| 80 | 3300005339 | Ga0070660_100035269 | Ga0070660_1000352692 | 239 |
| 81 | 3300005339 | Ga0070660_100057536 | Ga0070660_1000575362 | 239 |
| 82 | 3300005341 | Ga0070691_10008931 | Ga0070691_100089312 | 239 |
| 83 | 3300005341 | Ga0070691_10200059 | Ga0070691_102000591 | 239 |
| 84 | 3300005344 | Ga0070661_100002004 | Ga0070661_10000200414 | 239 |
| 85 | 3300005344 | Ga0070661_100030028 | Ga0070661_1000300282 | 239 |
| 86 | 3300005347 | Ga0070668_100060882 | Ga0070668_1000608823 | 239 |
| 87 | 3300005347 | Ga0070668_100094942 | Ga0070668_1000949422 | 239 |
| 88 | 3300005355 | Ga0070671_100144601 | Ga0070671_1001446012 | 239 |
| 89 | 3300005355 | Ga0070671_100288743 | Ga0070671_1002887432 | 239 |
| 90 | 3300005364 | Ga0070673_100243700 | Ga0070673_1002437002 | 239 |
| 91 | 3300005364 | Ga0070673_100580153 | Ga0070673_1005801531 | 239 |
| 92 | 3300005366 | Ga0070659_100125331 | Ga0070659_1001253312 | 239 |
| 93 | 3300005367 | Ga0070667_100428968 | Ga0070667_1004289681 | 239 |
| 94 | 3300005406 | Ga0070703_10144566 | Ga0070703_101445661 | 239 |
| 95 | 3300005434 | Ga0070709_10211631 | Ga0070709_102116311 | 239 |
| 96 | 3300005435 | Ga0070714_100076874 | Ga0070714_1000768742 | 239 |
| 97 | 3300005435 | Ga0070714_100092897 | Ga0070714_1000928972 | 239 |
| 98 | 3300005435 | Ga0070714_100202842 | Ga0070714_1002028421 | 239 |
| 99 | 3300005435 | Ga0070714_100572269 | Ga0070714_1005722691 | 239 |
| 100 | 3300005436 | Ga0070713_100111353 | Ga0070713_1001113532 | 239 |
| 101 | 3300005437 | Ga0070710_10090443 | Ga0070710_100904432 | 239 |
| 102 | 3300005437 | Ga0070710_10444076 | Ga0070710_104440761 | 239 |
| 103 | 3300005439 | Ga0070711_100024542 | Ga0070711_1000245423 | 239 |
| 104 | 3300005439 | Ga0070711_100077683 | Ga0070711_1000776832 | 239 |
| 105 | 3300005439 | Ga0070711_100124939 | Ga0070711_1001249392 | 239 |
| 106 | 3300005439 | Ga0070711_100301821 | Ga0070711_1003018211 | 239 |
| 107 | 3300005440 | Ga0070705_100126502 | Ga0070705_1001265022 | 239 |
| 108 | 3300005441 | Ga0070700_100019718 | Ga0070700_1000197181 | 239 |
| 109 | 3300005441 | Ga0070700_100344132 | Ga0070700_1003441321 | 239 |
| 110 | 3300005444 | Ga0070694_100086279 | Ga0070694_1000862792 | 239 |
| 111 | 3300005445 | Ga0070708_100175035 | Ga0070708_1001750351 | 239 |
| 112 | 3300005445 | Ga0070708_100382449 | Ga0070708_1003824491 | 239 |
| 113 | 3300005456 | Ga0070678_100091429 | Ga0070678_1000914292 | 239 |
| 114 | 3300005456 | Ga0070678_100129144 | Ga0070678_1001291442 | 239 |
| 115 | 3300005457 | Ga0070662_100197155 | Ga0070662_1001971551 | 239 |
| 116 | 3300005458 | Ga0070681_10002271 | Ga0070681_100022711 | 239 |
| 117 | 3300005458 | Ga0070681_10002726 | Ga0070681_1000272611 | 239 |
| 118 | 3300005458 | Ga0070681_10072999 | Ga0070681_100729993 | 239 |
| 119 | 3300005458 | Ga0070681_10296454 | Ga0070681_102964541 | 239 |
| 120 | 3300005459 | Ga0068867_100160534 | Ga0068867_1001605342 | 239 |
| 121 | 3300005467 | Ga0070706_100184423 | Ga0070706_1001844231 | 239 |
| 122 | 3300005468 | Ga0070707_100005527 | Ga0070707_1000055277 | 239 |
| 123 | 3300005468 | Ga0070707_100051334 | Ga0070707_1000513344 | 239 |
| 124 | 3300005468 | Ga0070707_100176381 | Ga0070707_1001763811 | 239 |
| 125 | 3300005468 | Ga0070707_100439318 | Ga0070707_1004393182 | 239 |
| 126 | 3300005471 | Ga0070698_100000151 | Ga0070698_1000001519 | 239 |
| 127 | 3300005471 | Ga0070698_100240034 | Ga0070698_1002400341 | 239 |
| 128 | 3300005518 | Ga0070699_100037674 | Ga0070699_1000376742 | 239 |
| 129 | 3300005518 | Ga0070699_100093048 | Ga0070699_1000930483 | 239 |
| 130 | 3300005530 | Ga0070679_100002206 | Ga0070679_10000220611 | 239 |
| 131 | 3300005530 | Ga0070679_100084504 | Ga0070679_1000845043 | 239 |
| 132 | 3300005530 | Ga0070679_100222581 | Ga0070679_1002225813 | 239 |
| 133 | 3300005535 | Ga0070684_100004651 | Ga0070684_10000465111 | 239 |
| 134 | 3300005535 | Ga0070684_100198306 | Ga0070684_1001983062 | 239 |
| 135 | 3300005539 | Ga0068853_100002617 | Ga0068853_1000026179 | 239 |
| 136 | 3300005543 | Ga0070672_100054452 | Ga0070672_1000544522 | 239 |
| 137 | 3300005543 | Ga0070672_100215012 | Ga0070672_1002150122 | 239 |
| 138 | 3300005544 | Ga0070686_100148778 | Ga0070686_1001487781 | 239 |
| 139 | 3300005548 | Ga0070665_100534221 | Ga0070665_1005342212 | 239 |
| 140 | 3300005548 | Ga0070665_100966612 | Ga0070665_1009666121 | 239 |
| 141 | 3300005563 | Ga0068855_100006805 | Ga0068855_1000068058 | 239 |
| 142 | 3300005563 | Ga0068855_100064976 | Ga0068855_1000649763 | 239 |
| 143 | 3300005564 | Ga0070664_100006100 | Ga0070664_1000061004 | 239 |
| 144 | 3300005564 | Ga0070664_100081116 | Ga0070664_1000811162 | 239 |
| 145 | 3300005564 | Ga0070664_100178422 | Ga0070664_1001784222 | 239 |
| 146 | 3300005564 | Ga0070664_100221865 | Ga0070664_1002218652 | 239 |
| 147 | 3300005577 | Ga0068857_100082893 | Ga0068857_1000828933 | 239 |
| 148 | 3300005577 | Ga0068857_100338064 | Ga0068857_1003380642 | 239 |
| 149 | 3300005577 | Ga0068857_100379154 | Ga0068857_1003791542 | 239 |
| 150 | 3300005577 | Ga0068857_100786425 | Ga0068857_1007864251 | 239 |
| 151 | 3300005578 | Ga0068854_100203316 | Ga0068854_1002033162 | 239 |
| 152 | 3300005614 | Ga0068856_100005989 | Ga0068856_1000059894 | 239 |
| 153 | 3300005614 | Ga0068856_100092197 | Ga0068856_1000921972 | 239 |
| 154 | 3300005614 | Ga0068856_100121296 | Ga0068856_1001212962 | 239 |
| 155 | 3300005614 | Ga0068856_100145805 | Ga0068856_1001458053 | 239 |
| 156 | 3300005614 | Ga0068856_100245538 | Ga0068856_1002455382 | 239 |
| 157 | 3300005616 | Ga0068852_100002176 | Ga0068852_10000217612 | 239 |
| 158 | 3300005616 | Ga0068852_100226473 | Ga0068852_1002264732 | 239 |
| 159 | 3300005617 | Ga0068859_100060184 | Ga0068859_1000601845 | 239 |
| 160 | 3300005719 | Ga0068861_100096125 | Ga0068861_1000961252 | 239 |
| 161 | 3300005842 | Ga0068858_100265659 | Ga0068858_1002656592 | 239 |
| 162 | 3300005843 | Ga0068860_100091970 | Ga0068860_1000919702 | 239 |
| 163 | 3300005843 | Ga0068860_100123087 | Ga0068860_1001230872 | 239 |
| 164 | 3300005844 | Ga0068862_100248007 | Ga0068862_1002480072 | 239 |
