F477104

General Info

Members Datasets Scaffolds Average Seq Length
717 320 715 245

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10207612|Ga0163163_102076122
Length 289
Sequence LGLAPTNREDAVPTDARVLALAIGFAGFMVQAASAQSPGTAAKQESVPMSEAAKSELAPTGVLRAGINLSNFLLVTGKSASGDPQGVSPDMAAEIAKRLGVPVKYVPYKTPGELADMAGTDAWDIGLIGAEPQRAEKIAFTAAYCEIEATYLVPAGSALKAIADVDKPGVRIAVTGRSAYGLWLDRNIKAATLVRSDTLDSAYEQFVKDKLDALAGLRPRLISDVKKLPGARILDGQFTAVQQAVGTSPKNAAGIAFLRKFVEEAKASGFVKQLIERHKVVGLSVAPPG

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
316 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.02
Nodule 0
Rhizoplane 4.74
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000858 3300003203 Bacteria 14329
2 Ga0070676_10145408 3300005328 Bacteria 1513
3 Ga0070683_100076900 3300005329 Bacteria 3121
4 Ga0070670_100049840 3300005331 Bacteria 3600
5 Ga0070666_10096579 3300005335 Unclassified 2034
6 Ga0070666_10382643 3300005335 Bacteria 1010
7 Ga0070680_100015728 3300005336 Bacteria 5940
8 Ga0070680_100018914 3300005336 Bacteria 5450
9 Ga0070660_100035269 3300005339 Bacteria 3786
10 Ga0070660_100057536 3300005339 Bacteria 3012
11 Ga0070689_100021465 3300005340 Bacteria 4808
12 Ga0070691_10008931 3300005341 Bacteria 4587
13 Ga0070691_10200059 3300005341 Bacteria 1049
14 Ga0070661_100002004 3300005344 Bacteria 14094
15 Ga0070661_100030028 3300005344 Bacteria 3925
16 Ga0070668_100060882 3300005347 Bacteria 2924
17 Ga0070668_100094942 3300005347 Bacteria 2355
18 Ga0070671_100086224 3300005355 Bacteria 2626
19 Ga0070671_100144601 3300005355 Bacteria 2007
20 Ga0070671_100288743 3300005355 Bacteria 1396
21 Ga0070673_100038692 3300005364 Bacteria 3644
22 Ga0070673_100243700 3300005364 Bacteria 1564
23 Ga0070673_100580153 3300005364 Bacteria 1021
24 Ga0070659_100125331 3300005366 Bacteria 2084
25 Ga0070667_100067343 3300005367 Bacteria 3044
26 Ga0070667_100428968 3300005367 Bacteria 1206
27 Ga0070703_10144566 3300005406 Bacteria 887
28 Ga0070709_10211631 3300005434 Unclassified 1378
29 Ga0070714_100076874 3300005435 Bacteria 2899
30 Ga0070714_100092897 3300005435 Bacteria 2645
31 Ga0070714_100202842 3300005435 Bacteria 1815
32 Ga0070714_100572269 3300005435 Bacteria 1083
33 Ga0070713_100111353 3300005436 Bacteria 2387
34 Ga0070710_10090443 3300005437 Bacteria 1804
35 Ga0070710_10444076 3300005437 Bacteria 878
36 Ga0070711_100024542 3300005439 Bacteria 3934
37 Ga0070711_100077683 3300005439 Bacteria 2357
38 Ga0070711_100124939 3300005439 Bacteria 1909
39 Ga0070711_100301821 3300005439 Bacteria 1274
40 Ga0070705_100126502 3300005440 Bacteria 1660
41 Ga0070700_100019718 3300005441 Bacteria 3896
42 Ga0070700_100344132 3300005441 Bacteria 1103
43 Ga0070694_100086279 3300005444 Bacteria 2193
44 Ga0070708_100097355 3300005445 Bacteria 2690
45 Ga0070708_100175035 3300005445 Bacteria 2005
46 Ga0070708_100265081 3300005445 Bacteria 1615
47 Ga0070708_100382449 3300005445 Bacteria 1327
48 Ga0070678_100091429 3300005456 Bacteria 2335
49 Ga0070678_100129144 3300005456 Bacteria 2005
50 Ga0070662_100197155 3300005457 Bacteria 1596
51 Ga0070681_10002271 3300005458 Bacteria 17559
52 Ga0070681_10002726 3300005458 Bacteria 16270
53 Ga0070681_10072999 3300005458 Bacteria 3393
54 Ga0070681_10296454 3300005458 Bacteria 1527
55 Ga0068867_100160534 3300005459 Bacteria 1772
56 Ga0070706_100184423 3300005467 Bacteria 1949
57 Ga0070707_100005527 3300005468 Bacteria 11812
58 Ga0070707_100051334 3300005468 Bacteria 3954
59 Ga0070707_100176381 3300005468 Bacteria 2083
60 Ga0070707_100374501 3300005468 Bacteria 1383
61 Ga0070707_100439318 3300005468 Bacteria 1265
62 Ga0070698_100000151 3300005471 Bacteria 62941
63 Ga0070698_100240034 3300005471 Bacteria 1745
64 Ga0070699_100037674 3300005518 Bacteria 4187
65 Ga0070699_100093048 3300005518 Bacteria 2637
66 Ga0070699_100471893 3300005518 Bacteria 1138
67 Ga0070679_100002206 3300005530 Bacteria 17585
68 Ga0070679_100084504 3300005530 Bacteria 3162
69 Ga0070679_100211549 3300005530 Bacteria 1903
70 Ga0070679_100222581 3300005530 Unclassified 1848
71 Ga0070684_100004651 3300005535 Bacteria 10477
72 Ga0070684_100198306 3300005535 Bacteria 1828
73 Ga0070697_100020046 3300005536 Bacteria 5286
74 Ga0068853_100002617 3300005539 Bacteria 13541
75 Ga0070672_100054452 3300005543 Bacteria 3132
76 Ga0070672_100092248 3300005543 Bacteria 2445
77 Ga0070672_100215012 3300005543 Bacteria 1611
78 Ga0070686_100148778 3300005544 Bacteria 1638
79 Ga0070665_100045868 3300005548 Bacteria 4390
80 Ga0070665_100534221 3300005548 Bacteria 1185
81 Ga0070665_100966612 3300005548 Bacteria 864
82 Ga0068855_100006805 3300005563 Bacteria 13870
83 Ga0068855_100064976 3300005563 Bacteria 4254
84 Ga0070664_100006100 3300005564 Bacteria 9745
85 Ga0070664_100081116 3300005564 Bacteria 2795
86 Ga0070664_100178422 3300005564 Bacteria 1887
87 Ga0070664_100221865 3300005564 Bacteria 1692
88 Ga0068857_100082893 3300005577 Bacteria 2865
89 Ga0068857_100338064 3300005577 Bacteria 1393
90 Ga0068857_100379154 3300005577 Bacteria 1313
91 Ga0068857_100786425 3300005577 Bacteria 908
92 Ga0068854_100203316 3300005578 Bacteria 1558
93 Ga0068856_100005989 3300005614 Bacteria 11971
94 Ga0068856_100092197 3300005614 Bacteria 3014
95 Ga0068856_100121296 3300005614 Bacteria 2616
96 Ga0068856_100145805 3300005614 Bacteria 2375
97 Ga0068856_100245538 3300005614 Bacteria 1805
98 Ga0070702_100136597 3300005615 Bacteria 1556
99 Ga0068852_100002176 3300005616 Bacteria 13431
100 Ga0068852_100226473 3300005616 Bacteria 1780
101 Ga0068859_100060184 3300005617 Bacteria 3827
102 Ga0068859_100114911 3300005617 Bacteria 2756
103 Ga0068861_100096125 3300005719 Bacteria 2347
104 Ga0068858_100265659 3300005842 Bacteria 1632
105 Ga0068860_100091970 3300005843 Bacteria 2890
106 Ga0068860_100123087 3300005843 Bacteria 2485
107 Ga0068862_100248007 3300005844 Bacteria 1622
108 Ga0068862_100255562 3300005844 Bacteria 1598
109 Ga0068862_100298786 3300005844 Bacteria 1481
110 Ga0081455_10000058 3300005937 Bacteria 119171
111 Ga0081455_10014280 3300005937 Bacteria 7794
112 Ga0081455_10014867 3300005937 Bacteria 7590
113 Ga0081455_10040186 3300005937 Bacteria 4127
114 Ga0081540_1000040 3300005983 Bacteria 136968
115 Ga0081540_1016800 3300005983 Bacteria 4561
116 Ga0081539_10000118 3300005985 Bacteria 184562
117 Ga0081539_10003667 3300005985 Bacteria 18436
118 Ga0081539_10106698 3300005985 Bacteria 1417
119 Ga0070717_10078984 3300006028 Bacteria 2758
120 Ga0070717_10174947 3300006028 Bacteria 1868
121 Ga0070717_10293321 3300006028 Bacteria 1444
122 Ga0070717_10359992 3300006028 Bacteria 1302
123 Ga0075365_10002405 3300006038 Bacteria 9164
124 Ga0075365_10128891 3300006038 Bacteria 1750
125 Ga0075365_10129417 3300006038 Bacteria 1746
126 Ga0075365_10389289 3300006038 Bacteria 983
127 Ga0075368_10003668 3300006042 Bacteria 5150
128 Ga0075368_10021831 3300006042 Bacteria 2433
129 Ga0075368_10087405 3300006042 Bacteria 1273
130 Ga0075363_100027715 3300006048 Bacteria 2907
131 Ga0075364_10010124 3300006051 Bacteria 5687
132 Ga0075432_10102773 3300006058 Bacteria 1058
133 Ga0070715_10026516 3300006163 Bacteria 2307
134 Ga0070712_100038899 3300006175 Bacteria 3253
135 Ga0070712_100070508 3300006175 Bacteria 2497
136 Ga0070712_100105208 3300006175 Bacteria 2095
137 Ga0070712_100139468 3300006175 Bacteria 1848
138 Ga0070712_100215231 3300006175 Bacteria 1517
139 Ga0075362_10082341 3300006177 Bacteria 1485
140 Ga0075362_10224942 3300006177 Bacteria 918
141 Ga0075367_10083007 3300006178 Bacteria 1941
142 Ga0075369_10001810 3300006186 Bacteria 7447
143 Ga0075428_100026575 3300006844 Bacteria 6408
144 Ga0075428_100112351 3300006844 Bacteria 2967
145 Ga0075428_100145913 3300006844 Bacteria 2572
146 Ga0075428_100450658 3300006844 Bacteria 1378
147 Ga0075428_100579662 3300006844 Bacteria 1199
148 Ga0075430_100059928 3300006846 Bacteria 3199
149 Ga0075430_100147098 3300006846 Bacteria 1962
150 Ga0075430_100236636 3300006846 Bacteria 1513
151 Ga0075430_100339119 3300006846 Bacteria 1242
152 Ga0075430_100544122 3300006846 Bacteria 957
153 Ga0075431_100003740 3300006847 Bacteria 14780
154 Ga0075431_100007662 3300006847 Bacteria 10752
155 Ga0075431_100035511 3300006847 Bacteria 5132
156 Ga0075431_100035737 3300006847 Bacteria 5116
157 Ga0075431_100048763 3300006847 Bacteria 4368
158 Ga0075431_100110767 3300006847 Bacteria 2833
159 Ga0075433_10002457 3300006852 Bacteria 14094
160 Ga0075433_10040255 3300006852 Bacteria 4045
161 Ga0075433_10100652 3300006852 Bacteria 2559
162 Ga0075434_100001552 3300006871 Bacteria 19464
163 Ga0075429_100238900 3300006880 Bacteria 1591
164 Ga0075429_100353646 3300006880 Bacteria 1286
165 Ga0075436_100085191 3300006914 Bacteria 2193
166 Ga0097620_100060186 3300006931 Bacteria 3827
167 Ga0097620_100114908 3300006931 Bacteria 2756
168 Ga0097620_100885767 3300006931 Bacteria 978
169 Ga0075435_100005800 3300007076 Bacteria 8676
170 Ga0075435_100026923 3300007076 Bacteria 4492
171 Ga0075435_100158186 3300007076 Bacteria 1908
172 Ga0099794_10292543 3300007265 Bacteria 843
173 Ga0099795_10151714 3300007788 Bacteria 949
174 Ga0105240_10002630 3300009093 Bacteria 28616
175 Ga0105240_10019378 3300009093 Bacteria 9090
176 Ga0105240_10176907 3300009093 Bacteria 2522
177 Ga0105240_10318233 3300009093 Unclassified 1774
178 Ga0105240_10514520 3300009093 Bacteria 1329
179 Ga0105240_11070846 3300009093 Bacteria 859
180 Ga0111539_10003980 3300009094 Bacteria 19415
181 Ga0111539_10008813 3300009094 Bacteria 12790
182 Ga0111539_10036498 3300009094 Bacteria 5942
183 Ga0111539_10175139 3300009094 Bacteria 2506
184 Ga0111539_10191067 3300009094 Bacteria 2389
185 Ga0105245_10142083 3300009098 Bacteria 2262
186 Ga0105245_10512308 3300009098 Unclassified 1217
187 Ga0105245_10730848 3300009098 Bacteria 1025
188 Ga0114129_10288183 3300009147 Bacteria 2192
189 Ga0114129_10390679 3300009147 Bacteria 1835
190 Ga0114129_11641492 3300009147 Bacteria 786
191 Ga0105243_10244828 3300009148 Bacteria 1597
192 Ga0105243_10700195 3300009148 Bacteria 987
193 Ga0105241_10046486 3300009174 Bacteria 3296
194 Ga0105241_10702071 3300009174 Bacteria 923
195 Ga0105248_10036725 3300009177 Bacteria 5479
196 Ga0105248_10273665 3300009177 Bacteria 1901
197 Ga0105248_10878700 3300009177 Bacteria 1012
198 Ga0105237_10149731 3300009545 Bacteria 2330
199 Ga0105237_10664275 3300009545 Bacteria 1049
200 Ga0105238_10001395 3300009551 Bacteria 24233
201 Ga0105238_10131003 3300009551 Bacteria 2486
202 Ga0105238_10281596 3300009551 Bacteria 1644
203 Ga0105249_10242527 3300009553 Bacteria 1782
204 Ga0105249_10562662 3300009553 Bacteria 1192
205 Ga0105249_10899084 3300009553 Bacteria 952
206 Ga0099796_10083298 3300010159 Bacteria 1176
207 Ga0099796_10178150 3300010159 Bacteria 852
208 Ga0105239_10372967 3300010375 Bacteria 1613
209 Ga0157373_10018195 3300013100 Bacteria 5117
210 Ga0157371_10020398 3300013102 Bacteria 4877
211 Ga0157371_10357717 3300013102 Bacteria 1063
212 Ga0157370_10028222 3300013104 Bacteria 5524
213 Ga0157370_10110453 3300013104 Bacteria 2570
214 Ga0157370_10722170 3300013104 Unclassified 909
215 Ga0157369_10027627 3300013105 Bacteria 6287
216 Ga0157369_10579116 3300013105 Bacteria 1159
217 Ga0157374_10285474 3300013296 Bacteria 1630
218 Ga0157378_10442262 3300013297 Bacteria 1289
219 Ga0163162_10023969 3300013306 Bacteria 6022
220 Ga0157372_10005959 3300013307 Bacteria 12957
221 Ga0157372_10106475 3300013307 Bacteria 3207
222 Ga0157375_10050936 3300013308 Bacteria 4064
223 Ga0163163_10207612 3300014325 Bacteria 2007
224 Ga0157380_10099565 3300014326 Bacteria 2418
225 Ga0157380_10112989 3300014326 Bacteria 2286
226 Ga0157380_10473160 3300014326 Bacteria 1210
227 Ga0182008_10015135 3300014497 Bacteria 4031
228 Ga0157379_10060599 3300014968 Plasmid 3383
229 Ga0157376_10195768 3300014969 Bacteria 1856
230 Ga0157376_10564736 3300014969 Bacteria 1128
231 Ga0163161_10230834 3300017792 Bacteria 1436
232 Ga0213873_10061209 3300021358 Bacteria 1020
233 Ga0213872_10025640 3300021361 Bacteria 2710
234 Ga0213872_10062346 3300021361 Bacteria 1685
235 Ga0213872_10073160 3300021361 Bacteria 1544
236 Ga0213876_10139037 3300021384 Bacteria 1292
237 Ga0213875_10000424 3300021388 Bacteria 37012
238 Ga0213875_10009829 3300021388 Bacteria 4823
239 Ga0213875_10014253 3300021388 Bacteria 3882
240 Ga0213875_10099822 3300021388 Bacteria 1355
241 Ga0213875_10217217 3300021388 Bacteria 901
242 Ga0207682_10119475 3300025893 Bacteria 1168
243 Ga0207692_10044804 3300025898 Bacteria 2209
244 Ga0207680_10086233 3300025903 Bacteria 1985
245 Ga0207680_10328879 3300025903 Bacteria 1070
246 Ga0207685_10013744 3300025905 Bacteria 2513
247 Ga0207699_10058486 3300025906 Bacteria 2306
248 Ga0207699_10126046 3300025906 Unclassified 1663
249 Ga0207705_10029840 3300025909 Bacteria 3888
250 Ga0207705_10190201 3300025909 Bacteria 1552
251 Ga0207705_10346648 3300025909 Bacteria 1144
252 Ga0207684_10068225 3300025910 Bacteria 3022
253 Ga0207684_10082279 3300025910 Bacteria 2741
254 Ga0207707_10041726 3300025912 Bacteria 4007
255 Ga0207707_10100127 3300025912 Bacteria 2533
256 Ga0207707_10264987 3300025912 Bacteria 1490
257 Ga0207695_10197134 3300025913 Unclassified 1929
258 Ga0207695_10228426 3300025913 Bacteria 1766
259 Ga0207695_10324475 3300025913 Bacteria 1429
260 Ga0207693_10015426 3300025915 Bacteria 6128
261 Ga0207693_10021995 3300025915 Bacteria 5069
262 Ga0207693_10055956 3300025915 Bacteria 3093
263 Ga0207693_10171102 3300025915 Bacteria 1710
264 Ga0207693_10192495 3300025915 Bacteria 1605
265 Ga0207693_10202988 3300025915 Bacteria 1559
266 Ga0207693_10282938 3300025915 Bacteria 1299
267 Ga0207693_10397448 3300025915 Bacteria 1078
268 Ga0207660_10355704 3300025917 Bacteria 1174
269 Ga0207657_10029903 3300025919 Bacteria 4951
270 Ga0207657_10296615 3300025919 Bacteria 1281
271 Ga0207649_10003790 3300025920 Bacteria 8245
272 Ga0207649_10025800 3300025920 Bacteria 3431
273 Ga0207652_10006133 3300025921 Bacteria 9720
274 Ga0207652_10113529 3300025921 Bacteria 2405
275 Ga0207652_10127613 3300025921 Bacteria 2266
276 Ga0207652_10145332 3300025921 Bacteria 2122
277 Ga0207646_10008706 3300025922 Bacteria 10125
278 Ga0207646_10117167 3300025922 Bacteria 2392
279 Ga0207646_10438130 3300025922 Bacteria 1179
280 Ga0207646_10465218 3300025922 Bacteria 1140
281 Ga0207694_10071122 3300025924 Bacteria 2718
282 Ga0207694_10241427 3300025924 Bacteria 1477
283 Ga0207650_10047749 3300025925 Bacteria 3155
284 Ga0207659_10097934 3300025926 Bacteria 2204
285 Ga0207687_10088115 3300025927 Bacteria 2257
286 Ga0207687_10164414 3300025927 Bacteria 1706
287 Ga0207700_10029099 3300025928 Bacteria 3894
288 Ga0207700_10056886 3300025928 Bacteria 2946
289 Ga0207700_10214060 3300025928 Bacteria 1631
290 Ga0207700_10261306 3300025928 Bacteria 1483
291 Ga0207664_10036468 3300025929 Bacteria 3801
292 Ga0207664_10130575 3300025929 Bacteria 2114
293 Ga0207664_10311048 3300025929 Bacteria 1388
294 Ga0207664_10503124 3300025929 Bacteria 1085
295 Ga0207644_10008559 3300025931 Bacteria 6693
296 Ga0207644_10367805 3300025931 Bacteria 1171
297 Ga0207644_10395037 3300025931 Bacteria 1129
298 Ga0207690_10053769 3300025932 Bacteria 2704
299 Ga0207706_10019719 3300025933 Bacteria 6065
300 Ga0207706_10271632 3300025933 Bacteria 1479
301 Ga0207709_10066020 3300025935 Bacteria 2277
302 Ga0207670_10049145 3300025936 Bacteria 2820
303 Ga0207670_10179831 3300025936 Bacteria 1592
304 Ga0207665_10050650 3300025939 Bacteria 2793
305 Ga0207691_10005919 3300025940 Bacteria 11807
306 Ga0207691_10115744 3300025940 Bacteria 2380
307 Ga0207711_10020650 3300025941 Bacteria 5496
308 Ga0207711_10276244 3300025941 Bacteria 1546
309 Ga0207661_10019962 3300025944 Bacteria 5002
310 Ga0207661_10370031 3300025944 Bacteria 1296
311 Ga0207661_10717491 3300025944 Bacteria 920
312 Ga0207679_10028203 3300025945 Bacteria 3892
313 Ga0207679_10052364 3300025945 Bacteria 2993
314 Ga0207679_10248931 3300025945 Bacteria 1510
315 Ga0207679_10300607 3300025945 Bacteria 1383
316 Ga0207679_10545839 3300025945 Bacteria 1039
317 Ga0207667_10031492 3300025949 Bacteria 5725
318 Ga0207667_10234870 3300025949 Bacteria 1877
319 Ga0207667_10384343 3300025949 Bacteria 1430
320 Ga0207667_10777094 3300025949 Bacteria 956
321 Ga0207668_10083105 3300025972 Bacteria 2329
322 Ga0207703_10254752 3300026035 Bacteria 1584
323 Ga0207639_10003687 3300026041 Bacteria 10295
324 Ga0207678_10154512 3300026067 Bacteria 1959
325 Ga0207678_10642033 3300026067 Bacteria 932
326 Ga0207708_10008880 3300026075 Bacteria 7439
327 Ga0207708_10366322 3300026075 Bacteria 1185
328 Ga0207708_10406907 3300026075 Bacteria 1126
329 Ga0207702_10014050 3300026078 Bacteria 6648
330 Ga0207702_10049619 3300026078 Plasmid 3542
331 Ga0207702_10057572 3300026078 Bacteria 3304
332 Ga0207702_10155645 3300026078 Bacteria 2083
333 Ga0207641_10038460 3300026088 Bacteria 4000
334 Ga0207648_10165786 3300026089 Bacteria 1952
335 Ga0207648_10218927 3300026089 Bacteria 1692
336 Ga0207648_10607214 3300026089 Bacteria 1009
337 Ga0207676_10645730 3300026095 Bacteria 1021
338 Ga0207676_10791329 3300026095 Bacteria 925
339 Ga0207674_10000005 3300026116 Bacteria 237935
340 Ga0207674_10012502 3300026116 Bacteria 9484
341 Ga0207674_10084065 3300026116 Bacteria 3181
342 Ga0207674_10108400 3300026116 Bacteria 2754
343 Ga0207674_10789946 3300026116 Bacteria 916
344 Ga0207675_100033679 3300026118 Bacteria 4773
345 Ga0207675_100082428 3300026118 Bacteria 3017
346 Ga0207683_10305156 3300026121 Bacteria 1456
347 Ga0207698_10076754 3300026142 Bacteria 2676
348 Ga0207698_10336881 3300026142 Unclassified 1419
349 Ga0209813_10001131 3300027866 Bacteria 5943
350 Ga0207428_10000820 3300027907 Bacteria 35016
351 Ga0207428_10023160 3300027907 Bacteria 5226
352 Ga0207428_10109523 3300027907 Bacteria 2127
353 Ga0207428_10183983 3300027907 Bacteria 1577
354 Ga0207428_10477781 3300027907 Unclassified 907
355 Ga0268265_10191522 3300028380 Bacteria 1766
356 Ga0268265_10515605 3300028380 Bacteria 1129
357 Ga0268265_10606819 3300028380 Bacteria 1047
358 Ga0268264_10217565 3300028381 Bacteria 1757
359 Ga0265338_10110649 3300028800 Bacteria 2213
360 Ga0265762_1033348 3300030760 Bacteria 985
361 Ga0265760_10020451 3300031090 Bacteria 1911
362 Ga0265339_10000047 3300031249 Bacteria 110601
363 Ga0265316_10308211 3300031344 Bacteria 1152
364 Ga0307408_100335510 3300031548 Bacteria 1278
365 Ga0265313_10000069 3300031595 Bacteria 100065
366 Ga0265313_10121941 3300031595 Unclassified 1136
367 Ga0316576_10109279 3300031727 Bacteria 2072
368 Ga0307406_10370964 3300031901 Bacteria 1125
369 Ga0307416_100241314 3300032002 Bacteria 1751
370 Ga0373950_0010782 3300034818 Bacteria 1483
371 Ga0373926_0073934 3300035083 Bacteria 1255
372 Ga0373934_0093214 3300035086 Bacteria 1215
373 Ga0373940_0004606 3300035088 Bacteria 2925
374 Ga0373940_0010882 3300035088 Bacteria 2150
375 Ga0373940_0106758 3300035088 Bacteria 855
376 Ga0373923_0044031 3300035111 Bacteria 1849
377 Ga0373923_0071502 3300035111 Bacteria 1490
378 Ga0373936_0092067 3300035113 Bacteria 1272
379 Ga0373939_0002275 3300035114 Bacteria 4540
380 Ga0373939_0012130 3300035114 Bacteria 2191
381 Ga0373941_0013366 3300035115 Bacteria 2169
382 Ga0373953_0007043 3300035117 Bacteria 3744
383 Ga0373953_0053349 3300035117 Bacteria 1639
384 Ga0373954_0053704 3300035118 Bacteria 1894
385 Ga0373956_0183323 3300035119 Bacteria 990
386 Ga0373957_0043487 3300035120 Unclassified 1698
387 Ga0373957_0066338 3300035120 Bacteria 1405
388 Ga0373946_0077574 3300035171 Bacteria 1448
389 Ga0373946_0089460 3300035171 Bacteria 1362
390 Ga0373955_0013905 3300035172 Bacteria 3905
391 Ga0373955_0037958 3300035172 Bacteria 2564
392 Ga0373942_0016762 3300035207 Bacteria 1800
393 Ga0373942_0081450 3300035207 Bacteria 962
394 Ga0373961_0010010 3300035241 Bacteria 2331
395 Ga0373961_0019586 3300035241 Bacteria 1780
396 Ga0373962_0014124 3300035242 Bacteria 2031
397 Ga0316574_0250935 3300035398 Unclassified 1131
398 Ga0373924_0044852 3300035410 Bacteria 1818
399 Ga0373924_0113203 3300035410 Unclassified 1174
400 Ga0373931_0007066 3300035691 Bacteria 5278
401 Ga0373931_0013645 3300035691 Bacteria 3960
402 Ga0373931_0050747 3300035691 Bacteria 2208
403 Ga0373931_0183971 3300035691 Bacteria 1239
404 Ga0373931_0258801 3300035691 Bacteria 1061
405 Ga0373935_0033555 3300035692 Bacteria 3195
406 Ga0373935_0073612 3300035692 Bacteria 2207
407 Ga0373935_0082099 3300035692 Bacteria 2097