| 165 | 3300005844 | Ga0068862_100255562 | Ga0068862_1002555622 | 239 |
| 166 | 3300005844 | Ga0068862_100298786 | Ga0068862_1002987862 | 239 |
| 167 | 3300005937 | Ga0081455_10000058 | Ga0081455_1000005879 | 239 |
| 168 | 3300005937 | Ga0081455_10014280 | Ga0081455_100142806 | 239 |
| 169 | 3300005937 | Ga0081455_10014867 | Ga0081455_100148678 | 239 |
| 170 | 3300005937 | Ga0081455_10040186 | Ga0081455_100401862 | 239 |
| 171 | 3300005983 | Ga0081540_1000040 | Ga0081540_100004022 | 239 |
| 172 | 3300005983 | Ga0081540_1016800 | Ga0081540_10168003 | 239 |
| 173 | 3300005985 | Ga0081539_10000118 | Ga0081539_1000011831 | 239 |
| 174 | 3300005985 | Ga0081539_10003667 | Ga0081539_100036679 | 239 |
| 175 | 3300005985 | Ga0081539_10106698 | Ga0081539_101066981 | 239 |
| 176 | 3300006028 | Ga0070717_10078984 | Ga0070717_100789841 | 239 |
| 177 | 3300006028 | Ga0070717_10174947 | Ga0070717_101749472 | 239 |
| 178 | 3300006028 | Ga0070717_10293321 | Ga0070717_102933212 | 239 |
| 179 | 3300006028 | Ga0070717_10359992 | Ga0070717_103599921 | 239 |
| 180 | 3300006038 | Ga0075365_10002405 | Ga0075365_100024052 | 239 |
| 181 | 3300006038 | Ga0075365_10128891 | Ga0075365_101288912 | 239 |
| 182 | 3300006038 | Ga0075365_10129417 | Ga0075365_101294172 | 239 |
| 183 | 3300006038 | Ga0075365_10389289 | Ga0075365_103892892 | 239 |
| 184 | 3300006042 | Ga0075368_10003668 | Ga0075368_100036683 | 239 |
| 185 | 3300006042 | Ga0075368_10021831 | Ga0075368_100218313 | 239 |
| 186 | 3300006042 | Ga0075368_10087405 | Ga0075368_100874052 | 239 |
| 187 | 3300006048 | Ga0075363_100027715 | Ga0075363_1000277152 | 239 |
| 188 | 3300006051 | Ga0075364_10010124 | Ga0075364_100101243 | 239 |
| 189 | 3300006058 | Ga0075432_10102773 | Ga0075432_101027732 | 239 |
| 190 | 3300006163 | Ga0070715_10026516 | Ga0070715_100265162 | 239 |
| 191 | 3300006175 | Ga0070712_100070508 | Ga0070712_1000705082 | 239 |
| 192 | 3300006175 | Ga0070712_100105208 | Ga0070712_1001052082 | 239 |
| 193 | 3300006175 | Ga0070712_100139468 | Ga0070712_1001394682 | 239 |
| 194 | 3300006175 | Ga0070712_100215231 | Ga0070712_1002152311 | 239 |
| 195 | 3300006177 | Ga0075362_10082341 | Ga0075362_100823412 | 239 |
| 196 | 3300006178 | Ga0075367_10083007 | Ga0075367_100830072 | 239 |
| 197 | 3300006186 | Ga0075369_10001810 | Ga0075369_1000181010 | 239 |
| 198 | 3300006844 | Ga0075428_100026575 | Ga0075428_1000265752 | 239 |
| 199 | 3300006844 | Ga0075428_100112351 | Ga0075428_1001123511 | 239 |
| 200 | 3300006844 | Ga0075428_100145913 | Ga0075428_1001459132 | 239 |
| 201 | 3300006844 | Ga0075428_100450658 | Ga0075428_1004506582 | 239 |
| 202 | 3300006844 | Ga0075428_100579662 | Ga0075428_1005796621 | 239 |
| 203 | 3300006846 | Ga0075430_100059928 | Ga0075430_1000599282 | 239 |
| 204 | 3300006846 | Ga0075430_100147098 | Ga0075430_1001470982 | 239 |
| 205 | 3300006846 | Ga0075430_100236636 | Ga0075430_1002366361 | 239 |
| 206 | 3300006846 | Ga0075430_100339119 | Ga0075430_1003391192 | 239 |
| 207 | 3300006846 | Ga0075430_100544122 | Ga0075430_1005441221 | 239 |
| 208 | 3300006847 | Ga0075431_100003740 | Ga0075431_10000374011 | 239 |
| 209 | 3300006847 | Ga0075431_100007662 | Ga0075431_1000076626 | 239 |
| 210 | 3300006847 | Ga0075431_100035511 | Ga0075431_1000355112 | 239 |
| 211 | 3300006847 | Ga0075431_100035737 | Ga0075431_1000357373 | 239 |
| 212 | 3300006847 | Ga0075431_100048763 | Ga0075431_1000487635 | 239 |
| 213 | 3300006847 | Ga0075431_100110767 | Ga0075431_1001107673 | 239 |
| 214 | 3300006852 | Ga0075433_10002457 | Ga0075433_1000245715 | 239 |
| 215 | 3300006852 | Ga0075433_10040255 | Ga0075433_100402553 | 239 |
| 216 | 3300006852 | Ga0075433_10100652 | Ga0075433_101006521 | 239 |
| 217 | 3300006871 | Ga0075434_100001552 | Ga0075434_1000015522 | 239 |
| 218 | 3300006880 | Ga0075429_100238900 | Ga0075429_1002389003 | 239 |
| 219 | 3300006880 | Ga0075429_100353646 | Ga0075429_1003536462 | 239 |
| 220 | 3300006914 | Ga0075436_100085191 | Ga0075436_1000851912 | 239 |
| 221 | 3300006931 | Ga0097620_100060186 | Ga0097620_1000601863 | 239 |
| 222 | 3300006931 | Ga0097620_100885767 | Ga0097620_1008857671 | 239 |
| 223 | 3300007076 | Ga0075435_100005800 | Ga0075435_1000058002 | 239 |
| 224 | 3300007076 | Ga0075435_100026923 | Ga0075435_1000269233 | 239 |
| 225 | 3300007076 | Ga0075435_100158186 | Ga0075435_1001581862 | 239 |
| 226 | 3300007788 | Ga0099795_10151714 | Ga0099795_101517141 | 239 |
| 227 | 3300009093 | Ga0105240_10002630 | Ga0105240_1000263025 | 239 |
| 228 | 3300009093 | Ga0105240_10019378 | Ga0105240_100193788 | 239 |
| 229 | 3300009093 | Ga0105240_10176907 | Ga0105240_101769072 | 239 |
| 230 | 3300009093 | Ga0105240_10318233 | Ga0105240_103182332 | 239 |
| 231 | 3300009093 | Ga0105240_10514520 | Ga0105240_105145202 | 239 |
| 232 | 3300009093 | Ga0105240_11070846 | Ga0105240_110708462 | 239 |
| 233 | 3300009094 | Ga0111539_10003980 | Ga0111539_1000398012 | 239 |
| 234 | 3300009094 | Ga0111539_10008813 | Ga0111539_100088136 | 239 |
| 235 | 3300009094 | Ga0111539_10036498 | Ga0111539_100364982 | 239 |
| 236 | 3300009094 | Ga0111539_10175139 | Ga0111539_101751394 | 239 |
| 237 | 3300009094 | Ga0111539_10191067 | Ga0111539_101910672 | 239 |
| 238 | 3300009098 | Ga0105245_10512308 | Ga0105245_105123082 | 239 |
| 239 | 3300009098 | Ga0105245_10730848 | Ga0105245_107308481 | 239 |
| 240 | 3300009147 | Ga0114129_10390679 | Ga0114129_103906792 | 239 |
| 241 | 3300009147 | Ga0114129_11641492 | Ga0114129_116414921 | 239 |
| 242 | 3300009148 | Ga0105243_10244828 | Ga0105243_102448282 | 239 |
| 243 | 3300009148 | Ga0105243_10700195 | Ga0105243_107001952 | 239 |
| 244 | 3300009174 | Ga0105241_10046486 | Ga0105241_100464863 | 239 |
| 245 | 3300009174 | Ga0105241_10702071 | Ga0105241_107020711 | 239 |
| 246 | 3300009177 | Ga0105248_10036725 | Ga0105248_100367253 | 239 |
| 247 | 3300009177 | Ga0105248_10273665 | Ga0105248_102736651 | 239 |
| 248 | 3300009177 | Ga0105248_10878700 | Ga0105248_108787001 | 239 |
| 249 | 3300009545 | Ga0105237_10149731 | Ga0105237_101497312 | 239 |
| 250 | 3300009545 | Ga0105237_10664275 | Ga0105237_106642751 | 239 |
| 251 | 3300009551 | Ga0105238_10001395 | Ga0105238_100013958 | 239 |