408 Ga0373935_0285236 3300035692 Bacteria 1163
409 Ga0373927_0044150 3300035695 Bacteria 2884
410 Ga0373927_0071306 3300035695 Bacteria 2249
411 Ga0373927_0163066 3300035695 Bacteria 1461
412 Ga0373927_0191689 3300035695 Bacteria 1341
413 Ga0373927_0310970 3300035695 Bacteria 1037
414 Ga0373933_0004861 3300035724 Bacteria 7334
415 Ga0373933_0011796 3300035724 Bacteria 4826
416 Ga0373933_0016852 3300035724 Bacteria 4094
417 Ga0373933_0097211 3300035724 Bacteria 1823
418 Ga0373933_0162416 3300035724 Bacteria 1419
419 Ga0373947_0016322 3300035725 Bacteria 4268
420 Ga0373947_0197397 3300035725 Bacteria 1315
421 Ga0373947_0284726 3300035725 Unclassified 1099
422 Ga0373947_0378709 3300035725 Bacteria 952
423 Ga0373937_0000761 3300036401 Bacteria 27843
424 Ga0373937_0136329 3300036401 Bacteria 2295
425 Ga0373937_0374780 3300036401 Bacteria 1349
426 Ga0316584_0147376 3300036712 Bacteria 1753
427 Ga0373925_0037185 3300037068 Bacteria 3593
428 Ga0373925_0050679 3300037068 Bacteria 3097
429 Ga0373925_0109152 3300037068 Bacteria 2136
430 Ga0373925_0533388 3300037068 Bacteria 965
431 Ga0373925_0685459 3300037068 Bacteria 845
432 Ga0395899_0024032 3300037312 Bacteria 4609
433 Ga0395899_0069251 3300037312 Bacteria 2584
434 Ga0395899_0088176 3300037312 Bacteria 2251
435 Ga0395900_0021639 3300037418 Bacteria 6574
436 Ga0395900_0077801 3300037418 Bacteria 3408
437 Ga0395900_0168974 3300037418 Bacteria 2227
438 Ga0395898_0022898 3300037466 Bacteria 6317
439 Ga0395905_0603119 3300037471 Bacteria 1000
440 Ga0436364_0108726 3300037853 Bacteria 1264
441 Ga0436364_0141915 3300037853 Bacteria 16587
442 Ga0436364_0286343 3300037853 Bacteria 1598
443 Ga0436364_0663275 3300037853 Bacteria 97909
444 Ga0436364_0668296 3300037853 Bacteria 132076
445 Ga0436364_1070480 3300037853 Bacteria 1140
446 Ga0436364_1100698 3300037853 Bacteria 2819
447 Ga0436364_1147233 3300037853 Bacteria 1375
448 Ga0436364_1324861 3300037853 Bacteria 2239
449 Ga0436364_1427712 3300037853 Bacteria 1088
450 Ga0436364_1502786 3300037853 Bacteria 3112
451 Ga0395901_0004105 3300038443 Bacteria 14682
452 Ga0395901_0027696 3300038443 Bacteria 5826
453 Ga0436365_0585284 3300039437 Bacteria 1374
454 Ga0436365_0750241 3300039437 Bacteria 3919
455 Ga0436365_0758860 3300039437 Bacteria 2253
456 Ga0436365_0941153 3300039437 Bacteria 2382
457 Ga0436365_1479190 3300039437 Bacteria 1623
458 Ga0436360_0427988 3300039438 Bacteria 1983
459 Ga0436360_0923341 3300039438 Bacteria 4418
460 Ga0436360_0981069 3300039438 Bacteria 3532
461 Ga0436360_1116770 3300039438 Bacteria 1047
462 Ga0436360_1179304 3300039438 Bacteria 1252
463 Ga0436360_1203512 3300039438 Bacteria 1343
464 Ga0436360_1369054 3300039438 Bacteria 4584
465 Ga0436361_0537570 3300039447 Bacteria 1563
466 Ga0436361_0661457 3300039447 Bacteria 3507
467 Ga0436361_0819334 3300039447 Bacteria 1666
468 Ga0436361_0895546 3300039447 Bacteria 3935
469 Ga0436363_0337004 3300039450 Bacteria 755
470 Ga0436363_0630022 3300039450 Bacteria 1215
471 Ga0436363_1370045 3300039450 Bacteria 1051
472 Ga0436362_0018763 3300039453 Bacteria 2619
473 Ga0436362_0151417 3300039453 Bacteria 1687
474 Ga0436362_0821186 3300039453 Bacteria 1967
475 Ga0436362_0905187 3300039453 Bacteria 956
476 Ga0451807_1379513 3300041486 Unclassified 1370
477 Ga0451577_0058318 3300042876 Bacteria 3442
478 Ga0466963_0034271 3300044694 Bacteria 3303
479 Ga0466963_0063652 3300044694 Bacteria 2469
480 Ga0466963_0139486 3300044694 Bacteria 1679
481 Ga0453684_0221968 3300044712 Bacteria 2189
482 Ga0466957_0029268 3300044842 Bacteria 3283
483 Ga0466960_0159009 3300044901 Bacteria 1212
484 Ga0451576_0000231 3300045051 Bacteria 136040
485 Ga0466958_0278385 3300045836 Unclassified 1072
486 Ga0466967_0017620 3300045976 Bacteria 5679
487 Ga0466967_0047199 3300045976 Bacteria 3754
488 Ga0466967_0434529 3300045976 Bacteria 1281
489 Ga0466967_0541993 3300045976 Bacteria 1145
490 Ga0466967_0820418 3300045976 Bacteria 924
491 Ga0495592_0207647 3300046454 Unclassified 1317
492 Ga0495592_0296424 3300046454 Bacteria 1052
493 Ga0495592_0457795 3300046454 Bacteria 798
494 Ga0495603_0060560 3300046455 Bacteria 2237
495 Ga0495629_0009132 3300046459 Bacteria 7262
496 Ga0495629_0050778 3300046459 Bacteria 2904
497 Ga0495629_0324725 3300046459 Bacteria 1052
498 Ga0495651_0001110 3300046462 Bacteria 20796
499 Ga0495651_0035681 3300046462 Bacteria 3871
500 Ga0495651_0210964 3300046462 Bacteria 1351
501 Ga0495653_0015948 3300046463 Bacteria 6125
502 Ga0495580_0033025 3300046472 Bacteria 3730
503 Ga0495580_0331218 3300046472 Bacteria 1034
504 Ga0495582_0201455 3300046473 Bacteria 1137
505 Ga0495664_0003048 3300046477 Bacteria 9072
506 Ga0495664_0203852 3300046477 Unclassified 1198
507 Ga0495664_0451982 3300046477 Bacteria 769
508 Ga0495594_0091952 3300046499 Bacteria 1701
509 Ga0495608_0002474 3300046511 Bacteria 13250
510 Ga0495608_0003631 3300046511 Bacteria 11079
511 Ga0495608_0010040 3300046511 Bacteria 6604
512 Ga0495608_0346536 3300046511 Unclassified 915
513 Ga0495618_0004450 3300046514 Bacteria 8617
514 Ga0495618_0243946 3300046514 Bacteria 1129
515 Ga0495628_0026011 3300046516 Bacteria 4778
516 Ga0495628_0162703 3300046516 Bacteria 1695
517 Ga0495630_0188579 3300046517 Bacteria 1573
518 Ga0495642_0092971 3300046528 Bacteria 1278
519 Ga0495652_0008869 3300046529 Bacteria 9150
520 Ga0495640_0013010 3300046533 Bacteria 6339
521 Ga0495640_0013014 3300046533 Bacteria 6337
522 Ga0495640_0089210 3300046533 Bacteria 2037
523 Ga0495640_0095657 3300046533 Bacteria 1955
524 Ga0495640_0302616 3300046533 Bacteria 993
525 Ga0495587_0003059 3300046536 Bacteria 11171
526 Ga0495587_0003972 3300046536 Bacteria 9806
527 Ga0495587_0126345 3300046536 Bacteria 1463
528 Ga0495645_0026353 3300046543 Bacteria 4219
529 Ga0495645_0130339 3300046543 Bacteria 1763
530 Ga0495645_0197727 3300046543 Bacteria 1366
531 Ga0495645_0327354 3300046543 Bacteria 993
532 Ga0495667_0002458 3300046559 Bacteria 12367
533 Ga0495667_0095069 3300046559 Bacteria 1930
534 Ga0495667_0217275 3300046559 Bacteria 1221
535 Ga0495634_0021446 3300046642 Bacteria 4566
536 Ga0495634_0315460 3300046642 Bacteria 942
537 Ga0495635_0134069 3300046663 Bacteria 1688
538 Ga0495635_0263073 3300046663 Bacteria 1161
539 Ga0495599_0006436 3300046678 Bacteria 7084
540 Ga0495599_0194900 3300046678 Bacteria 1245
541 Ga0495623_0054108 3300046679 Bacteria 2533
542 Ga0495623_0056199 3300046679 Unclassified 2478
543 Ga0495646_0024219 3300046680 Bacteria 3823
544 Ga0495646_0092056 3300046680 Unclassified 1749
545 Ga0495658_0044840 3300046683 Bacteria 2479
546 Ga0495658_0364690 3300046683 Bacteria 919
547 Ga0495669_0003664 3300046684 Bacteria 6327
548 Ga0495613_0160950 3300046689 Bacteria 1597
549 Ga0495613_0243124 3300046689 Bacteria 1258
550 Ga0495613_0326434 3300046689 Bacteria 1058
551 Ga0495670_0149208 3300046691 Bacteria 1226
552 Ga0495600_0001916 3300046809 Bacteria 11682
553 Ga0495600_0033817 3300046809 Unclassified 3319
554 Ga0495600_0213057 3300046809 Bacteria 1237
555 Ga0495581_0114871 3300047315 Bacteria 1566
556 Ga0495581_0430511 3300047315 Bacteria 769
557 Ga0495604_0016624 3300047317 Bacteria 5884
558 Ga0495604_0237929 3300047317 Bacteria 1246
559 Ga0495604_0309282 3300047317 Unclassified 1059
560 Ga0495636_0223409 3300047318 Bacteria 865
561 Ga0495674_0002245 3300047319 Bacteria 18988
562 Ga0495676_0373977 3300047321 Bacteria 949
563 Ga0495680_0001116 3300047322 Bacteria 29627
564 Ga0495680_0109017 3300047322 Bacteria 2054
565 Ga0495675_0008949 3300047444 Bacteria 6225
566 Ga0495675_0009772 3300047444 Bacteria 5983
567 Ga0495684_0080283 3300047471 Bacteria 2476
568 Ga0495684_0215571 3300047471 Bacteria 1410
569 Ga0495602_0000398 3300048088 Bacteria 40599
570 Ga0495602_0003277 3300048088 Bacteria 16722
571 Ga0495602_0083357 3300048088 Bacteria 2679
572 Ga0496100_0189029 3300048903 Bacteria 1494
573 Ga0496100_0317406 3300048903 Bacteria 1170
574 Ga0496101_0226698 3300048904 Bacteria 1452
575 Ga0496102_0130395 3300048905 Bacteria 2352
576 Ga0496102_0252018 3300048905 Bacteria 1665
577 Ga0496104_0000182 3300048907 Bacteria 56117
578 Ga0496104_0157687 3300048907 Bacteria 2178
579 Ga0496104_0161275 3300048907 Bacteria 2151
580 Ga0496104_0256037 3300048907 Bacteria 1663
581 Ga0496104_0951254 3300048907 Bacteria 763
582 Ga0496105_0018209 3300048908 Bacteria 5640
583 Ga0496106_0042250 3300048909 Bacteria 3419
584 Ga0496107_0084564 3300048910 Bacteria 2315
585 Ga0496108_0014116 3300048911 Bacteria 6516
586 Ga0496108_0144705 3300048911 Bacteria 2049
587 Ga0496108_0338840 3300048911 Unclassified 1312
588 Ga0496109_0004093 3300048912 Bacteria 12190
589 Ga0496109_0084299 3300048912 Bacteria 2932
590 Ga0496109_0311928 3300048912 Bacteria 1484
591 Ga0496110_0009439 3300048913 Bacteria 7902
592 Ga0496110_0062738 3300048913 Bacteria 3283
593 Ga0496111_0006863 3300048914 Bacteria 7430
594 Ga0496111_0069536 3300048914 Bacteria 2560
595 Ga0496111_0089794 3300048914 Bacteria 2251
596 Ga0496112_0022376 3300048915 Bacteria 6025
597 Ga0496112_0045592 3300048915 Bacteria 4298
598 Ga0496112_0072626 3300048915 Bacteria 3401
599 Ga0496112_0142143 3300048915 Unclassified 2369
600 Ga0496112_0231401 3300048915 Bacteria 1803
601 Ga0496113_0008368 3300048916 Bacteria 6739
602 Ga0496113_0770174 3300048916 Bacteria 766
603 Ga0496115_0219333 3300048918 Bacteria 1570
604 Ga0496115_0368809 3300048918 Unclassified 1169
605 Ga0496119_0021644 3300048922 Bacteria 4636
606 Ga0496120_0010331 3300048923 Bacteria 6525
607 Ga0496126_0019977 3300048929 Bacteria 6582
608 Ga0501034_0015519 3300049571 Bacteria 7826
609 Ga0501036_0585873 3300049572 Bacteria 926
610 Ga0501037_0543421 3300049573 Bacteria 785
611 Ga0501039_0507502 3300049575 Bacteria 947
612 Ga0501040_0014149 3300049576 Bacteria 5252
613 Ga0501046_0331248 3300049580 Bacteria 1108
614 Ga0501047_0049032 3300049581 Bacteria 4078
615 Ga0501048_0254716 3300049582 Bacteria 1247
616 Ga0501070_0001514 3300049586 Bacteria 20720
617 Ga0501072_0015465 3300049588 Bacteria 5850
618 Ga0501072_0043292 3300049588 Bacteria 3538
619 Ga0501072_0055740 3300049588 Bacteria 3115
620 Ga0501072_0368856 3300049588 Bacteria 1140
621 Ga0501073_0109984 3300049589 Bacteria 1912
622 Ga0501074_0024883 3300049590 Bacteria 4349
623 Ga0501075_0096213 3300049591 Bacteria 2247
624 Ga0501075_0135227 3300049591 Bacteria 1878
625 Ga0501075_0330944 3300049591 Bacteria 1161
626 Ga0501076_0009242 3300049592 Bacteria 7272
627 Ga0501076_0502018 3300049592 Bacteria 1000
628 Ga0501077_0046065 3300049593 Bacteria 2771
629 Ga0501077_0262511 3300049593 Bacteria 1098
630 Ga0501079_0006102 3300049741 Bacteria 9033
631 Ga0501079_0017971 3300049741 Bacteria 5399
632 Ga0501079_0139779 3300049741 Bacteria 1886
633 Ga0501079_0679599 3300049741 Bacteria 810
634 Ga0501080_0109882 3300049742 Bacteria 2555
635 Ga0501080_0318290 3300049742 Unclassified 1409
636 Ga0501080_0346834 3300049742 Unclassified 1341
637 Ga0501081_0016815 3300049743 Bacteria 4836
638 Ga0501081_0182537 3300049743 Bacteria 1518
639 Ga0501035_0313992 3300049822 Bacteria 1318
640 Ga0501044_0141440 3300049823 Bacteria 2395
641 Ga0501044_0444430 3300049823 Bacteria 1204
642 Ga0501045_0249183 3300049824 Bacteria 1322
643 nmdc:mga03683_103395_c1 3300050489 Bacteria 1254
644 nmdc:mga03683_32200_c1 3300050489 Bacteria 2108
645 nmdc:mga03683_58390_c1 3300050489 Bacteria 1626
646 nmdc:mga03n38_40237_c1 3300050490 Bacteria 2031
647 nmdc:mga00v17_49624_c1 3300050491 Bacteria 2547
648 nmdc:mga0yw44_157233_c1 3300050492 Bacteria 1486
649 nmdc:mga0yw44_2874_c1 3300050492 Bacteria 7483
650 nmdc:mga0yw44_85847_c1 3300050492 Bacteria 1981
651 nmdc:mga0yw44_9815_c1 3300050492 Bacteria 4861
652 nmdc:mga0k408_213338_c1 3300050493 Bacteria 1153
653 nmdc:mga06z11_103120_c1 3300050494 Bacteria 1568
654 nmdc:mga06z11_45433_c1 3300050494 Bacteria 2220
655 nmdc:mga06z11_65071_c1 3300050494 Bacteria 1913
656 nmdc:mga06z11_90393_c1 3300050494 Bacteria 1661
657 nmdc:mga04h51_5824_c1 3300050495 Bacteria 3159
658 nmdc:mga09592_373772_c1 3300050508 Bacteria 1233
659 nmdc:mga0qj67_21559_c1 3300050509 Bacteria 4943
660 nmdc:mga0qj67_229684_c1 3300050509 Bacteria 1506
661 nmdc:mga0qj67_34476_c1 3300050509 Bacteria 3954
662 nmdc:mga0qj67_382766_c1 3300050509 Bacteria 1136
663 nmdc:mga0qj67_39099_c1 3300050509 Bacteria 3724
664 nmdc:mga0qj67_95065_c1 3300050509 Bacteria 2398
665 nmdc:mga06r32_32644_c1 3300050510 Bacteria 4900
666 nmdc:mga06r32_33534_c1 3300050510 Bacteria 4836
667 nmdc:mga06r32_3463_c1 3300050510 Bacteria 14091
668 nmdc:mga06r32_46521_c1 3300050510 Bacteria 4140
669 nmdc:mga06r32_47421_c1 3300050510 Bacteria 4104
670 nmdc:mga06r32_607844_c1 3300050510 Bacteria 1064
671 nmdc:mga06r32_93534_c1 3300050510 Bacteria 2940
672 nmdc:mga08y16_13096_c1 3300050511 Bacteria 8725
673 nmdc:mga08y16_334135_c1 3300050511 Bacteria 1558
674 nmdc:mga08y16_70455_c1 3300050511 Bacteria 3645
675 nmdc:mga08y16_864617_c1 3300050511 Unclassified 893
676 nmdc:mga08y16_87880_c1 3300050511 Bacteria 3239
677 nmdc:mga0n895_207504_c1 3300050512 Bacteria 1990
678 nmdc:mga0n895_896_c1 3300050512 Bacteria 21473
679 nmdc:mga0rr50_455280_c1 3300050513 Bacteria 1085
680 nmdc:mga0rr50_5196_c1 3300050513 Bacteria 7739
681 nmdc:mga0rr50_8180_c1 3300050513 Bacteria 6494
682 nmdc:mga08x19_15172_c1 3300050514 Bacteria 4684
683 nmdc:mga0a205_206901_c1 3300050515 Bacteria 1851
684 nmdc:mga0a205_2921_c1 3300050515 Bacteria 15133
685 nmdc:mga0sz30_1852_c2 3300050516 Bacteria 1449
686 nmdc:mga0sz30_498_c1 3300050516 Bacteria 14575
687 Ga0495601_0000712 3300053077 Bacteria 17859
688 Ga0495601_0002860 3300053077 Bacteria 9810
689 Ga0495601_0297200 3300053077 Bacteria 1052
690 Ga0495612_0001184 3300053078 Bacteria 10747
691 Ga0495612_0118627 3300053078 Bacteria 1137
692 Ga0495612_0199031 3300053078 Unclassified 883
693 Ga0495595_0000196 3300053084 Bacteria 24609
694 Ga0495595_0006523 3300053084 Bacteria 4759
695 Ga0495595_0016485 3300053084 Bacteria 3162
696 Ga0495595_0021033 3300053084 Bacteria 2847
697 Ga0495595_0146977 3300053084 Bacteria 1158
698 Ga0495595_0296113 3300053084 Unclassified 813
699 Ga0495619_0004840 3300053085 Bacteria 8547
700 Ga0495619_0009682 3300053085 Bacteria 6076
701 Ga0495619_0116253 3300053085 Bacteria 1831
702 Ga0500651_0223322 3300053093 Bacteria 1104
703 Ga0500577_0129207 3300053142 Bacteria 1058
704 Ga0500616_0002029 3300053153 Bacteria 17855
705 Ga0500620_010418 3300053155 Bacteria 2446
706 Ga0500552_000491 3300053733 Bacteria 3661
707 Ga0501084_0071843 3300054114 Bacteria 2898
708 Ga0501084_0104908 3300054114 Bacteria 2374
709 Ga0501082_0042769 3300060353 Bacteria 3905
710 Ga0501082_0053454 3300060353 Bacteria 3482
711 Ga0501082_0409096 3300060353 Bacteria 1184
712 Ga0501082_0456676 3300060353 Bacteria 1116
713 Ga0530510_0024319 3300061734 Bacteria 4321
714 Ga0530510_0035765 3300061734 Bacteria 3580
715 Ga0530510_0297382 3300061734 Bacteria 1208

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0337004 Ga0436363_0337004_83_685 197
2 3300047317 Ga0495604_0309282 Ga0495604_0309282_279_965 224
3 3300053084 Ga0495595_0296113 Ga0495595_0296113_95_781 224
4 3300053085 Ga0495619_0116253 Ga0495619_0116253_53_739 224
5 3300009147 Ga0114129_10288183 Ga0114129_102881831 226
6 3300046559 Ga0495667_0095069 Ga0495667_0095069_1029_1769 226
7 3300005445 Ga0070708_100265081 Ga0070708_1002650812 227
8 3300005468 Ga0070707_100374501 Ga0070707_1003745012 227
9 3300005518 Ga0070699_100471893 Ga0070699_1004718932 227
10 3300025910 Ga0207684_10082279 Ga0207684_100822792 227
11 3300025922 Ga0207646_10438130 Ga0207646_104381302 227
12 3300027907 Ga0207428_10000820 Ga0207428_100008205 230
13 3300039438 Ga0436360_0981069 Ga0436360_0981069_2629_3360 230
14 3300039453 Ga0436362_0151417 Ga0436362_0151417_789_1520 230
15 3300037068 Ga0373925_0109152 Ga0373925_0109152_590_1315 231
16 3300005340 Ga0070689_100021465 Ga0070689_1000214654 232
17 3300006177 Ga0075362_10224942 Ga0075362_102249422 232
18 3300035241 Ga0373961_0019586 Ga0373961_0019586_302_1006 232
19 3300050489 nmdc:mga03683_32200_c1 nmdc:mga03683_32200_c1_497_1222 232
20 3300050493 nmdc:mga0k408_213338_c1 nmdc:mga0k408_213338_c1_17_742 232
21 3300005445 Ga0070708_100097355 Ga0070708_1000973552 233
22 3300005536 Ga0070697_100020046 Ga0070697_1000200467 233
23 3300005328 Ga0070676_10145408 Ga0070676_101454082 234
24 3300005331 Ga0070670_100049840 Ga0070670_1000498402 234
25 3300005335 Ga0070666_10096579 Ga0070666_100965792 234
26 3300005355 Ga0070671_100086224 Ga0070671_1000862241 234
27 3300005364 Ga0070673_100038692 Ga0070673_1000386921 234
28 3300005367 Ga0070667_100067343 Ga0070667_1000673434 234
29 3300005543 Ga0070672_100092248 Ga0070672_1000922482 234
30 3300005548 Ga0070665_100045868 Ga0070665_1000458682 234
31 3300005615 Ga0070702_100136597 Ga0070702_1001365972 234
32 3300005617 Ga0068859_100114911 Ga0068859_1001149112 234
33 3300006931 Ga0097620_100114908 Ga0097620_1001149082 234
34 3300009098 Ga0105245_10142083 Ga0105245_101420832 234
35 3300014968 Ga0157379_10060599 Ga0157379_100605993 234
36 3300025903 Ga0207680_10086233 Ga0207680_100862332 234
37 3300025915 Ga0207693_10015426 Ga0207693_100154261 234
38 3300025925 Ga0207650_10047749 Ga0207650_100477494 234
39 3300025927 Ga0207687_10164414 Ga0207687_101644142 234
40 3300025931 Ga0207644_10008559 Ga0207644_100085595 234
41 3300025936 Ga0207670_10049145 Ga0207670_100491454 234
42 3300025940 Ga0207691_10115744 Ga0207691_101157442 234
43 3300025945 Ga0207679_10545839 Ga0207679_105458391 234
44 3300048911 Ga0496108_0338840 Ga0496108_0338840_206_919 234
45 3300048914 Ga0496111_0089794 Ga0496111_0089794_54_767 234
46 iso_pu_bacteria 2929199973 2929200466 235
47 iso_pu_bacteria 8055909800 8055914638 235
48 3300005530 Ga0070679_100211549 Ga0070679_1002115492 237
49 3300007265 Ga0099794_10292543 Ga0099794_102925431 237
50 3300021388 Ga0213875_10014253 Ga0213875_100142532 237
51 3300025921 Ga0207652_10113529 Ga0207652_101135292 237
52 3300025949 Ga0207667_10777094 Ga0207667_107770942 237
53 3300037853 Ga0436364_0141915 Ga0436364_0141915_13273_13986 237
54 3300048907 Ga0496104_0951254 Ga0496104_0951254_14_748 237
55 3300048913 Ga0496110_0062738 Ga0496110_0062738_1966_2700 237
56 3300048915 Ga0496112_0072626 Ga0496112_0072626_1299_2033 237
57 3300006175 Ga0070712_100038899 Ga0070712_1000388994 238
58 3300025915 Ga0207693_10202988 Ga0207693_102029882 238
59 3300030760 Ga0265762_1033348 Ga0265762_10333481 238
60 3300031090 Ga0265760_10020451 Ga0265760_100204512 238
61 3300035691 Ga0373931_0258801 Ga0373931_0258801_327_1043 238
62 3300039438 Ga0436360_1179304 Ga0436360_1179304_377_1099 238
63 3300042876 Ga0451577_0058318 Ga0451577_0058318_232_948 238
64 3300045051 Ga0451576_0000231 Ga0451576_0000231_12239_12961 238
65 3300048904 Ga0496101_0226698 Ga0496101_0226698_40_762 238
66 3300048905 Ga0496102_0252018 Ga0496102_0252018_632_1354 238
67 3300048907 Ga0496104_0161275 Ga0496104_0161275_845_1567 238
68 3300048910 Ga0496107_0084564 Ga0496107_0084564_204_926 238
69 3300048911 Ga0496108_0144705 Ga0496108_0144705_138_860 238
70 3300048915 Ga0496112_0022376 Ga0496112_0022376_2031_2753 238
71 3300048918 Ga0496115_0219333 Ga0496115_0219333_168_890 238
72 3300049823 Ga0501044_0141440 Ga0501044_0141440_1153_1884 238
73 3300053084 Ga0495595_0006523 Ga0495595_0006523_1145_1873 238
74 3300053085 Ga0495619_0004840 Ga0495619_0004840_5046_5774 238
75 3300003203 JGI25406J46586_10000858 JGI25406J46586_100008586 239
76 3300005329 Ga0070683_100076900 Ga0070683_1000769002 239
77 3300005335 Ga0070666_10382643 Ga0070666_103826431 239
78 3300005336 Ga0070680_100015728 Ga0070680_1000157284 239
79 3300005336 Ga0070680_100018914 Ga0070680_1000189142 239
80 3300005339 Ga0070660_100035269 Ga0070660_1000352692 239
81 3300005339 Ga0070660_100057536 Ga0070660_1000575362 239
82 3300005341 Ga0070691_10008931 Ga0070691_100089312 239
83 3300005341 Ga0070691_10200059 Ga0070691_102000591 239
84 3300005344 Ga0070661_100002004 Ga0070661_10000200414 239
85 3300005344 Ga0070661_100030028 Ga0070661_1000300282 239
86 3300005347 Ga0070668_100060882 Ga0070668_1000608823 239
87 3300005347 Ga0070668_100094942 Ga0070668_1000949422 239
88 3300005355 Ga0070671_100144601 Ga0070671_1001446012 239
89 3300005355 Ga0070671_100288743 Ga0070671_1002887432 239
90 3300005364 Ga0070673_100243700 Ga0070673_1002437002 239
91 3300005364 Ga0070673_100580153 Ga0070673_1005801531 239