| 252 | 3300009551 | Ga0105238_10131003 | Ga0105238_101310032 | 239 |
| 253 | 3300009551 | Ga0105238_10281596 | Ga0105238_102815963 | 239 |
| 254 | 3300009553 | Ga0105249_10242527 | Ga0105249_102425272 | 239 |
| 255 | 3300009553 | Ga0105249_10562662 | Ga0105249_105626621 | 239 |
| 256 | 3300009553 | Ga0105249_10899084 | Ga0105249_108990841 | 239 |
| 257 | 3300010159 | Ga0099796_10083298 | Ga0099796_100832982 | 239 |
| 258 | 3300010159 | Ga0099796_10178150 | Ga0099796_101781501 | 239 |
| 259 | 3300010375 | Ga0105239_10372967 | Ga0105239_103729672 | 239 |
| 260 | 3300013100 | Ga0157373_10018195 | Ga0157373_100181952 | 239 |
| 261 | 3300013102 | Ga0157371_10020398 | Ga0157371_100203985 | 239 |
| 262 | 3300013102 | Ga0157371_10357717 | Ga0157371_103577171 | 239 |
| 263 | 3300013104 | Ga0157370_10028222 | Ga0157370_100282222 | 239 |
| 264 | 3300013104 | Ga0157370_10110453 | Ga0157370_101104533 | 239 |
| 265 | 3300013104 | Ga0157370_10722170 | Ga0157370_107221701 | 239 |
| 266 | 3300013105 | Ga0157369_10027627 | Ga0157369_100276272 | 239 |
| 267 | 3300013105 | Ga0157369_10579116 | Ga0157369_105791161 | 239 |
| 268 | 3300013296 | Ga0157374_10285474 | Ga0157374_102854742 | 239 |
| 269 | 3300013297 | Ga0157378_10442262 | Ga0157378_104422621 | 239 |
| 270 | 3300013306 | Ga0163162_10023969 | Ga0163162_100239692 | 239 |
| 271 | 3300013307 | Ga0157372_10005959 | Ga0157372_1000595915 | 239 |
| 272 | 3300013307 | Ga0157372_10106475 | Ga0157372_101064752 | 239 |
| 273 | 3300013308 | Ga0157375_10050936 | Ga0157375_100509363 | 239 |
| 274 | 3300014325 | Ga0163163_10207612 | Ga0163163_102076122 | 239 |
| 275 | 3300014326 | Ga0157380_10099565 | Ga0157380_100995655 | 239 |
| 276 | 3300014326 | Ga0157380_10112989 | Ga0157380_101129893 | 239 |
| 277 | 3300014326 | Ga0157380_10473160 | Ga0157380_104731602 | 239 |
| 278 | 3300014497 | Ga0182008_10015135 | Ga0182008_100151353 | 239 |
| 279 | 3300014969 | Ga0157376_10195768 | Ga0157376_101957681 | 239 |
| 280 | 3300014969 | Ga0157376_10564736 | Ga0157376_105647361 | 239 |
| 281 | 3300017792 | Ga0163161_10230834 | Ga0163161_102308341 | 239 |
| 282 | 3300021358 | Ga0213873_10061209 | Ga0213873_100612092 | 239 |
| 283 | 3300021361 | Ga0213872_10025640 | Ga0213872_100256403 | 239 |
| 284 | 3300021361 | Ga0213872_10062346 | Ga0213872_100623462 | 239 |
| 285 | 3300021361 | Ga0213872_10073160 | Ga0213872_100731602 | 239 |
| 286 | 3300021384 | Ga0213876_10139037 | Ga0213876_101390372 | 239 |
| 287 | 3300021388 | Ga0213875_10000424 | Ga0213875_1000042417 | 239 |
| 288 | 3300021388 | Ga0213875_10009829 | Ga0213875_100098294 | 239 |
| 289 | 3300021388 | Ga0213875_10099822 | Ga0213875_100998221 | 239 |
| 290 | 3300021388 | Ga0213875_10217217 | Ga0213875_102172171 | 239 |
| 291 | 3300025893 | Ga0207682_10119475 | Ga0207682_101194752 | 239 |
| 292 | 3300025898 | Ga0207692_10044804 | Ga0207692_100448042 | 239 |
| 293 | 3300025903 | Ga0207680_10328879 | Ga0207680_103288791 | 239 |
| 294 | 3300025905 | Ga0207685_10013744 | Ga0207685_100137442 | 239 |
| 295 | 3300025906 | Ga0207699_10058486 | Ga0207699_100584862 | 239 |
| 296 | 3300025906 | Ga0207699_10126046 | Ga0207699_101260461 | 239 |
| 297 | 3300025909 | Ga0207705_10029840 | Ga0207705_100298402 | 239 |
| 298 | 3300025909 | Ga0207705_10190201 | Ga0207705_101902012 | 239 |
| 299 | 3300025909 | Ga0207705_10346648 | Ga0207705_103466482 | 239 |
| 300 | 3300025910 | Ga0207684_10068225 | Ga0207684_100682253 | 239 |
| 301 | 3300025912 | Ga0207707_10041726 | Ga0207707_100417262 | 239 |
| 302 | 3300025912 | Ga0207707_10100127 | Ga0207707_101001274 | 239 |
| 303 | 3300025912 | Ga0207707_10264987 | Ga0207707_102649872 | 239 |
| 304 | 3300025913 | Ga0207695_10197134 | Ga0207695_101971343 | 239 |
| 305 | 3300025913 | Ga0207695_10228426 | Ga0207695_102284262 | 239 |
| 306 | 3300025913 | Ga0207695_10324475 | Ga0207695_103244751 | 239 |
| 307 | 3300025915 | Ga0207693_10021995 | Ga0207693_100219952 | 239 |
| 308 | 3300025915 | Ga0207693_10055956 | Ga0207693_100559563 | 239 |
| 309 | 3300025915 | Ga0207693_10171102 | Ga0207693_101711021 | 239 |
| 310 | 3300025915 | Ga0207693_10192495 | Ga0207693_101924951 | 239 |
| 311 | 3300025915 | Ga0207693_10282938 | Ga0207693_102829381 | 239 |
| 312 | 3300025915 | Ga0207693_10397448 | Ga0207693_103974482 | 239 |
| 313 | 3300025917 | Ga0207660_10355704 | Ga0207660_103557042 | 239 |
| 314 | 3300025919 | Ga0207657_10029903 | Ga0207657_100299033 | 239 |
| 315 | 3300025919 | Ga0207657_10296615 | Ga0207657_102966152 | 239 |
| 316 | 3300025920 | Ga0207649_10003790 | Ga0207649_100037908 | 239 |
| 317 | 3300025920 | Ga0207649_10025800 | Ga0207649_100258002 | 239 |
| 318 | 3300025921 | Ga0207652_10006133 | Ga0207652_1000613312 | 239 |
| 319 | 3300025921 | Ga0207652_10127613 | Ga0207652_101276132 | 239 |
| 320 | 3300025921 | Ga0207652_10145332 | Ga0207652_101453322 | 239 |
| 321 | 3300025922 | Ga0207646_10008706 | Ga0207646_100087066 | 239 |
| 322 | 3300025922 | Ga0207646_10117167 | Ga0207646_101171672 | 239 |
| 323 | 3300025922 | Ga0207646_10465218 | Ga0207646_104652182 | 239 |
| 324 | 3300025924 | Ga0207694_10071122 | Ga0207694_100711222 | 239 |
| 325 | 3300025924 | Ga0207694_10241427 | Ga0207694_102414272 | 239 |
| 326 | 3300025926 | Ga0207659_10097934 | Ga0207659_100979342 | 239 |
| 327 | 3300025927 | Ga0207687_10088115 | Ga0207687_100881152 | 239 |
| 328 | 3300025928 | Ga0207700_10029099 | Ga0207700_100290992 | 239 |
| 329 | 3300025928 | Ga0207700_10056886 | Ga0207700_100568863 | 239 |
| 330 | 3300025928 | Ga0207700_10214060 | Ga0207700_102140602 | 239 |
| 331 | 3300025928 | Ga0207700_10261306 | Ga0207700_102613062 | 239 |
| 332 | 3300025929 | Ga0207664_10036468 | Ga0207664_100364684 | 239 |
| 333 | 3300025929 | Ga0207664_10130575 | Ga0207664_101305753 | 239 |
| 334 | 3300025929 | Ga0207664_10311048 | Ga0207664_103110482 | 239 |
| 335 | 3300025929 | Ga0207664_10503124 | Ga0207664_105031241 | 239 |
| 336 | 3300025931 | Ga0207644_10367805 | Ga0207644_103678052 | 239 |
| 337 | 3300025931 | Ga0207644_10395037 | Ga0207644_103950372 | 239 |
| 338 | 3300025932 | Ga0207690_10053769 | Ga0207690_100537692 | 239 |
| 339 | 3300025933 | Ga0207706_10019719 | Ga0207706_100197195 | 239 |
| 340 | 3300025933 | Ga0207706_10271632 | Ga0207706_102716322 | 239 |
| 341 | 3300025935 | Ga0207709_10066020 | Ga0207709_100660203 | 239 |
| 342 | 3300025936 | Ga0207670_10179831 | Ga0207670_101798312 | 239 |
| 343 | 3300025939 | Ga0207665_10050650 | Ga0207665_100506504 | 239 |
| 344 | 3300025940 | Ga0207691_10005919 | Ga0207691_1000591912 | 239 |
| 345 | 3300025941 | Ga0207711_10020650 | Ga0207711_100206503 | 239 |
| 346 | 3300025941 | Ga0207711_10276244 | Ga0207711_102762441 | 239 |
| 347 | 3300025944 | Ga0207661_10019962 | Ga0207661_100199623 | 239 |
| 348 | 3300025944 | Ga0207661_10370031 | Ga0207661_103700311 | 239 |
| 349 | 3300025944 | Ga0207661_10717491 | Ga0207661_107174911 | 239 |
| 350 | 3300025945 | Ga0207679_10028203 | Ga0207679_100282032 | 239 |
| 351 | 3300025945 | Ga0207679_10052364 | Ga0207679_100523641 | 239 |
| 352 | 3300025945 | Ga0207679_10248931 | Ga0207679_102489312 | 239 |
| 353 | 3300025945 | Ga0207679_10300607 | Ga0207679_103006071 | 239 |
| 354 | 3300025949 | Ga0207667_10031492 | Ga0207667_100314926 | 239 |
| 355 | 3300025949 | Ga0207667_10234870 | Ga0207667_102348702 | 239 |
| 356 | 3300025949 | Ga0207667_10384343 | Ga0207667_103843432 | 239 |
| 357 | 3300025972 | Ga0207668_10083105 | Ga0207668_100831052 | 239 |
| 358 | 3300026035 | Ga0207703_10254752 | Ga0207703_102547522 | 239 |
| 359 | 3300026041 | Ga0207639_10003687 | Ga0207639_100036872 | 239 |
| 360 | 3300026067 | Ga0207678_10154512 | Ga0207678_101545122 | 239 |
| 361 | 3300026067 | Ga0207678_10642033 | Ga0207678_106420331 | 239 |
| 362 | 3300026075 | Ga0207708_10008880 | Ga0207708_100088804 | 239 |
| 363 | 3300026075 | Ga0207708_10366322 | Ga0207708_103663222 | 239 |
| 364 | 3300026075 | Ga0207708_10406907 | Ga0207708_104069071 | 239 |
| 365 | 3300026078 | Ga0207702_10014050 | Ga0207702_100140503 | 239 |
| 366 | 3300026078 | Ga0207702_10049619 | Ga0207702_100496192 | 239 |
| 367 | 3300026078 | Ga0207702_10057572 | Ga0207702_100575723 | 239 |
| 368 | 3300026078 | Ga0207702_10155645 | Ga0207702_101556452 | 239 |
| 369 | 3300026088 | Ga0207641_10038460 | Ga0207641_100384604 | 239 |
| 370 | 3300026089 | Ga0207648_10165786 | Ga0207648_101657862 | 239 |
| 371 | 3300026089 | Ga0207648_10218927 | Ga0207648_102189271 | 239 |
| 372 | 3300026089 | Ga0207648_10607214 | Ga0207648_106072141 | 239 |
| 373 | 3300026095 | Ga0207676_10645730 | Ga0207676_106457301 | 239 |
| 374 | 3300026095 | Ga0207676_10791329 | Ga0207676_107913291 | 239 |
| 375 | 3300026116 | Ga0207674_10000005 | Ga0207674_10000005106 | 239 |
| 376 | 3300026116 | Ga0207674_10012502 | Ga0207674_100125022 | 239 |
| 377 | 3300026116 | Ga0207674_10084065 | Ga0207674_100840652 | 239 |
| 378 | 3300026116 | Ga0207674_10108400 | Ga0207674_101084002 | 239 |
| 379 | 3300026116 | Ga0207674_10789946 | Ga0207674_107899461 | 239 |
| 380 | 3300026118 | Ga0207675_100033679 | Ga0207675_1000336795 | 239 |
| 381 | 3300026118 | Ga0207675_100082428 | Ga0207675_1000824282 | 239 |
| 382 | 3300026121 | Ga0207683_10305156 | Ga0207683_103051562 | 239 |
| 383 | 3300026142 | Ga0207698_10076754 | Ga0207698_100767543 | 239 |
| 384 | 3300026142 | Ga0207698_10336881 | Ga0207698_103368812 | 239 |
| 385 | 3300027866 | Ga0209813_10001131 | Ga0209813_100011314 | 239 |
| 386 | 3300027907 | Ga0207428_10023160 | Ga0207428_100231602 | 239 |
| 387 | 3300027907 | Ga0207428_10109523 | Ga0207428_101095232 | 239 |
| 388 | 3300027907 | Ga0207428_10183983 | Ga0207428_101839832 | 239 |
| 389 | 3300027907 | Ga0207428_10477781 | Ga0207428_104777811 | 239 |
| 390 | 3300028380 | Ga0268265_10191522 | Ga0268265_101915223 | 239 |
| 391 | 3300028380 | Ga0268265_10515605 | Ga0268265_105156051 | 239 |
| 392 | 3300028380 | Ga0268265_10606819 | Ga0268265_106068191 | 239 |
| 393 | 3300028381 | Ga0268264_10217565 | Ga0268264_102175652 | 239 |
| 394 | 3300028800 | Ga0265338_10110649 | Ga0265338_101106493 | 239 |
| 395 | 3300031249 | Ga0265339_10000047 | Ga0265339_1000004732 | 239 |
| 396 | 3300031344 | Ga0265316_10308211 | Ga0265316_103082111 | 239 |
| 397 | 3300031548 | Ga0307408_100335510 | Ga0307408_1003355101 | 239 |
| 398 | 3300031595 | Ga0265313_10000069 | Ga0265313_1000006917 | 239 |
| 399 | 3300031595 | Ga0265313_10121941 | Ga0265313_101219411 | 239 |
| 400 | 3300031727 | Ga0316576_10109279 | Ga0316576_101092791 | 239 |
| 401 | 3300031901 | Ga0307406_10370964 | Ga0307406_103709642 | 239 |
| 402 | 3300032002 | Ga0307416_100241314 | Ga0307416_1002413142 | 239 |
| 403 | 3300034818 | Ga0373950_0010782 | Ga0373950_0010782_60_884 | 239 |
| 404 | 3300035083 | Ga0373926_0073934 | Ga0373926_0073934_22_762 | 239 |
| 405 | 3300035086 | Ga0373934_0093214 | Ga0373934_0093214_375_1103 | 239 |
| 406 | 3300035088 | Ga0373940_0004606 | Ga0373940_0004606_2147_2872 | 239 |
| 407 | 3300035088 | Ga0373940_0010882 | Ga0373940_0010882_1096_1917 | 239 |
| 408 | 3300035088 | Ga0373940_0106758 | Ga0373940_0106758_84_809 | 239 |
| 409 | 3300035111 | Ga0373923_0044031 | Ga0373923_0044031_522_1250 | 239 |
| 410 | 3300035111 | Ga0373923_0071502 | Ga0373923_0071502_458_1192 | 239 |
| 411 | 3300035113 | Ga0373936_0092067 | Ga0373936_0092067_105_833 | 239 |
| 412 | 3300035114 | Ga0373939_0002275 | Ga0373939_0002275_1121_1945 | 239 |
| 413 | 3300035114 | Ga0373939_0012130 | Ga0373939_0012130_379_1200 | 239 |
| 414 | 3300035115 | Ga0373941_0013366 | Ga0373941_0013366_806_1630 | 239 |
| 415 | 3300035117 | Ga0373953_0007043 | Ga0373953_0007043_1629_2357 | 239 |
| 416 | 3300035117 | Ga0373953_0053349 | Ga0373953_0053349_517_1257 | 239 |
| 417 | 3300035118 | Ga0373954_0053704 | Ga0373954_0053704_498_1226 | 239 |
| 418 | 3300035119 | Ga0373956_0183323 | Ga0373956_0183323_128_856 | 239 |
| 419 | 3300035120 | Ga0373957_0043487 | Ga0373957_0043487_402_1130 | 239 |
| 420 | 3300035120 | Ga0373957_0066338 | Ga0373957_0066338_476_1204 | 239 |
| 421 | 3300035171 | Ga0373946_0077574 | Ga0373946_0077574_369_1109 | 239 |
| 422 | 3300035171 | Ga0373946_0089460 | Ga0373946_0089460_542_1276 | 239 |
| 423 | 3300035172 | Ga0373955_0013905 | Ga0373955_0013905_2414_3142 | 239 |
| 424 | 3300035172 | Ga0373955_0037958 | Ga0373955_0037958_673_1401 | 239 |