92 3300005366 Ga0070659_100125331 Ga0070659_1001253312 239
93 3300005367 Ga0070667_100428968 Ga0070667_1004289681 239
94 3300005406 Ga0070703_10144566 Ga0070703_101445661 239
95 3300005434 Ga0070709_10211631 Ga0070709_102116311 239
96 3300005435 Ga0070714_100076874 Ga0070714_1000768742 239
97 3300005435 Ga0070714_100092897 Ga0070714_1000928972 239
98 3300005435 Ga0070714_100202842 Ga0070714_1002028421 239
99 3300005435 Ga0070714_100572269 Ga0070714_1005722691 239
100 3300005436 Ga0070713_100111353 Ga0070713_1001113532 239
101 3300005437 Ga0070710_10090443 Ga0070710_100904432 239
102 3300005437 Ga0070710_10444076 Ga0070710_104440761 239
103 3300005439 Ga0070711_100024542 Ga0070711_1000245423 239
104 3300005439 Ga0070711_100077683 Ga0070711_1000776832 239
105 3300005439 Ga0070711_100124939 Ga0070711_1001249392 239
106 3300005439 Ga0070711_100301821 Ga0070711_1003018211 239
107 3300005440 Ga0070705_100126502 Ga0070705_1001265022 239
108 3300005441 Ga0070700_100019718 Ga0070700_1000197181 239
109 3300005441 Ga0070700_100344132 Ga0070700_1003441321 239
110 3300005444 Ga0070694_100086279 Ga0070694_1000862792 239
111 3300005445 Ga0070708_100175035 Ga0070708_1001750351 239
112 3300005445 Ga0070708_100382449 Ga0070708_1003824491 239
113 3300005456 Ga0070678_100091429 Ga0070678_1000914292 239
114 3300005456 Ga0070678_100129144 Ga0070678_1001291442 239
115 3300005457 Ga0070662_100197155 Ga0070662_1001971551 239
116 3300005458 Ga0070681_10002271 Ga0070681_100022711 239
117 3300005458 Ga0070681_10002726 Ga0070681_1000272611 239
118 3300005458 Ga0070681_10072999 Ga0070681_100729993 239
119 3300005458 Ga0070681_10296454 Ga0070681_102964541 239
120 3300005459 Ga0068867_100160534 Ga0068867_1001605342 239
121 3300005467 Ga0070706_100184423 Ga0070706_1001844231 239
122 3300005468 Ga0070707_100005527 Ga0070707_1000055277 239
123 3300005468 Ga0070707_100051334 Ga0070707_1000513344 239
124 3300005468 Ga0070707_100176381 Ga0070707_1001763811 239
125 3300005468 Ga0070707_100439318 Ga0070707_1004393182 239
126 3300005471 Ga0070698_100000151 Ga0070698_1000001519 239
127 3300005471 Ga0070698_100240034 Ga0070698_1002400341 239
128 3300005518 Ga0070699_100037674 Ga0070699_1000376742 239
129 3300005518 Ga0070699_100093048 Ga0070699_1000930483 239
130 3300005530 Ga0070679_100002206 Ga0070679_10000220611 239
131 3300005530 Ga0070679_100084504 Ga0070679_1000845043 239
132 3300005530 Ga0070679_100222581 Ga0070679_1002225813 239
133 3300005535 Ga0070684_100004651 Ga0070684_10000465111 239
134 3300005535 Ga0070684_100198306 Ga0070684_1001983062 239
135 3300005539 Ga0068853_100002617 Ga0068853_1000026179 239
136 3300005543 Ga0070672_100054452 Ga0070672_1000544522 239
137 3300005543 Ga0070672_100215012 Ga0070672_1002150122 239
138 3300005544 Ga0070686_100148778 Ga0070686_1001487781 239
139 3300005548 Ga0070665_100534221 Ga0070665_1005342212 239
140 3300005548 Ga0070665_100966612 Ga0070665_1009666121 239
141 3300005563 Ga0068855_100006805 Ga0068855_1000068058 239
142 3300005563 Ga0068855_100064976 Ga0068855_1000649763 239
143 3300005564 Ga0070664_100006100 Ga0070664_1000061004 239
144 3300005564 Ga0070664_100081116 Ga0070664_1000811162 239
145 3300005564 Ga0070664_100178422 Ga0070664_1001784222 239
146 3300005564 Ga0070664_100221865 Ga0070664_1002218652 239
147 3300005577 Ga0068857_100082893 Ga0068857_1000828933 239
148 3300005577 Ga0068857_100338064 Ga0068857_1003380642 239
149 3300005577 Ga0068857_100379154 Ga0068857_1003791542 239
150 3300005577 Ga0068857_100786425 Ga0068857_1007864251 239
151 3300005578 Ga0068854_100203316 Ga0068854_1002033162 239
152 3300005614 Ga0068856_100005989 Ga0068856_1000059894 239
153 3300005614 Ga0068856_100092197 Ga0068856_1000921972 239
154 3300005614 Ga0068856_100121296 Ga0068856_1001212962 239
155 3300005614 Ga0068856_100145805 Ga0068856_1001458053 239
156 3300005614 Ga0068856_100245538 Ga0068856_1002455382 239
157 3300005616 Ga0068852_100002176 Ga0068852_10000217612 239
158 3300005616 Ga0068852_100226473 Ga0068852_1002264732 239
159 3300005617 Ga0068859_100060184 Ga0068859_1000601845 239
160 3300005719 Ga0068861_100096125 Ga0068861_1000961252 239
161 3300005842 Ga0068858_100265659 Ga0068858_1002656592 239
162 3300005843 Ga0068860_100091970 Ga0068860_1000919702 239
163 3300005843 Ga0068860_100123087 Ga0068860_1001230872 239
164 3300005844 Ga0068862_100248007 Ga0068862_1002480072 239
165 3300005844 Ga0068862_100255562 Ga0068862_1002555622 239
166 3300005844 Ga0068862_100298786 Ga0068862_1002987862 239
167 3300005937 Ga0081455_10000058 Ga0081455_1000005879 239
168 3300005937 Ga0081455_10014280 Ga0081455_100142806 239
169 3300005937 Ga0081455_10014867 Ga0081455_100148678 239
170 3300005937 Ga0081455_10040186 Ga0081455_100401862 239
171 3300005983 Ga0081540_1000040 Ga0081540_100004022 239
172 3300005983 Ga0081540_1016800 Ga0081540_10168003 239
173 3300005985 Ga0081539_10000118 Ga0081539_1000011831 239
174 3300005985 Ga0081539_10003667 Ga0081539_100036679 239
175 3300005985 Ga0081539_10106698 Ga0081539_101066981 239
176 3300006028 Ga0070717_10078984 Ga0070717_100789841 239
177 3300006028 Ga0070717_10174947 Ga0070717_101749472 239
178 3300006028 Ga0070717_10293321 Ga0070717_102933212 239
179 3300006028 Ga0070717_10359992 Ga0070717_103599921 239
180 3300006038 Ga0075365_10002405 Ga0075365_100024052 239
181 3300006038 Ga0075365_10128891 Ga0075365_101288912 239
182 3300006038 Ga0075365_10129417 Ga0075365_101294172 239
183 3300006038 Ga0075365_10389289 Ga0075365_103892892 239
184 3300006042 Ga0075368_10003668 Ga0075368_100036683 239
185 3300006042 Ga0075368_10021831 Ga0075368_100218313 239
186 3300006042 Ga0075368_10087405 Ga0075368_100874052 239
187 3300006048 Ga0075363_100027715 Ga0075363_1000277152 239
188 3300006051 Ga0075364_10010124 Ga0075364_100101243 239
189 3300006058 Ga0075432_10102773 Ga0075432_101027732 239
190 3300006163 Ga0070715_10026516 Ga0070715_100265162 239
191 3300006175 Ga0070712_100070508 Ga0070712_1000705082 239
192 3300006175 Ga0070712_100105208 Ga0070712_1001052082 239
193 3300006175 Ga0070712_100139468 Ga0070712_1001394682 239
194 3300006175 Ga0070712_100215231 Ga0070712_1002152311 239
195 3300006177 Ga0075362_10082341 Ga0075362_100823412 239
196 3300006178 Ga0075367_10083007 Ga0075367_100830072 239
197 3300006186 Ga0075369_10001810 Ga0075369_1000181010 239
198 3300006844 Ga0075428_100026575 Ga0075428_1000265752 239
199 3300006844 Ga0075428_100112351 Ga0075428_1001123511 239
200 3300006844 Ga0075428_100145913 Ga0075428_1001459132 239
201 3300006844 Ga0075428_100450658 Ga0075428_1004506582 239
202 3300006844 Ga0075428_100579662 Ga0075428_1005796621 239
203 3300006846 Ga0075430_100059928 Ga0075430_1000599282 239
204 3300006846 Ga0075430_100147098 Ga0075430_1001470982 239
205 3300006846 Ga0075430_100236636 Ga0075430_1002366361 239
206 3300006846 Ga0075430_100339119 Ga0075430_1003391192 239
207 3300006846 Ga0075430_100544122 Ga0075430_1005441221 239
208 3300006847 Ga0075431_100003740 Ga0075431_10000374011 239
209 3300006847 Ga0075431_100007662 Ga0075431_1000076626 239
210 3300006847 Ga0075431_100035511 Ga0075431_1000355112 239
211 3300006847 Ga0075431_100035737 Ga0075431_1000357373 239
212 3300006847 Ga0075431_100048763 Ga0075431_1000487635 239
213 3300006847 Ga0075431_100110767 Ga0075431_1001107673 239
214 3300006852 Ga0075433_10002457 Ga0075433_1000245715 239
215 3300006852 Ga0075433_10040255 Ga0075433_100402553 239
216 3300006852 Ga0075433_10100652 Ga0075433_101006521 239
217 3300006871 Ga0075434_100001552 Ga0075434_1000015522 239
218 3300006880 Ga0075429_100238900 Ga0075429_1002389003 239
219 3300006880 Ga0075429_100353646 Ga0075429_1003536462 239
220 3300006914 Ga0075436_100085191 Ga0075436_1000851912 239
221 3300006931 Ga0097620_100060186 Ga0097620_1000601863 239
222 3300006931 Ga0097620_100885767 Ga0097620_1008857671 239
223 3300007076 Ga0075435_100005800 Ga0075435_1000058002 239
224 3300007076 Ga0075435_100026923 Ga0075435_1000269233 239
225 3300007076 Ga0075435_100158186 Ga0075435_1001581862 239
226 3300007788 Ga0099795_10151714 Ga0099795_101517141 239
227 3300009093 Ga0105240_10002630 Ga0105240_1000263025 239
228 3300009093 Ga0105240_10019378 Ga0105240_100193788 239
229 3300009093 Ga0105240_10176907 Ga0105240_101769072 239
230 3300009093 Ga0105240_10318233 Ga0105240_103182332 239
231 3300009093 Ga0105240_10514520 Ga0105240_105145202 239
232 3300009093 Ga0105240_11070846 Ga0105240_110708462 239
233 3300009094 Ga0111539_10003980 Ga0111539_1000398012 239
234 3300009094 Ga0111539_10008813 Ga0111539_100088136 239
235 3300009094 Ga0111539_10036498 Ga0111539_100364982 239
236 3300009094 Ga0111539_10175139 Ga0111539_101751394 239
237 3300009094 Ga0111539_10191067 Ga0111539_101910672 239
238 3300009098 Ga0105245_10512308 Ga0105245_105123082 239
239 3300009098 Ga0105245_10730848 Ga0105245_107308481 239
240 3300009147 Ga0114129_10390679 Ga0114129_103906792 239
241 3300009147 Ga0114129_11641492 Ga0114129_116414921 239
242 3300009148 Ga0105243_10244828 Ga0105243_102448282 239
243 3300009148 Ga0105243_10700195 Ga0105243_107001952 239
244 3300009174 Ga0105241_10046486 Ga0105241_100464863 239
245 3300009174 Ga0105241_10702071 Ga0105241_107020711 239
246 3300009177 Ga0105248_10036725 Ga0105248_100367253 239
247 3300009177 Ga0105248_10273665 Ga0105248_102736651 239
248 3300009177 Ga0105248_10878700 Ga0105248_108787001 239
249 3300009545 Ga0105237_10149731 Ga0105237_101497312 239
250 3300009545 Ga0105237_10664275 Ga0105237_106642751 239
251 3300009551 Ga0105238_10001395 Ga0105238_100013958 239
252 3300009551 Ga0105238_10131003 Ga0105238_101310032 239
253 3300009551 Ga0105238_10281596 Ga0105238_102815963 239
254 3300009553 Ga0105249_10242527 Ga0105249_102425272 239
255 3300009553 Ga0105249_10562662 Ga0105249_105626621 239
256 3300009553 Ga0105249_10899084 Ga0105249_108990841 239
257 3300010159 Ga0099796_10083298 Ga0099796_100832982 239
258 3300010159 Ga0099796_10178150 Ga0099796_101781501 239
259 3300010375 Ga0105239_10372967 Ga0105239_103729672 239
260 3300013100 Ga0157373_10018195 Ga0157373_100181952 239
261 3300013102 Ga0157371_10020398 Ga0157371_100203985 239
262 3300013102 Ga0157371_10357717 Ga0157371_103577171 239
263 3300013104 Ga0157370_10028222 Ga0157370_100282222 239
264 3300013104 Ga0157370_10110453 Ga0157370_101104533 239
265 3300013104 Ga0157370_10722170 Ga0157370_107221701 239
266 3300013105 Ga0157369_10027627 Ga0157369_100276272 239
267 3300013105 Ga0157369_10579116 Ga0157369_105791161 239
268 3300013296 Ga0157374_10285474 Ga0157374_102854742 239
269 3300013297 Ga0157378_10442262 Ga0157378_104422621 239
270 3300013306 Ga0163162_10023969 Ga0163162_100239692 239
271 3300013307 Ga0157372_10005959 Ga0157372_1000595915 239
272 3300013307 Ga0157372_10106475 Ga0157372_101064752 239
273 3300013308 Ga0157375_10050936 Ga0157375_100509363 239
274 3300014325 Ga0163163_10207612 Ga0163163_102076122 239
275 3300014326 Ga0157380_10099565 Ga0157380_100995655 239
276 3300014326 Ga0157380_10112989 Ga0157380_101129893 239
277 3300014326 Ga0157380_10473160 Ga0157380_104731602 239
278 3300014497 Ga0182008_10015135 Ga0182008_100151353 239
279 3300014969 Ga0157376_10195768 Ga0157376_101957681 239
280 3300014969 Ga0157376_10564736 Ga0157376_105647361 239
281 3300017792 Ga0163161_10230834 Ga0163161_102308341 239
282 3300021358 Ga0213873_10061209 Ga0213873_100612092 239
283 3300021361 Ga0213872_10025640 Ga0213872_100256403 239
284 3300021361 Ga0213872_10062346 Ga0213872_100623462 239
285 3300021361 Ga0213872_10073160 Ga0213872_100731602 239
286 3300021384 Ga0213876_10139037 Ga0213876_101390372 239
287 3300021388 Ga0213875_10000424 Ga0213875_1000042417 239
288 3300021388 Ga0213875_10009829 Ga0213875_100098294 239
289 3300021388 Ga0213875_10099822 Ga0213875_100998221 239
290 3300021388 Ga0213875_10217217 Ga0213875_102172171 239
291 3300025893 Ga0207682_10119475 Ga0207682_101194752 239
292 3300025898 Ga0207692_10044804 Ga0207692_100448042 239
293 3300025903 Ga0207680_10328879 Ga0207680_103288791 239
294 3300025905 Ga0207685_10013744 Ga0207685_100137442 239
295 3300025906 Ga0207699_10058486 Ga0207699_100584862 239
296 3300025906 Ga0207699_10126046 Ga0207699_101260461 239
297 3300025909 Ga0207705_10029840 Ga0207705_100298402 239
298 3300025909 Ga0207705_10190201 Ga0207705_101902012 239
299 3300025909 Ga0207705_10346648 Ga0207705_103466482 239
300 3300025910 Ga0207684_10068225 Ga0207684_100682253 239
301 3300025912 Ga0207707_10041726 Ga0207707_100417262 239
302 3300025912 Ga0207707_10100127 Ga0207707_101001274 239
303 3300025912 Ga0207707_10264987 Ga0207707_102649872 239
304 3300025913 Ga0207695_10197134 Ga0207695_101971343 239
305 3300025913 Ga0207695_10228426 Ga0207695_102284262 239
306 3300025913 Ga0207695_10324475 Ga0207695_103244751 239
307 3300025915 Ga0207693_10021995 Ga0207693_100219952 239
308 3300025915 Ga0207693_10055956 Ga0207693_100559563 239
309 3300025915 Ga0207693_10171102 Ga0207693_101711021 239
310 3300025915 Ga0207693_10192495 Ga0207693_101924951 239
311 3300025915 Ga0207693_10282938 Ga0207693_102829381 239
312 3300025915 Ga0207693_10397448 Ga0207693_103974482 239
313 3300025917 Ga0207660_10355704 Ga0207660_103557042 239
314 3300025919 Ga0207657_10029903 Ga0207657_100299033 239
315 3300025919 Ga0207657_10296615 Ga0207657_102966152 239
316 3300025920 Ga0207649_10003790 Ga0207649_100037908 239
317 3300025920 Ga0207649_10025800 Ga0207649_100258002 239
318 3300025921 Ga0207652_10006133 Ga0207652_1000613312 239
319 3300025921 Ga0207652_10127613 Ga0207652_101276132 239
320 3300025921 Ga0207652_10145332 Ga0207652_101453322 239
321 3300025922 Ga0207646_10008706 Ga0207646_100087066 239
322 3300025922 Ga0207646_10117167 Ga0207646_101171672 239
323 3300025922 Ga0207646_10465218 Ga0207646_104652182 239
324 3300025924 Ga0207694_10071122 Ga0207694_100711222 239
325 3300025924 Ga0207694_10241427 Ga0207694_102414272 239
326 3300025926 Ga0207659_10097934 Ga0207659_100979342 239
327 3300025927 Ga0207687_10088115 Ga0207687_100881152 239
328 3300025928 Ga0207700_10029099 Ga0207700_100290992 239
329 3300025928 Ga0207700_10056886 Ga0207700_100568863 239
330 3300025928 Ga0207700_10214060 Ga0207700_102140602 239
331 3300025928 Ga0207700_10261306 Ga0207700_102613062 239
332 3300025929 Ga0207664_10036468 Ga0207664_100364684 239
333 3300025929 Ga0207664_10130575 Ga0207664_101305753 239
334 3300025929 Ga0207664_10311048 Ga0207664_103110482 239
335 3300025929 Ga0207664_10503124 Ga0207664_105031241 239
336 3300025931 Ga0207644_10367805 Ga0207644_103678052 239
337 3300025931 Ga0207644_10395037 Ga0207644_103950372 239
338 3300025932 Ga0207690_10053769 Ga0207690_100537692 239
339 3300025933 Ga0207706_10019719 Ga0207706_100197195 239
340 3300025933 Ga0207706_10271632 Ga0207706_102716322 239
341 3300025935 Ga0207709_10066020 Ga0207709_100660203 239
342 3300025936 Ga0207670_10179831 Ga0207670_101798312 239
343 3300025939 Ga0207665_10050650 Ga0207665_100506504 239
344 3300025940 Ga0207691_10005919 Ga0207691_1000591912 239
345 3300025941 Ga0207711_10020650 Ga0207711_100206503 239
346 3300025941 Ga0207711_10276244 Ga0207711_102762441 239
347 3300025944 Ga0207661_10019962 Ga0207661_100199623 239
348 3300025944 Ga0207661_10370031 Ga0207661_103700311 239
349 3300025944 Ga0207661_10717491 Ga0207661_107174911 239
350 3300025945 Ga0207679_10028203 Ga0207679_100282032 239
351 3300025945 Ga0207679_10052364 Ga0207679_100523641 239
352 3300025945 Ga0207679_10248931 Ga0207679_102489312 239
353 3300025945 Ga0207679_10300607 Ga0207679_103006071 239
354 3300025949 Ga0207667_10031492 Ga0207667_100314926 239
355 3300025949 Ga0207667_10234870 Ga0207667_102348702 239
356 3300025949 Ga0207667_10384343 Ga0207667_103843432 239
357 3300025972 Ga0207668_10083105 Ga0207668_100831052 239
358 3300026035 Ga0207703_10254752 Ga0207703_102547522 239
359 3300026041 Ga0207639_10003687 Ga0207639_100036872 239
360 3300026067 Ga0207678_10154512 Ga0207678_101545122 239
361 3300026067 Ga0207678_10642033 Ga0207678_106420331 239
362 3300026075 Ga0207708_10008880 Ga0207708_100088804 239
363 3300026075 Ga0207708_10366322 Ga0207708_103663222 239
364 3300026075 Ga0207708_10406907 Ga0207708_104069071 239
365 3300026078 Ga0207702_10014050 Ga0207702_100140503 239
366 3300026078 Ga0207702_10049619 Ga0207702_100496192 239
367 3300026078 Ga0207702_10057572 Ga0207702_100575723 239
368 3300026078 Ga0207702_10155645 Ga0207702_101556452 239
369 3300026088 Ga0207641_10038460 Ga0207641_100384604 239
370 3300026089 Ga0207648_10165786 Ga0207648_101657862 239
371 3300026089 Ga0207648_10218927 Ga0207648_102189271 239
372 3300026089 Ga0207648_10607214 Ga0207648_106072141 239
373 3300026095 Ga0207676_10645730 Ga0207676_106457301 239
374 3300026095 Ga0207676_10791329 Ga0207676_107913291 239
375 3300026116 Ga0207674_10000005 Ga0207674_10000005106 239
376 3300026116 Ga0207674_10012502 Ga0207674_100125022 239
377 3300026116 Ga0207674_10084065 Ga0207674_100840652 239
378 3300026116 Ga0207674_10108400 Ga0207674_101084002 239
379 3300026116 Ga0207674_10789946 Ga0207674_107899461 239
380 3300026118 Ga0207675_100033679 Ga0207675_1000336795 239
381 3300026118 Ga0207675_100082428 Ga0207675_1000824282 239
382 3300026121 Ga0207683_10305156 Ga0207683_103051562 239
383 3300026142 Ga0207698_10076754 Ga0207698_100767543 239
384 3300026142 Ga0207698_10336881 Ga0207698_103368812 239
385 3300027866 Ga0209813_10001131 Ga0209813_100011314 239
386 3300027907 Ga0207428_10023160 Ga0207428_100231602 239
387 3300027907 Ga0207428_10109523 Ga0207428_101095232 239
388 3300027907 Ga0207428_10183983 Ga0207428_101839832 239
389 3300027907 Ga0207428_10477781 Ga0207428_104777811 239
390 3300028380 Ga0268265_10191522 Ga0268265_101915223 239
391 3300028380 Ga0268265_10515605 Ga0268265_105156051 239
392 3300028380 Ga0268265_10606819 Ga0268265_106068191 239
393 3300028381 Ga0268264_10217565 Ga0268264_102175652 239
394 3300028800 Ga0265338_10110649 Ga0265338_101106493 239
395 3300031249 Ga0265339_10000047 Ga0265339_1000004732 239
396 3300031344 Ga0265316_10308211 Ga0265316_103082111 239
397 3300031548 Ga0307408_100335510 Ga0307408_1003355101 239
398 3300031595 Ga0265313_10000069 Ga0265313_1000006917 239
399 3300031595 Ga0265313_10121941 Ga0265313_101219411 239
400 3300031727 Ga0316576_10109279 Ga0316576_101092791 239
401 3300031901 Ga0307406_10370964 Ga0307406_103709642 239
402 3300032002 Ga0307416_100241314 Ga0307416_1002413142 239
403 3300034818 Ga0373950_0010782 Ga0373950_0010782_60_884 239
404 3300035083 Ga0373926_0073934 Ga0373926_0073934_22_762 239
405 3300035086 Ga0373934_0093214 Ga0373934_0093214_375_1103 239
406 3300035088 Ga0373940_0004606 Ga0373940_0004606_2147_2872 239
407 3300035088 Ga0373940_0010882 Ga0373940_0010882_1096_1917 239
408 3300035088 Ga0373940_0106758 Ga0373940_0106758_84_809 239
409 3300035111 Ga0373923_0044031 Ga0373923_0044031_522_1250 239
410 3300035111 Ga0373923_0071502 Ga0373923_0071502_458_1192 239
411 3300035113 Ga0373936_0092067 Ga0373936_0092067_105_833 239
412 3300035114 Ga0373939_0002275 Ga0373939_0002275_1121_1945 239
413 3300035114 Ga0373939_0012130 Ga0373939_0012130_379_1200 239
414 3300035115 Ga0373941_0013366 Ga0373941_0013366_806_1630 239
415 3300035117 Ga0373953_0007043 Ga0373953_0007043_1629_2357 239
416 3300035117 Ga0373953_0053349 Ga0373953_0053349_517_1257 239
417 3300035118 Ga0373954_0053704 Ga0373954_0053704_498_1226 239
418 3300035119 Ga0373956_0183323 Ga0373956_0183323_128_856 239
419 3300035120 Ga0373957_0043487 Ga0373957_0043487_402_1130 239
420 3300035120 Ga0373957_0066338 Ga0373957_0066338_476_1204 239
421 3300035171 Ga0373946_0077574 Ga0373946_0077574_369_1109 239
422 3300035171 Ga0373946_0089460 Ga0373946_0089460_542_1276 239
423 3300035172 Ga0373955_0013905 Ga0373955_0013905_2414_3142 239
424 3300035172 Ga0373955_0037958 Ga0373955_0037958_673_1401 239
425 3300035207 Ga0373942_0016762 Ga0373942_0016762_856_1680 239
426 3300035207 Ga0373942_0081450 Ga0373942_0081450_143_883 239
427 3300035241 Ga0373961_0010010 Ga0373961_0010010_1144_1968 239
428 3300035242 Ga0373962_0014124 Ga0373962_0014124_818_1642 239
429 3300035398 Ga0316574_0250935 Ga0316574_0250935_95_820 239
430 3300035410 Ga0373924_0044852 Ga0373924_0044852_478_1206 239
431 3300035410 Ga0373924_0113203 Ga0373924_0113203_49_777 239
432 3300035691 Ga0373931_0007066 Ga0373931_0007066_4079_4900 239
433 3300035691 Ga0373931_0013645 Ga0373931_0013645_360_1184 239