| 425 | 3300035207 | Ga0373942_0016762 | Ga0373942_0016762_856_1680 | 239 |
| 426 | 3300035207 | Ga0373942_0081450 | Ga0373942_0081450_143_883 | 239 |
| 427 | 3300035241 | Ga0373961_0010010 | Ga0373961_0010010_1144_1968 | 239 |
| 428 | 3300035242 | Ga0373962_0014124 | Ga0373962_0014124_818_1642 | 239 |
| 429 | 3300035398 | Ga0316574_0250935 | Ga0316574_0250935_95_820 | 239 |
| 430 | 3300035410 | Ga0373924_0044852 | Ga0373924_0044852_478_1206 | 239 |
| 431 | 3300035410 | Ga0373924_0113203 | Ga0373924_0113203_49_777 | 239 |
| 432 | 3300035691 | Ga0373931_0007066 | Ga0373931_0007066_4079_4900 | 239 |
| 433 | 3300035691 | Ga0373931_0013645 | Ga0373931_0013645_360_1184 | 239 |
| 434 | 3300035691 | Ga0373931_0050747 | Ga0373931_0050747_1096_1821 | 239 |
| 435 | 3300035691 | Ga0373931_0183971 | Ga0373931_0183971_248_988 | 239 |
| 436 | 3300035692 | Ga0373935_0033555 | Ga0373935_0033555_163_891 | 239 |
| 437 | 3300035692 | Ga0373935_0073612 | Ga0373935_0073612_1333_2061 | 239 |
| 438 | 3300035692 | Ga0373935_0082099 | Ga0373935_0082099_1027_1767 | 239 |
| 439 | 3300035692 | Ga0373935_0285236 | Ga0373935_0285236_332_1072 | 239 |
| 440 | 3300035695 | Ga0373927_0044150 | Ga0373927_0044150_52_792 | 239 |
| 441 | 3300035695 | Ga0373927_0071306 | Ga0373927_0071306_1409_2134 | 239 |
| 442 | 3300035695 | Ga0373927_0163066 | Ga0373927_0163066_672_1403 | 239 |
| 443 | 3300035695 | Ga0373927_0191689 | Ga0373927_0191689_584_1324 | 239 |
| 444 | 3300035695 | Ga0373927_0310970 | Ga0373927_0310970_42_782 | 239 |
| 445 | 3300035724 | Ga0373933_0004861 | Ga0373933_0004861_244_972 | 239 |
| 446 | 3300035724 | Ga0373933_0011796 | Ga0373933_0011796_200_928 | 239 |
| 447 | 3300035724 | Ga0373933_0016852 | Ga0373933_0016852_1454_2179 | 239 |
| 448 | 3300035724 | Ga0373933_0097211 | Ga0373933_0097211_483_1211 | 239 |
| 449 | 3300035724 | Ga0373933_0162416 | Ga0373933_0162416_462_1187 | 239 |
| 450 | 3300035725 | Ga0373947_0016322 | Ga0373947_0016322_435_1163 | 239 |
| 451 | 3300035725 | Ga0373947_0197397 | Ga0373947_0197397_400_1140 | 239 |
| 452 | 3300035725 | Ga0373947_0284726 | Ga0373947_0284726_109_849 | 239 |
| 453 | 3300035725 | Ga0373947_0378709 | Ga0373947_0378709_199_933 | 239 |
| 454 | 3300036401 | Ga0373937_0000761 | Ga0373937_0000761_20300_21028 | 239 |
| 455 | 3300036401 | Ga0373937_0136329 | Ga0373937_0136329_1259_1984 | 239 |
| 456 | 3300036401 | Ga0373937_0374780 | Ga0373937_0374780_306_1034 | 239 |
| 457 | 3300036712 | Ga0316584_0147376 | Ga0316584_0147376_324_1049 | 239 |
| 458 | 3300037068 | Ga0373925_0037185 | Ga0373925_0037185_1589_2317 | 239 |
| 459 | 3300037068 | Ga0373925_0050679 | Ga0373925_0050679_865_1593 | 239 |
| 460 | 3300037068 | Ga0373925_0533388 | Ga0373925_0533388_162_893 | 239 |
| 461 | 3300037068 | Ga0373925_0685459 | Ga0373925_0685459_54_782 | 239 |
| 462 | 3300037312 | Ga0395899_0024032 | Ga0395899_0024032_3578_4303 | 239 |
| 463 | 3300037312 | Ga0395899_0069251 | Ga0395899_0069251_499_1224 | 239 |
| 464 | 3300037312 | Ga0395899_0088176 | Ga0395899_0088176_469_1200 | 239 |
| 465 | 3300037418 | Ga0395900_0021639 | Ga0395900_0021639_4249_4974 | 239 |
| 466 | 3300037418 | Ga0395900_0077801 | Ga0395900_0077801_1305_2030 | 239 |
| 467 | 3300037418 | Ga0395900_0168974 | Ga0395900_0168974_17_748 | 239 |
| 468 | 3300037466 | Ga0395898_0022898 | Ga0395898_0022898_4251_4976 | 239 |
| 469 | 3300037471 | Ga0395905_0603119 | Ga0395905_0603119_55_786 | 239 |
| 470 | 3300037853 | Ga0436364_0108726 | Ga0436364_0108726_456_1196 | 239 |
| 471 | 3300037853 | Ga0436364_0286343 | Ga0436364_0286343_401_1129 | 239 |
| 472 | 3300037853 | Ga0436364_0663275 | Ga0436364_0663275_50070_50810 | 239 |
| 473 | 3300037853 | Ga0436364_0668296 | Ga0436364_0668296_27955_28683 | 239 |
| 474 | 3300037853 | Ga0436364_1070480 | Ga0436364_1070480_304_1044 | 239 |
| 475 | 3300037853 | Ga0436364_1100698 | Ga0436364_1100698_1737_2471 | 239 |
| 476 | 3300037853 | Ga0436364_1147233 | Ga0436364_1147233_61_789 | 239 |
| 477 | 3300037853 | Ga0436364_1324861 | Ga0436364_1324861_473_1207 | 239 |
| 478 | 3300037853 | Ga0436364_1427712 | Ga0436364_1427712_166_897 | 239 |
| 479 | 3300037853 | Ga0436364_1502786 | Ga0436364_1502786_1537_2262 | 239 |
| 480 | 3300038443 | Ga0395901_0004105 | Ga0395901_0004105_1671_2402 | 239 |
| 481 | 3300038443 | Ga0395901_0027696 | Ga0395901_0027696_1109_1834 | 239 |
| 482 | 3300039437 | Ga0436365_0585284 | Ga0436365_0585284_310_1041 | 239 |
| 483 | 3300039437 | Ga0436365_0750241 | Ga0436365_0750241_1776_2516 | 239 |
| 484 | 3300039437 | Ga0436365_0758860 | Ga0436365_0758860_831_1571 | 239 |
| 485 | 3300039437 | Ga0436365_0941153 | Ga0436365_0941153_1065_1805 | 239 |
| 486 | 3300039437 | Ga0436365_1479190 | Ga0436365_1479190_381_1121 | 239 |
| 487 | 3300039438 | Ga0436360_0427988 | Ga0436360_0427988_802_1626 | 239 |
| 488 | 3300039438 | Ga0436360_0923341 | Ga0436360_0923341_2159_2884 | 239 |
| 489 | 3300039438 | Ga0436360_1116770 | Ga0436360_1116770_211_942 | 239 |
| 490 | 3300039438 | Ga0436360_1203512 | Ga0436360_1203512_97_837 | 239 |
| 491 | 3300039438 | Ga0436360_1369054 | Ga0436360_1369054_1736_2461 | 239 |
| 492 | 3300039447 | Ga0436361_0537570 | Ga0436361_0537570_431_1156 | 239 |
| 493 | 3300039447 | Ga0436361_0661457 | Ga0436361_0661457_2037_2768 | 239 |
| 494 | 3300039447 | Ga0436361_0819334 | Ga0436361_0819334_732_1457 | 239 |
| 495 | 3300039447 | Ga0436361_0895546 | Ga0436361_0895546_871_1596 | 239 |
| 496 | 3300039450 | Ga0436363_0630022 | Ga0436363_0630022_332_1072 | 239 |
| 497 | 3300039450 | Ga0436363_1370045 | Ga0436363_1370045_221_955 | 239 |
| 498 | 3300039453 | Ga0436362_0018763 | Ga0436362_0018763_249_989 | 239 |
| 499 | 3300039453 | Ga0436362_0821186 | Ga0436362_0821186_1217_1945 | 239 |
| 500 | 3300039453 | Ga0436362_0905187 | Ga0436362_0905187_135_866 | 239 |
| 501 | 3300041486 | Ga0451807_1379513 | Ga0451807_1379513_223_957 | 239 |
| 502 | 3300044694 | Ga0466963_0034271 | Ga0466963_0034271_343_1062 | 239 |
| 503 | 3300044694 | Ga0466963_0063652 | Ga0466963_0063652_176_907 | 239 |
| 504 | 3300044694 | Ga0466963_0139486 | Ga0466963_0139486_101_826 | 239 |