434 3300035691 Ga0373931_0050747 Ga0373931_0050747_1096_1821 239
435 3300035691 Ga0373931_0183971 Ga0373931_0183971_248_988 239
436 3300035692 Ga0373935_0033555 Ga0373935_0033555_163_891 239
437 3300035692 Ga0373935_0073612 Ga0373935_0073612_1333_2061 239
438 3300035692 Ga0373935_0082099 Ga0373935_0082099_1027_1767 239
439 3300035692 Ga0373935_0285236 Ga0373935_0285236_332_1072 239
440 3300035695 Ga0373927_0044150 Ga0373927_0044150_52_792 239
441 3300035695 Ga0373927_0071306 Ga0373927_0071306_1409_2134 239
442 3300035695 Ga0373927_0163066 Ga0373927_0163066_672_1403 239
443 3300035695 Ga0373927_0191689 Ga0373927_0191689_584_1324 239
444 3300035695 Ga0373927_0310970 Ga0373927_0310970_42_782 239
445 3300035724 Ga0373933_0004861 Ga0373933_0004861_244_972 239
446 3300035724 Ga0373933_0011796 Ga0373933_0011796_200_928 239
447 3300035724 Ga0373933_0016852 Ga0373933_0016852_1454_2179 239
448 3300035724 Ga0373933_0097211 Ga0373933_0097211_483_1211 239
449 3300035724 Ga0373933_0162416 Ga0373933_0162416_462_1187 239
450 3300035725 Ga0373947_0016322 Ga0373947_0016322_435_1163 239
451 3300035725 Ga0373947_0197397 Ga0373947_0197397_400_1140 239
452 3300035725 Ga0373947_0284726 Ga0373947_0284726_109_849 239
453 3300035725 Ga0373947_0378709 Ga0373947_0378709_199_933 239
454 3300036401 Ga0373937_0000761 Ga0373937_0000761_20300_21028 239
455 3300036401 Ga0373937_0136329 Ga0373937_0136329_1259_1984 239
456 3300036401 Ga0373937_0374780 Ga0373937_0374780_306_1034 239
457 3300036712 Ga0316584_0147376 Ga0316584_0147376_324_1049 239
458 3300037068 Ga0373925_0037185 Ga0373925_0037185_1589_2317 239
459 3300037068 Ga0373925_0050679 Ga0373925_0050679_865_1593 239
460 3300037068 Ga0373925_0533388 Ga0373925_0533388_162_893 239
461 3300037068 Ga0373925_0685459 Ga0373925_0685459_54_782 239
462 3300037312 Ga0395899_0024032 Ga0395899_0024032_3578_4303 239
463 3300037312 Ga0395899_0069251 Ga0395899_0069251_499_1224 239
464 3300037312 Ga0395899_0088176 Ga0395899_0088176_469_1200 239
465 3300037418 Ga0395900_0021639 Ga0395900_0021639_4249_4974 239
466 3300037418 Ga0395900_0077801 Ga0395900_0077801_1305_2030 239
467 3300037418 Ga0395900_0168974 Ga0395900_0168974_17_748 239
468 3300037466 Ga0395898_0022898 Ga0395898_0022898_4251_4976 239
469 3300037471 Ga0395905_0603119 Ga0395905_0603119_55_786 239
470 3300037853 Ga0436364_0108726 Ga0436364_0108726_456_1196 239
471 3300037853 Ga0436364_0286343 Ga0436364_0286343_401_1129 239
472 3300037853 Ga0436364_0663275 Ga0436364_0663275_50070_50810 239
473 3300037853 Ga0436364_0668296 Ga0436364_0668296_27955_28683 239
474 3300037853 Ga0436364_1070480 Ga0436364_1070480_304_1044 239
475 3300037853 Ga0436364_1100698 Ga0436364_1100698_1737_2471 239
476 3300037853 Ga0436364_1147233 Ga0436364_1147233_61_789 239
477 3300037853 Ga0436364_1324861 Ga0436364_1324861_473_1207 239
478 3300037853 Ga0436364_1427712 Ga0436364_1427712_166_897 239
479 3300037853 Ga0436364_1502786 Ga0436364_1502786_1537_2262 239
480 3300038443 Ga0395901_0004105 Ga0395901_0004105_1671_2402 239
481 3300038443 Ga0395901_0027696 Ga0395901_0027696_1109_1834 239
482 3300039437 Ga0436365_0585284 Ga0436365_0585284_310_1041 239
483 3300039437 Ga0436365_0750241 Ga0436365_0750241_1776_2516 239
484 3300039437 Ga0436365_0758860 Ga0436365_0758860_831_1571 239
485 3300039437 Ga0436365_0941153 Ga0436365_0941153_1065_1805 239
486 3300039437 Ga0436365_1479190 Ga0436365_1479190_381_1121 239
487 3300039438 Ga0436360_0427988 Ga0436360_0427988_802_1626 239
488 3300039438 Ga0436360_0923341 Ga0436360_0923341_2159_2884 239
489 3300039438 Ga0436360_1116770 Ga0436360_1116770_211_942 239
490 3300039438 Ga0436360_1203512 Ga0436360_1203512_97_837 239
491 3300039438 Ga0436360_1369054 Ga0436360_1369054_1736_2461 239
492 3300039447 Ga0436361_0537570 Ga0436361_0537570_431_1156 239
493 3300039447 Ga0436361_0661457 Ga0436361_0661457_2037_2768 239
494 3300039447 Ga0436361_0819334 Ga0436361_0819334_732_1457 239
495 3300039447 Ga0436361_0895546 Ga0436361_0895546_871_1596 239
496 3300039450 Ga0436363_0630022 Ga0436363_0630022_332_1072 239
497 3300039450 Ga0436363_1370045 Ga0436363_1370045_221_955 239
498 3300039453 Ga0436362_0018763 Ga0436362_0018763_249_989 239
499 3300039453 Ga0436362_0821186 Ga0436362_0821186_1217_1945 239
500 3300039453 Ga0436362_0905187 Ga0436362_0905187_135_866 239
501 3300041486 Ga0451807_1379513 Ga0451807_1379513_223_957 239
502 3300044694 Ga0466963_0034271 Ga0466963_0034271_343_1062 239
503 3300044694 Ga0466963_0063652 Ga0466963_0063652_176_907 239
504 3300044694 Ga0466963_0139486 Ga0466963_0139486_101_826 239
505 3300044712 Ga0453684_0221968 Ga0453684_0221968_29_757 239
506 3300044842 Ga0466957_0029268 Ga0466957_0029268_1298_2029 239
507 3300044901 Ga0466960_0159009 Ga0466960_0159009_476_1201 239
508 3300045836 Ga0466958_0278385 Ga0466958_0278385_329_1048 239
509 3300045976 Ga0466967_0017620 Ga0466967_0017620_870_1601 239
510 3300045976 Ga0466967_0047199 Ga0466967_0047199_2700_3425 239
511 3300045976 Ga0466967_0434529 Ga0466967_0434529_352_1080 239
512 3300045976 Ga0466967_0541993 Ga0466967_0541993_95_820 239
513 3300045976 Ga0466967_0820418 Ga0466967_0820418_46_780 239
514 3300046454 Ga0495592_0207647 Ga0495592_0207647_394_1122 239
515 3300046454 Ga0495592_0296424 Ga0495592_0296424_49_789 239
516 3300046454 Ga0495592_0457795 Ga0495592_0457795_28_756 239
517 3300046455 Ga0495603_0060560 Ga0495603_0060560_188_913 239
518 3300046459 Ga0495629_0009132 Ga0495629_0009132_3529_4269 239
519 3300046459 Ga0495629_0050778 Ga0495629_0050778_11_745 239
520 3300046459 Ga0495629_0324725 Ga0495629_0324725_300_1025 239
521 3300046462 Ga0495651_0001110 Ga0495651_0001110_93_833 239
522 3300046462 Ga0495651_0035681 Ga0495651_0035681_778_1506 239
523 3300046462 Ga0495651_0210964 Ga0495651_0210964_82_816 239
524 3300046463 Ga0495653_0015948 Ga0495653_0015948_4891_5619 239
525 3300046472 Ga0495580_0033025 Ga0495580_0033025_1528_2268 239
526 3300046472 Ga0495580_0331218 Ga0495580_0331218_139_954 239
527 3300046473 Ga0495582_0201455 Ga0495582_0201455_94_828 239
528 3300046477 Ga0495664_0003048 Ga0495664_0003048_3231_3959 239
529 3300046477 Ga0495664_0203852 Ga0495664_0203852_63_803 239
530 3300046477 Ga0495664_0451982 Ga0495664_0451982_10_738 239
531 3300046499 Ga0495594_0091952 Ga0495594_0091952_696_1436 239
532 3300046511 Ga0495608_0002474 Ga0495608_0002474_30_758 239
533 3300046511 Ga0495608_0003631 Ga0495608_0003631_989_1729 239
534 3300046511 Ga0495608_0010040 Ga0495608_0010040_2234_2962 239
535 3300046511 Ga0495608_0346536 Ga0495608_0346536_39_773 239
536 3300046514 Ga0495618_0004450 Ga0495618_0004450_611_1351 239
537 3300046514 Ga0495618_0243946 Ga0495618_0243946_378_1106 239
538 3300046516 Ga0495628_0026011 Ga0495628_0026011_3971_4711 239
539 3300046516 Ga0495628_0162703 Ga0495628_0162703_474_1208 239
540 3300046517 Ga0495630_0188579 Ga0495630_0188579_704_1438 239
541 3300046528 Ga0495642_0092971 Ga0495642_0092971_10_825 239
542 3300046529 Ga0495652_0008869 Ga0495652_0008869_732_1472 239
543 3300046533 Ga0495640_0013010 Ga0495640_0013010_131_859 239
544 3300046533 Ga0495640_0013014 Ga0495640_0013014_1598_2338 239
545 3300046533 Ga0495640_0089210 Ga0495640_0089210_713_1441 239
546 3300046533 Ga0495640_0095657 Ga0495640_0095657_341_1075 239
547 3300046533 Ga0495640_0302616 Ga0495640_0302616_67_795 239
548 3300046536 Ga0495587_0003059 Ga0495587_0003059_280_1020 239
549 3300046536 Ga0495587_0003972 Ga0495587_0003972_5461_6189 239
550 3300046536 Ga0495587_0126345 Ga0495587_0126345_131_859 239
551 3300046543 Ga0495645_0026353 Ga0495645_0026353_995_1723 239
552 3300046543 Ga0495645_0130339 Ga0495645_0130339_775_1515 239
553 3300046543 Ga0495645_0197727 Ga0495645_0197727_412_1146 239
554 3300046543 Ga0495645_0327354 Ga0495645_0327354_105_833 239
555 3300046559 Ga0495667_0002458 Ga0495667_0002458_9672_10412 239
556 3300046559 Ga0495667_0217275 Ga0495667_0217275_92_826 239
557 3300046642 Ga0495634_0021446 Ga0495634_0021446_3348_4088 239
558 3300046642 Ga0495634_0315460 Ga0495634_0315460_124_858 239
559 3300046663 Ga0495635_0134069 Ga0495635_0134069_907_1632 239
560 3300046663 Ga0495635_0263073 Ga0495635_0263073_163_897 239
561 3300046678 Ga0495599_0006436 Ga0495599_0006436_377_1105 239
562 3300046678 Ga0495599_0194900 Ga0495599_0194900_97_837 239
563 3300046679 Ga0495623_0054108 Ga0495623_0054108_211_945 239
564 3300046679 Ga0495623_0056199 Ga0495623_0056199_1424_2152 239
565 3300046680 Ga0495646_0024219 Ga0495646_0024219_94_834 239
566 3300046680 Ga0495646_0092056 Ga0495646_0092056_56_784 239
567 3300046683 Ga0495658_0044840 Ga0495658_0044840_284_1024 239
568 3300046683 Ga0495658_0364690 Ga0495658_0364690_70_879 239
569 3300046684 Ga0495669_0003664 Ga0495669_0003664_3414_4229 239
570 3300046689 Ga0495613_0160950 Ga0495613_0160950_695_1423 239
571 3300046689 Ga0495613_0243124 Ga0495613_0243124_139_867 239
572 3300046689 Ga0495613_0326434 Ga0495613_0326434_63_797 239
573 3300046691 Ga0495670_0149208 Ga0495670_0149208_301_1116 239
574 3300046809 Ga0495600_0001916 Ga0495600_0001916_6962_7702 239
575 3300046809 Ga0495600_0033817 Ga0495600_0033817_709_1437 239
576 3300046809 Ga0495600_0213057 Ga0495600_0213057_163_897 239
577 3300047315 Ga0495581_0114871 Ga0495581_0114871_622_1350 239
578 3300047315 Ga0495581_0430511 Ga0495581_0430511_27_752 239
579 3300047317 Ga0495604_0016624 Ga0495604_0016624_820_1548 239
580 3300047317 Ga0495604_0237929 Ga0495604_0237929_196_930 239
581 3300047318 Ga0495636_0223409 Ga0495636_0223409_29_754 239
582 3300047319 Ga0495674_0002245 Ga0495674_0002245_8285_9025 239
583 3300047321 Ga0495676_0373977 Ga0495676_0373977_183_908 239
584 3300047322 Ga0495680_0001116 Ga0495680_0001116_9297_10037 239
585 3300047322 Ga0495680_0109017 Ga0495680_0109017_837_1565 239
586 3300047444 Ga0495675_0008949 Ga0495675_0008949_3491_4219 239
587 3300047444 Ga0495675_0009772 Ga0495675_0009772_1715_2455 239
588 3300047471 Ga0495684_0080283 Ga0495684_0080283_208_948 239
589 3300047471 Ga0495684_0215571 Ga0495684_0215571_581_1306 239
590 3300048088 Ga0495602_0000398 Ga0495602_0000398_12526_13254 239
591 3300048088 Ga0495602_0003277 Ga0495602_0003277_15565_16305 239