| 505 | 3300044712 | Ga0453684_0221968 | Ga0453684_0221968_29_757 | 239 |
| 506 | 3300044842 | Ga0466957_0029268 | Ga0466957_0029268_1298_2029 | 239 |
| 507 | 3300044901 | Ga0466960_0159009 | Ga0466960_0159009_476_1201 | 239 |
| 508 | 3300045836 | Ga0466958_0278385 | Ga0466958_0278385_329_1048 | 239 |
| 509 | 3300045976 | Ga0466967_0017620 | Ga0466967_0017620_870_1601 | 239 |
| 510 | 3300045976 | Ga0466967_0047199 | Ga0466967_0047199_2700_3425 | 239 |
| 511 | 3300045976 | Ga0466967_0434529 | Ga0466967_0434529_352_1080 | 239 |
| 512 | 3300045976 | Ga0466967_0541993 | Ga0466967_0541993_95_820 | 239 |
| 513 | 3300045976 | Ga0466967_0820418 | Ga0466967_0820418_46_780 | 239 |
| 514 | 3300046454 | Ga0495592_0207647 | Ga0495592_0207647_394_1122 | 239 |
| 515 | 3300046454 | Ga0495592_0296424 | Ga0495592_0296424_49_789 | 239 |
| 516 | 3300046454 | Ga0495592_0457795 | Ga0495592_0457795_28_756 | 239 |
| 517 | 3300046455 | Ga0495603_0060560 | Ga0495603_0060560_188_913 | 239 |
| 518 | 3300046459 | Ga0495629_0009132 | Ga0495629_0009132_3529_4269 | 239 |
| 519 | 3300046459 | Ga0495629_0050778 | Ga0495629_0050778_11_745 | 239 |
| 520 | 3300046459 | Ga0495629_0324725 | Ga0495629_0324725_300_1025 | 239 |
| 521 | 3300046462 | Ga0495651_0001110 | Ga0495651_0001110_93_833 | 239 |
| 522 | 3300046462 | Ga0495651_0035681 | Ga0495651_0035681_778_1506 | 239 |
| 523 | 3300046462 | Ga0495651_0210964 | Ga0495651_0210964_82_816 | 239 |
| 524 | 3300046463 | Ga0495653_0015948 | Ga0495653_0015948_4891_5619 | 239 |
| 525 | 3300046472 | Ga0495580_0033025 | Ga0495580_0033025_1528_2268 | 239 |
| 526 | 3300046472 | Ga0495580_0331218 | Ga0495580_0331218_139_954 | 239 |
| 527 | 3300046473 | Ga0495582_0201455 | Ga0495582_0201455_94_828 | 239 |
| 528 | 3300046477 | Ga0495664_0003048 | Ga0495664_0003048_3231_3959 | 239 |
| 529 | 3300046477 | Ga0495664_0203852 | Ga0495664_0203852_63_803 | 239 |
| 530 | 3300046477 | Ga0495664_0451982 | Ga0495664_0451982_10_738 | 239 |
| 531 | 3300046499 | Ga0495594_0091952 | Ga0495594_0091952_696_1436 | 239 |
| 532 | 3300046511 | Ga0495608_0002474 | Ga0495608_0002474_30_758 | 239 |
| 533 | 3300046511 | Ga0495608_0003631 | Ga0495608_0003631_989_1729 | 239 |
| 534 | 3300046511 | Ga0495608_0010040 | Ga0495608_0010040_2234_2962 | 239 |
| 535 | 3300046511 | Ga0495608_0346536 | Ga0495608_0346536_39_773 | 239 |
| 536 | 3300046514 | Ga0495618_0004450 | Ga0495618_0004450_611_1351 | 239 |
| 537 | 3300046514 | Ga0495618_0243946 | Ga0495618_0243946_378_1106 | 239 |
| 538 | 3300046516 | Ga0495628_0026011 | Ga0495628_0026011_3971_4711 | 239 |
| 539 | 3300046516 | Ga0495628_0162703 | Ga0495628_0162703_474_1208 | 239 |
| 540 | 3300046517 | Ga0495630_0188579 | Ga0495630_0188579_704_1438 | 239 |
| 541 | 3300046528 | Ga0495642_0092971 | Ga0495642_0092971_10_825 | 239 |
| 542 | 3300046529 | Ga0495652_0008869 | Ga0495652_0008869_732_1472 | 239 |
| 543 | 3300046533 | Ga0495640_0013010 | Ga0495640_0013010_131_859 | 239 |
| 544 | 3300046533 | Ga0495640_0013014 | Ga0495640_0013014_1598_2338 | 239 |
| 545 | 3300046533 | Ga0495640_0089210 | Ga0495640_0089210_713_1441 | 239 |
| 546 | 3300046533 | Ga0495640_0095657 | Ga0495640_0095657_341_1075 | 239 |
| 547 | 3300046533 | Ga0495640_0302616 | Ga0495640_0302616_67_795 | 239 |
| 548 | 3300046536 | Ga0495587_0003059 | Ga0495587_0003059_280_1020 | 239 |
| 549 | 3300046536 | Ga0495587_0003972 | Ga0495587_0003972_5461_6189 | 239 |
| 550 | 3300046536 | Ga0495587_0126345 | Ga0495587_0126345_131_859 | 239 |
| 551 | 3300046543 | Ga0495645_0026353 | Ga0495645_0026353_995_1723 | 239 |
| 552 | 3300046543 | Ga0495645_0130339 | Ga0495645_0130339_775_1515 | 239 |
| 553 | 3300046543 | Ga0495645_0197727 | Ga0495645_0197727_412_1146 | 239 |
| 554 | 3300046543 | Ga0495645_0327354 | Ga0495645_0327354_105_833 | 239 |
| 555 | 3300046559 | Ga0495667_0002458 | Ga0495667_0002458_9672_10412 | 239 |
| 556 | 3300046559 | Ga0495667_0217275 | Ga0495667_0217275_92_826 | 239 |
| 557 | 3300046642 | Ga0495634_0021446 | Ga0495634_0021446_3348_4088 | 239 |
| 558 | 3300046642 | Ga0495634_0315460 | Ga0495634_0315460_124_858 | 239 |
| 559 | 3300046663 | Ga0495635_0134069 | Ga0495635_0134069_907_1632 | 239 |
| 560 | 3300046663 | Ga0495635_0263073 | Ga0495635_0263073_163_897 | 239 |
| 561 | 3300046678 | Ga0495599_0006436 | Ga0495599_0006436_377_1105 | 239 |
| 562 | 3300046678 | Ga0495599_0194900 | Ga0495599_0194900_97_837 | 239 |
| 563 | 3300046679 | Ga0495623_0054108 | Ga0495623_0054108_211_945 | 239 |
| 564 | 3300046679 | Ga0495623_0056199 | Ga0495623_0056199_1424_2152 | 239 |
| 565 | 3300046680 | Ga0495646_0024219 | Ga0495646_0024219_94_834 | 239 |
| 566 | 3300046680 | Ga0495646_0092056 | Ga0495646_0092056_56_784 | 239 |
| 567 | 3300046683 | Ga0495658_0044840 | Ga0495658_0044840_284_1024 | 239 |
| 568 | 3300046683 | Ga0495658_0364690 | Ga0495658_0364690_70_879 | 239 |
| 569 | 3300046684 | Ga0495669_0003664 | Ga0495669_0003664_3414_4229 | 239 |
| 570 | 3300046689 | Ga0495613_0160950 | Ga0495613_0160950_695_1423 | 239 |
| 571 | 3300046689 | Ga0495613_0243124 | Ga0495613_0243124_139_867 | 239 |
| 572 | 3300046689 | Ga0495613_0326434 | Ga0495613_0326434_63_797 | 239 |
| 573 | 3300046691 | Ga0495670_0149208 | Ga0495670_0149208_301_1116 | 239 |
| 574 | 3300046809 | Ga0495600_0001916 | Ga0495600_0001916_6962_7702 | 239 |
| 575 | 3300046809 | Ga0495600_0033817 | Ga0495600_0033817_709_1437 | 239 |
| 576 | 3300046809 | Ga0495600_0213057 | Ga0495600_0213057_163_897 | 239 |
| 577 | 3300047315 | Ga0495581_0114871 | Ga0495581_0114871_622_1350 | 239 |
| 578 | 3300047315 | Ga0495581_0430511 | Ga0495581_0430511_27_752 | 239 |
| 579 | 3300047317 | Ga0495604_0016624 | Ga0495604_0016624_820_1548 | 239 |
| 580 | 3300047317 | Ga0495604_0237929 | Ga0495604_0237929_196_930 | 239 |
| 581 | 3300047318 | Ga0495636_0223409 | Ga0495636_0223409_29_754 | 239 |
| 582 | 3300047319 | Ga0495674_0002245 | Ga0495674_0002245_8285_9025 | 239 |
| 583 | 3300047321 | Ga0495676_0373977 | Ga0495676_0373977_183_908 | 239 |
| 584 | 3300047322 | Ga0495680_0001116 | Ga0495680_0001116_9297_10037 | 239 |
| 585 | 3300047322 | Ga0495680_0109017 | Ga0495680_0109017_837_1565 | 239 |