592 3300048088 Ga0495602_0083357 Ga0495602_0083357_352_1077 239
593 3300048903 Ga0496100_0189029 Ga0496100_0189029_64_789 239
594 3300048903 Ga0496100_0317406 Ga0496100_0317406_48_788 239
595 3300048905 Ga0496102_0130395 Ga0496102_0130395_510_1379 239
596 3300048907 Ga0496104_0000182 Ga0496104_0000182_52809_53534 239
597 3300048907 Ga0496104_0157687 Ga0496104_0157687_1384_2112 239
598 3300048907 Ga0496104_0256037 Ga0496104_0256037_716_1585 239
599 3300048908 Ga0496105_0018209 Ga0496105_0018209_4663_5388 239
600 3300048909 Ga0496106_0042250 Ga0496106_0042250_1471_2340 239
601 3300048911 Ga0496108_0014116 Ga0496108_0014116_2919_3644 239
602 3300048912 Ga0496109_0004093 Ga0496109_0004093_3811_4536 239
603 3300048912 Ga0496109_0084299 Ga0496109_0084299_1177_2046 239
604 3300048912 Ga0496109_0311928 Ga0496109_0311928_530_1339 239
605 3300048913 Ga0496110_0009439 Ga0496110_0009439_6932_7657 239
606 3300048914 Ga0496111_0006863 Ga0496111_0006863_5456_6181 239
607 3300048914 Ga0496111_0069536 Ga0496111_0069536_1190_1999 239
608 3300048915 Ga0496112_0045592 Ga0496112_0045592_787_1512 239
609 3300048915 Ga0496112_0142143 Ga0496112_0142143_1396_2124 239
610 3300048915 Ga0496112_0231401 Ga0496112_0231401_83_952 239
611 3300048916 Ga0496113_0008368 Ga0496113_0008368_1439_2164 239
612 3300048916 Ga0496113_0770174 Ga0496113_0770174_20_745 239
613 3300048918 Ga0496115_0368809 Ga0496115_0368809_92_820 239
614 3300048922 Ga0496119_0021644 Ga0496119_0021644_1935_2663 239
615 3300048923 Ga0496120_0010331 Ga0496120_0010331_2173_2901 239
616 3300048929 Ga0496126_0019977 Ga0496126_0019977_1936_2661 239
617 3300049571 Ga0501034_0015519 Ga0501034_0015519_3392_4123 239
618 3300049572 Ga0501036_0585873 Ga0501036_0585873_129_854 239
619 3300049573 Ga0501037_0543421 Ga0501037_0543421_25_756 239
620 3300049575 Ga0501039_0507502 Ga0501039_0507502_178_903 239
621 3300049576 Ga0501040_0014149 Ga0501040_0014149_3590_4315 239
622 3300049580 Ga0501046_0331248 Ga0501046_0331248_354_1079 239
623 3300049581 Ga0501047_0049032 Ga0501047_0049032_1413_2177 239
624 3300049582 Ga0501048_0254716 Ga0501048_0254716_462_1190 239
625 3300049586 Ga0501070_0001514 Ga0501070_0001514_15728_16492 239
626 3300049588 Ga0501072_0015465 Ga0501072_0015465_4677_5402 239
627 3300049588 Ga0501072_0043292 Ga0501072_0043292_1216_1980 239
628 3300049588 Ga0501072_0055740 Ga0501072_0055740_1599_2324 239
629 3300049588 Ga0501072_0368856 Ga0501072_0368856_358_1083 239
630 3300049589 Ga0501073_0109984 Ga0501073_0109984_839_1564 239
631 3300049590 Ga0501074_0024883 Ga0501074_0024883_2434_3159 239
632 3300049591 Ga0501075_0096213 Ga0501075_0096213_542_1267 239
633 3300049591 Ga0501075_0135227 Ga0501075_0135227_302_1027 239
634 3300049591 Ga0501075_0330944 Ga0501075_0330944_413_1141 239
635 3300049592 Ga0501076_0009242 Ga0501076_0009242_2880_3695 239
636 3300049592 Ga0501076_0502018 Ga0501076_0502018_20_745 239
637 3300049593 Ga0501077_0046065 Ga0501077_0046065_1254_1979 239
638 3300049593 Ga0501077_0262511 Ga0501077_0262511_75_800 239
639 3300049741 Ga0501079_0006102 Ga0501079_0006102_7397_8122 239
640 3300049741 Ga0501079_0017971 Ga0501079_0017971_3621_4346 239
641 3300049741 Ga0501079_0139779 Ga0501079_0139779_19_828 239
642 3300049741 Ga0501079_0679599 Ga0501079_0679599_48_773 239
643 3300049742 Ga0501080_0109882 Ga0501080_0109882_1243_2007 239
644 3300049742 Ga0501080_0318290 Ga0501080_0318290_451_1176 239
645 3300049742 Ga0501080_0346834 Ga0501080_0346834_84_824 239
646 3300049743 Ga0501081_0016815 Ga0501081_0016815_2271_2996 239
647 3300049743 Ga0501081_0182537 Ga0501081_0182537_572_1297 239
648 3300049822 Ga0501035_0313992 Ga0501035_0313992_531_1262 239
649 3300049823 Ga0501044_0444430 Ga0501044_0444430_22_753 239
650 3300049824 Ga0501045_0249183 Ga0501045_0249183_199_924 239
651 3300050489 nmdc:mga03683_103395_c1 nmdc:mga03683_103395_c1_288_1013 239
652 3300050489 nmdc:mga03683_58390_c1 nmdc:mga03683_58390_c1_724_1449 239
653 3300050490 nmdc:mga03n38_40237_c1 nmdc:mga03n38_40237_c1_139_867 239
654 3300050491 nmdc:mga00v17_49624_c1 nmdc:mga00v17_49624_c1_1392_2201 239
655 3300050492 nmdc:mga0yw44_157233_c1 nmdc:mga0yw44_157233_c1_74_799 239
656 3300050492 nmdc:mga0yw44_2874_c1 nmdc:mga0yw44_2874_c1_1812_2621 239
657 3300050492 nmdc:mga0yw44_85847_c1 nmdc:mga0yw44_85847_c1_780_1505 239
658 3300050492 nmdc:mga0yw44_9815_c1 nmdc:mga0yw44_9815_c1_4039_4764 239
659 3300050494 nmdc:mga06z11_103120_c1 nmdc:mga06z11_103120_c1_804_1529 239
660 3300050494 nmdc:mga06z11_45433_c1 nmdc:mga06z11_45433_c1_659_1384 239
661 3300050494 nmdc:mga06z11_65071_c1 nmdc:mga06z11_65071_c1_635_1363 239
662 3300050494 nmdc:mga06z11_90393_c1 nmdc:mga06z11_90393_c1_325_1131 239
663 3300050495 nmdc:mga04h51_5824_c1 nmdc:mga04h51_5824_c1_1536_2264 239
664 3300050508 nmdc:mga09592_373772_c1 nmdc:mga09592_373772_c1_256_981 239
665 3300050509 nmdc:mga0qj67_21559_c1 nmdc:mga0qj67_21559_c1_3946_4671 239
666 3300050509 nmdc:mga0qj67_229684_c1 nmdc:mga0qj67_229684_c1_460_1185 239
667 3300050509 nmdc:mga0qj67_34476_c1 nmdc:mga0qj67_34476_c1_236_961 239
668 3300050509 nmdc:mga0qj67_382766_c1 nmdc:mga0qj67_382766_c1_207_932 239
669 3300050509 nmdc:mga0qj67_39099_c1 nmdc:mga0qj67_39099_c1_2207_2932 239
670 3300050509 nmdc:mga0qj67_95065_c1 nmdc:mga0qj67_95065_c1_534_1259 239
671 3300050510 nmdc:mga06r32_32644_c1 nmdc:mga06r32_32644_c1_2003_2728 239
672 3300050510 nmdc:mga06r32_33534_c1 nmdc:mga06r32_33534_c1_673_1398 239
673 3300050510 nmdc:mga06r32_3463_c1 nmdc:mga06r32_3463_c1_5650_6375 239
674 3300050510 nmdc:mga06r32_46521_c1 nmdc:mga06r32_46521_c1_11_751 239
675 3300050510 nmdc:mga06r32_47421_c1 nmdc:mga06r32_47421_c1_2312_3037 239
676 3300050510 nmdc:mga06r32_607844_c1 nmdc:mga06r32_607844_c1_115_954 239
677 3300050510 nmdc:mga06r32_93534_c1 nmdc:mga06r32_93534_c1_1063_1836 239
678 3300050511 nmdc:mga08y16_13096_c1 nmdc:mga08y16_13096_c1_638_1363 239
679 3300050511 nmdc:mga08y16_334135_c1 nmdc:mga08y16_334135_c1_158_982 239
680 3300050511 nmdc:mga08y16_70455_c1 nmdc:mga08y16_70455_c1_1487_2326 239
681 3300050511 nmdc:mga08y16_864617_c1 nmdc:mga08y16_864617_c1_21_800 239
682 3300050511 nmdc:mga08y16_87880_c1 nmdc:mga08y16_87880_c1_630_1454 239
683 3300050512 nmdc:mga0n895_207504_c1 nmdc:mga0n895_207504_c1_286_1011 239
684 3300050512 nmdc:mga0n895_896_c1 nmdc:mga0n895_896_c1_8336_9160 239
685 3300050513 nmdc:mga0rr50_455280_c1 nmdc:mga0rr50_455280_c1_119_859 239
686 3300050513 nmdc:mga0rr50_5196_c1 nmdc:mga0rr50_5196_c1_1512_2336 239
687 3300050513 nmdc:mga0rr50_8180_c1 nmdc:mga0rr50_8180_c1_3836_4561 239
688 3300050514 nmdc:mga08x19_15172_c1 nmdc:mga08x19_15172_c1_971_1711 239
689 3300050515 nmdc:mga0a205_206901_c1 nmdc:mga0a205_206901_c1_886_1611 239
690 3300050515 nmdc:mga0a205_2921_c1 nmdc:mga0a205_2921_c1_13634_14458 239
691 3300050516 nmdc:mga0sz30_1852_c2 nmdc:mga0sz30_1852_c2_89_814 239
692 3300050516 nmdc:mga0sz30_498_c1 nmdc:mga0sz30_498_c1_13467_14192 239
693 3300053077 Ga0495601_0000712 Ga0495601_0000712_9943_10671 239
694 3300053077 Ga0495601_0002860 Ga0495601_0002860_4940_5680 239
695 3300053077 Ga0495601_0297200 Ga0495601_0297200_49_777 239
696 3300053078 Ga0495612_0001184 Ga0495612_0001184_1292_2020 239
697 3300053078 Ga0495612_0118627 Ga0495612_0118627_307_1065 239
698 3300053078 Ga0495612_0199031 Ga0495612_0199031_69_809 239
699 3300053084 Ga0495595_0000196 Ga0495595_0000196_4110_4850 239
700 3300053084 Ga0495595_0016485 Ga0495595_0016485_859_1587 239
701 3300053084 Ga0495595_0021033 Ga0495595_0021033_501_1229 239
702 3300053084 Ga0495595_0146977 Ga0495595_0146977_122_856 239
703 3300053085 Ga0495619_0009682 Ga0495619_0009682_4902_5630 239
704 3300053093 Ga0500651_0223322 Ga0500651_0223322_134_862 239
705 3300053142 Ga0500577_0129207 Ga0500577_0129207_290_1015 239
706 3300053153 Ga0500616_0002029 Ga0500616_0002029_582_1307 239
707 3300053155 Ga0500620_010418 Ga0500620_010418_1033_1758 239
708 3300053733 Ga0500552_000491 Ga0500552_000491_16_744 239
709 3300054114 Ga0501084_0071843 Ga0501084_0071843_911_1636 239
710 3300054114 Ga0501084_0104908 Ga0501084_0104908_919_1662 239
711 3300060353 Ga0501082_0042769 Ga0501082_0042769_1972_2697 239
712 3300060353 Ga0501082_0053454 Ga0501082_0053454_1385_2110 239
713 3300060353 Ga0501082_0409096 Ga0501082_0409096_366_1091 239
714 3300060353 Ga0501082_0456676 Ga0501082_0456676_185_904 239
715 3300061734 Ga0530510_0024319 Ga0530510_0024319_908_1633 239
716 3300061734 Ga0530510_0035765 Ga0530510_0035765_368_1177 239
717 3300061734 Ga0530510_0297382 Ga0530510_0297382_37_765 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

68

280

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ml0-assembly1.cif.gz_A crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) s69a mutant from salmonella typhimurium 0.8302 13 229
6mlv-assembly1.cif.gz_A crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) y14a mutant from salmonella typhimurium 0.8221 13 229
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.8133 101 188
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.8101 13 95
5wjp-assembly1.cif.gz_A crystal structure of the cyclohexadienyl dehydratase-like solute-binding protein sar11_1068 from candidatus pelagibacter ubique. 0.8026 6 234
ID Description Score Start End Superfamily
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8896 99 191 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8818 102 186 3.40.190.10
2y7iB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8793 101 191 3.40.190.10
2yjpC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8661 102 191 3.40.190.10
af_P30860_108_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8612 101 184 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2D7SK89-F1-model_v4 ABC transporter substrate-binding protein 0.9505 68 239
AF-A0A2D7SK89-F1-model_v4 ABC transporter substrate-binding protein 0.9348 68 239
AF-A0A2V6TN13-F1-model_v4 Uncharacterized protein 0.9176 90 239
AF-A0A7S3TEX8-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.8752 4 239
AF-A0A2V6TN13-F1-model_v4 Uncharacterized protein 0.869 90 239

Feature Viewer

pLDDT pTM Quality
95.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map