| 586 | 3300047444 | Ga0495675_0008949 | Ga0495675_0008949_3491_4219 | 239 |
| 587 | 3300047444 | Ga0495675_0009772 | Ga0495675_0009772_1715_2455 | 239 |
| 588 | 3300047471 | Ga0495684_0080283 | Ga0495684_0080283_208_948 | 239 |
| 589 | 3300047471 | Ga0495684_0215571 | Ga0495684_0215571_581_1306 | 239 |
| 590 | 3300048088 | Ga0495602_0000398 | Ga0495602_0000398_12526_13254 | 239 |
| 591 | 3300048088 | Ga0495602_0003277 | Ga0495602_0003277_15565_16305 | 239 |
| 592 | 3300048088 | Ga0495602_0083357 | Ga0495602_0083357_352_1077 | 239 |
| 593 | 3300048903 | Ga0496100_0189029 | Ga0496100_0189029_64_789 | 239 |
| 594 | 3300048903 | Ga0496100_0317406 | Ga0496100_0317406_48_788 | 239 |
| 595 | 3300048905 | Ga0496102_0130395 | Ga0496102_0130395_510_1379 | 239 |
| 596 | 3300048907 | Ga0496104_0000182 | Ga0496104_0000182_52809_53534 | 239 |
| 597 | 3300048907 | Ga0496104_0157687 | Ga0496104_0157687_1384_2112 | 239 |
| 598 | 3300048907 | Ga0496104_0256037 | Ga0496104_0256037_716_1585 | 239 |
| 599 | 3300048908 | Ga0496105_0018209 | Ga0496105_0018209_4663_5388 | 239 |
| 600 | 3300048909 | Ga0496106_0042250 | Ga0496106_0042250_1471_2340 | 239 |
| 601 | 3300048911 | Ga0496108_0014116 | Ga0496108_0014116_2919_3644 | 239 |
| 602 | 3300048912 | Ga0496109_0004093 | Ga0496109_0004093_3811_4536 | 239 |
| 603 | 3300048912 | Ga0496109_0084299 | Ga0496109_0084299_1177_2046 | 239 |
| 604 | 3300048912 | Ga0496109_0311928 | Ga0496109_0311928_530_1339 | 239 |
| 605 | 3300048913 | Ga0496110_0009439 | Ga0496110_0009439_6932_7657 | 239 |
| 606 | 3300048914 | Ga0496111_0006863 | Ga0496111_0006863_5456_6181 | 239 |
| 607 | 3300048914 | Ga0496111_0069536 | Ga0496111_0069536_1190_1999 | 239 |
| 608 | 3300048915 | Ga0496112_0045592 | Ga0496112_0045592_787_1512 | 239 |
| 609 | 3300048915 | Ga0496112_0142143 | Ga0496112_0142143_1396_2124 | 239 |
| 610 | 3300048915 | Ga0496112_0231401 | Ga0496112_0231401_83_952 | 239 |
| 611 | 3300048916 | Ga0496113_0008368 | Ga0496113_0008368_1439_2164 | 239 |
| 612 | 3300048916 | Ga0496113_0770174 | Ga0496113_0770174_20_745 | 239 |
| 613 | 3300048918 | Ga0496115_0368809 | Ga0496115_0368809_92_820 | 239 |
| 614 | 3300048922 | Ga0496119_0021644 | Ga0496119_0021644_1935_2663 | 239 |
| 615 | 3300048923 | Ga0496120_0010331 | Ga0496120_0010331_2173_2901 | 239 |
| 616 | 3300048929 | Ga0496126_0019977 | Ga0496126_0019977_1936_2661 | 239 |
| 617 | 3300049571 | Ga0501034_0015519 | Ga0501034_0015519_3392_4123 | 239 |
| 618 | 3300049572 | Ga0501036_0585873 | Ga0501036_0585873_129_854 | 239 |
| 619 | 3300049573 | Ga0501037_0543421 | Ga0501037_0543421_25_756 | 239 |
| 620 | 3300049575 | Ga0501039_0507502 | Ga0501039_0507502_178_903 | 239 |
| 621 | 3300049576 | Ga0501040_0014149 | Ga0501040_0014149_3590_4315 | 239 |
| 622 | 3300049580 | Ga0501046_0331248 | Ga0501046_0331248_354_1079 | 239 |
| 623 | 3300049581 | Ga0501047_0049032 | Ga0501047_0049032_1413_2177 | 239 |
| 624 | 3300049582 | Ga0501048_0254716 | Ga0501048_0254716_462_1190 | 239 |
| 625 | 3300049586 | Ga0501070_0001514 | Ga0501070_0001514_15728_16492 | 239 |
| 626 | 3300049588 | Ga0501072_0015465 | Ga0501072_0015465_4677_5402 | 239 |
| 627 | 3300049588 | Ga0501072_0043292 | Ga0501072_0043292_1216_1980 | 239 |
| 628 | 3300049588 | Ga0501072_0055740 | Ga0501072_0055740_1599_2324 | 239 |
| 629 | 3300049588 | Ga0501072_0368856 | Ga0501072_0368856_358_1083 | 239 |
| 630 | 3300049589 | Ga0501073_0109984 | Ga0501073_0109984_839_1564 | 239 |
| 631 | 3300049590 | Ga0501074_0024883 | Ga0501074_0024883_2434_3159 | 239 |
| 632 | 3300049591 | Ga0501075_0096213 | Ga0501075_0096213_542_1267 | 239 |
| 633 | 3300049591 | Ga0501075_0135227 | Ga0501075_0135227_302_1027 | 239 |
| 634 | 3300049591 | Ga0501075_0330944 | Ga0501075_0330944_413_1141 | 239 |
| 635 | 3300049592 | Ga0501076_0009242 | Ga0501076_0009242_2880_3695 | 239 |
| 636 | 3300049592 | Ga0501076_0502018 | Ga0501076_0502018_20_745 | 239 |
| 637 | 3300049593 | Ga0501077_0046065 | Ga0501077_0046065_1254_1979 | 239 |
| 638 | 3300049593 | Ga0501077_0262511 | Ga0501077_0262511_75_800 | 239 |
| 639 | 3300049741 | Ga0501079_0006102 | Ga0501079_0006102_7397_8122 | 239 |
| 640 | 3300049741 | Ga0501079_0017971 | Ga0501079_0017971_3621_4346 | 239 |
| 641 | 3300049741 | Ga0501079_0139779 | Ga0501079_0139779_19_828 | 239 |
| 642 | 3300049741 | Ga0501079_0679599 | Ga0501079_0679599_48_773 | 239 |
| 643 | 3300049742 | Ga0501080_0109882 | Ga0501080_0109882_1243_2007 | 239 |
| 644 | 3300049742 | Ga0501080_0318290 | Ga0501080_0318290_451_1176 | 239 |
| 645 | 3300049742 | Ga0501080_0346834 | Ga0501080_0346834_84_824 | 239 |
| 646 | 3300049743 | Ga0501081_0016815 | Ga0501081_0016815_2271_2996 | 239 |
| 647 | 3300049743 | Ga0501081_0182537 | Ga0501081_0182537_572_1297 | 239 |
| 648 | 3300049822 | Ga0501035_0313992 | Ga0501035_0313992_531_1262 | 239 |
| 649 | 3300049823 | Ga0501044_0444430 | Ga0501044_0444430_22_753 | 239 |
| 650 | 3300049824 | Ga0501045_0249183 | Ga0501045_0249183_199_924 | 239 |
| 651 | 3300050489 | nmdc:mga03683_103395_c1 | nmdc:mga03683_103395_c1_288_1013 | 239 |
| 652 | 3300050489 | nmdc:mga03683_58390_c1 | nmdc:mga03683_58390_c1_724_1449 | 239 |
| 653 | 3300050490 | nmdc:mga03n38_40237_c1 | nmdc:mga03n38_40237_c1_139_867 | 239 |
| 654 | 3300050491 | nmdc:mga00v17_49624_c1 | nmdc:mga00v17_49624_c1_1392_2201 | 239 |
| 655 | 3300050492 | nmdc:mga0yw44_157233_c1 | nmdc:mga0yw44_157233_c1_74_799 | 239 |
| 656 | 3300050492 | nmdc:mga0yw44_2874_c1 | nmdc:mga0yw44_2874_c1_1812_2621 | 239 |
| 657 | 3300050492 | nmdc:mga0yw44_85847_c1 | nmdc:mga0yw44_85847_c1_780_1505 | 239 |
| 658 | 3300050492 | nmdc:mga0yw44_9815_c1 | nmdc:mga0yw44_9815_c1_4039_4764 | 239 |
| 659 | 3300050494 | nmdc:mga06z11_103120_c1 | nmdc:mga06z11_103120_c1_804_1529 | 239 |
| 660 | 3300050494 | nmdc:mga06z11_45433_c1 | nmdc:mga06z11_45433_c1_659_1384 | 239 |
| 661 | 3300050494 | nmdc:mga06z11_65071_c1 | nmdc:mga06z11_65071_c1_635_1363 | 239 |
| 662 | 3300050494 | nmdc:mga06z11_90393_c1 | nmdc:mga06z11_90393_c1_325_1131 | 239 |
| 663 | 3300050495 | nmdc:mga04h51_5824_c1 | nmdc:mga04h51_5824_c1_1536_2264 | 239 |
| 664 | 3300050508 | nmdc:mga09592_373772_c1 | nmdc:mga09592_373772_c1_256_981 | 239 |
| 665 | 3300050509 | nmdc:mga0qj67_21559_c1 | nmdc:mga0qj67_21559_c1_3946_4671 | 239 |
| 666 | 3300050509 | nmdc:mga0qj67_229684_c1 | nmdc:mga0qj67_229684_c1_460_1185 | 239 |
| 667 | 3300050509 | nmdc:mga0qj67_34476_c1 | nmdc:mga0qj67_34476_c1_236_961 | 239 |
| 668 | 3300050509 | nmdc:mga0qj67_382766_c1 | nmdc:mga0qj67_382766_c1_207_932 | 239 |
| 669 | 3300050509 | nmdc:mga0qj67_39099_c1 | nmdc:mga0qj67_39099_c1_2207_2932 | 239 |
| 670 | 3300050509 | nmdc:mga0qj67_95065_c1 | nmdc:mga0qj67_95065_c1_534_1259 | 239 |
| 671 | 3300050510 | nmdc:mga06r32_32644_c1 | nmdc:mga06r32_32644_c1_2003_2728 | 239 |
| 672 | 3300050510 | nmdc:mga06r32_33534_c1 | nmdc:mga06r32_33534_c1_673_1398 | 239 |
| 673 | 3300050510 | nmdc:mga06r32_3463_c1 | nmdc:mga06r32_3463_c1_5650_6375 | 239 |
| 674 | 3300050510 | nmdc:mga06r32_46521_c1 | nmdc:mga06r32_46521_c1_11_751 | 239 |
| 675 | 3300050510 | nmdc:mga06r32_47421_c1 | nmdc:mga06r32_47421_c1_2312_3037 | 239 |
| 676 | 3300050510 | nmdc:mga06r32_607844_c1 | nmdc:mga06r32_607844_c1_115_954 | 239 |
| 677 | 3300050510 | nmdc:mga06r32_93534_c1 | nmdc:mga06r32_93534_c1_1063_1836 | 239 |
| 678 | 3300050511 | nmdc:mga08y16_13096_c1 | nmdc:mga08y16_13096_c1_638_1363 | 239 |
| 679 | 3300050511 | nmdc:mga08y16_334135_c1 | nmdc:mga08y16_334135_c1_158_982 | 239 |
| 680 | 3300050511 | nmdc:mga08y16_70455_c1 | nmdc:mga08y16_70455_c1_1487_2326 | 239 |
| 681 | 3300050511 | nmdc:mga08y16_864617_c1 | nmdc:mga08y16_864617_c1_21_800 | 239 |
| 682 | 3300050511 | nmdc:mga08y16_87880_c1 | nmdc:mga08y16_87880_c1_630_1454 | 239 |
| 683 | 3300050512 | nmdc:mga0n895_207504_c1 | nmdc:mga0n895_207504_c1_286_1011 | 239 |
| 684 | 3300050512 | nmdc:mga0n895_896_c1 | nmdc:mga0n895_896_c1_8336_9160 | 239 |
| 685 | 3300050513 | nmdc:mga0rr50_455280_c1 | nmdc:mga0rr50_455280_c1_119_859 | 239 |
| 686 | 3300050513 | nmdc:mga0rr50_5196_c1 | nmdc:mga0rr50_5196_c1_1512_2336 | 239 |
| 687 | 3300050513 | nmdc:mga0rr50_8180_c1 | nmdc:mga0rr50_8180_c1_3836_4561 | 239 |
| 688 | 3300050514 | nmdc:mga08x19_15172_c1 | nmdc:mga08x19_15172_c1_971_1711 | 239 |
| 689 | 3300050515 | nmdc:mga0a205_206901_c1 | nmdc:mga0a205_206901_c1_886_1611 | 239 |
| 690 | 3300050515 | nmdc:mga0a205_2921_c1 | nmdc:mga0a205_2921_c1_13634_14458 | 239 |
| 691 | 3300050516 | nmdc:mga0sz30_1852_c2 | nmdc:mga0sz30_1852_c2_89_814 | 239 |
| 692 | 3300050516 | nmdc:mga0sz30_498_c1 | nmdc:mga0sz30_498_c1_13467_14192 | 239 |
| 693 | 3300053077 | Ga0495601_0000712 | Ga0495601_0000712_9943_10671 | 239 |
| 694 | 3300053077 | Ga0495601_0002860 | Ga0495601_0002860_4940_5680 | 239 |
| 695 | 3300053077 | Ga0495601_0297200 | Ga0495601_0297200_49_777 | 239 |
| 696 | 3300053078 | Ga0495612_0001184 | Ga0495612_0001184_1292_2020 | 239 |
| 697 | 3300053078 | Ga0495612_0118627 | Ga0495612_0118627_307_1065 | 239 |
| 698 | 3300053078 | Ga0495612_0199031 | Ga0495612_0199031_69_809 | 239 |
| 699 | 3300053084 | Ga0495595_0000196 | Ga0495595_0000196_4110_4850 | 239 |
| 700 | 3300053084 | Ga0495595_0016485 | Ga0495595_0016485_859_1587 | 239 |
| 701 | 3300053084 | Ga0495595_0021033 | Ga0495595_0021033_501_1229 | 239 |
| 702 | 3300053084 | Ga0495595_0146977 | Ga0495595_0146977_122_856 | 239 |
| 703 | 3300053085 | Ga0495619_0009682 | Ga0495619_0009682_4902_5630 | 239 |
| 704 | 3300053093 | Ga0500651_0223322 | Ga0500651_0223322_134_862 | 239 |
| 705 | 3300053142 | Ga0500577_0129207 | Ga0500577_0129207_290_1015 | 239 |
| 706 | 3300053153 | Ga0500616_0002029 | Ga0500616_0002029_582_1307 | 239 |
| 707 | 3300053155 | Ga0500620_010418 | Ga0500620_010418_1033_1758 | 239 |
| 708 | 3300053733 | Ga0500552_000491 | Ga0500552_000491_16_744 | 239 |
| 709 | 3300054114 | Ga0501084_0071843 | Ga0501084_0071843_911_1636 | 239 |
| 710 | 3300054114 | Ga0501084_0104908 | Ga0501084_0104908_919_1662 | 239 |
| 711 | 3300060353 | Ga0501082_0042769 | Ga0501082_0042769_1972_2697 | 239 |
| 712 | 3300060353 | Ga0501082_0053454 | Ga0501082_0053454_1385_2110 | 239 |
| 713 | 3300060353 | Ga0501082_0409096 | Ga0501082_0409096_366_1091 | 239 |
| 714 | 3300060353 | Ga0501082_0456676 | Ga0501082_0456676_185_904 | 239 |
| 715 | 3300061734 | Ga0530510_0024319 | Ga0530510_0024319_908_1633 | 239 |
| 716 | 3300061734 | Ga0530510_0035765 | Ga0530510_0035765_368_1177 | 239 |
| 717 | 3300061734 | Ga0530510_0297382 | Ga0530510_0297382_37_765 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ml0-assembly1.cif.gz_A | crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) s69a mutant from salmonella typhimurium | 0.8302 | 13 | 229 |
| 6mlv-assembly1.cif.gz_A | crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) y14a mutant from salmonella typhimurium | 0.8221 | 13 | 229 |
| 6gpm-assembly1.cif.gz_A | crystal structure of domain 2 from tmargbp | 0.8133 | 101 | 188 |
| 6xks-assembly3.cif.gz_C | crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium | 0.8101 | 13 | 95 |
| 5wjp-assembly1.cif.gz_A | crystal structure of the cyclohexadienyl dehydratase-like solute-binding protein sar11_1068 from candidatus pelagibacter ubique. | 0.8026 | 6 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5eyfB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8896 | 99 | 191 | 3.40.190.10 |
| af_P96257_184_272_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8818 | 102 | 186 | 3.40.190.10 |
| 2y7iB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8793 | 101 | 191 | 3.40.190.10 |
| 2yjpC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8661 | 102 | 191 | 3.40.190.10 |
| af_P30860_108_189_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8612 | 101 | 184 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7SK89-F1-model_v4 | ABC transporter substrate-binding protein | 0.9505 | 68 | 239 |
|
| AF-A0A2D7SK89-F1-model_v4 | ABC transporter substrate-binding protein | 0.9348 | 68 | 239 |
|
| AF-A0A2V6TN13-F1-model_v4 | Uncharacterized protein | 0.9176 | 90 | 239 |
|
| AF-A0A7S3TEX8-F1-model_v4 | Solute-binding protein family 3/N-terminal domain-containing protein | 0.8752 | 4 | 239 |
|
| AF-A0A2V6TN13-F1-model_v4 | Uncharacterized protein | 0.869 | 90 | 239 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar