F477121

General Info

Members Datasets Scaffolds Average Seq Length
717 310 1428 324

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0265920|Ga0496102_0265920_485_1555
Length 356
Sequence MSATSRGSFCDSRNDLTETQASPEKYSKGNYMRLAMIGLGRMGGNIARRLMLGNHEIVAFDRDDGAVAELISEGATGADTLEDVVAKLNTPRIFWVMLPAGGPTQETVDRLIELAAPGDIIIDGGNSFYKDDITRAAAAREKQIHYVDVGTSGGVWGLDRGYCMMIGGDKETVDLLDPIFDTLAPGYGTIPRTPGRGTTDDRAERGYIHAGPNGAGHFVKMVHNGIEYGLMQAYAEGFDILKGKASEKLPAEERYDINLPDVAEVWRRGSVISSWLLDLCAIGLARDSMLEQFTGRVADSGEGRWTIDAAMEEAVPAHVLTAALFARYRSRVDTTFGDKLLSAMRFGFGGHVEMPQ

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
290 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
291 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
292 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
296 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
300 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
301 2643221583 Caulobacter sp. Root655 Isolate Unclassified
302 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
303 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
304 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
305 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
306 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
307 2919513703 Luteimonas sp. 3794 Isolate Unclassified
308 2919675420 Luteimonas terrae 4099 Isolate Unclassified
309 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
310 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.14
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 2.37
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0265920 3300048905 Bacteria 1617
2 JGI24740J21852_10005372 3300001979 Bacteria 5427
3 JGI24739J22299_10004790 3300001989 Bacteria 5167
4 JGI24739J22299_10009552 3300001989 Bacteria 3611
5 JGI24739J22299_10049772 3300001989 Bacteria 1357
6 JGI24737J22298_10000687 3300001990 Bacteria 11875
7 JGI24735J21928_10027297 3300002067 Bacteria 1711
8 JGI24738J21930_10002091 3300002075 Bacteria 5342
9 JGI24738J21930_10007677 3300002075 Bacteria 2478
10 JGI25150J39212_1000020 3300002774 Bacteria 134928
11 JGI25151J46595_10055943 3300003187 Bacteria 1297
12 JGI25153J46596_10000017 3300003215 Bacteria 274325
13 rootH2_10075661 3300003320 Bacteria 6877
14 Ga0055536_1011158 3300003781 Bacteria 3484
15 Ga0055530_10016424 3300003791 Bacteria 2365
16 Ga0055540_1005503 3300003792 Bacteria 5300
17 Ga0065165_1000625 3300005262 Bacteria 51321
18 Ga0065714_10109070 3300005288 Bacteria 1505
19 Ga0070658_10008641 3300005327 Bacteria 8186
20 Ga0070658_10038050 3300005327 Bacteria 3880
21 Ga0070658_10040306 3300005327 Bacteria 3767
22 Ga0070658_10222296 3300005327 Bacteria 1597
23 Ga0070658_10246114 3300005327 Bacteria 1516
24 Ga0070658_10318277 3300005327 Bacteria 1328
25 Ga0070676_10004172 3300005328 Bacteria 7587
26 Ga0070683_100025567 3300005329 Bacteria 5304
27 Ga0070683_100218535 3300005329 Bacteria 1811
28 Ga0070690_100091417 3300005330 Bacteria 2005
29 Ga0070670_100016900 3300005331 Bacteria 6263
30 Ga0070670_100025510 3300005331 Bacteria 5085
31 Ga0068869_100003116 3300005334 Bacteria 10111
32 Ga0070666_10062831 3300005335 Bacteria 2517
33 Ga0070680_100000777 3300005336 Bacteria 22371
34 Ga0070680_100001609 3300005336 Bacteria 16497
35 Ga0070680_100008701 3300005336 Bacteria 7780
36 Ga0070680_100255725 3300005336 Bacteria 1481
37 Ga0070680_100310653 3300005336 Bacteria 1337
38 Ga0070682_100035315 3300005337 Bacteria 3051
39 Ga0068868_100011184 3300005338 Bacteria 6534
40 Ga0070660_100003291 3300005339 Bacteria 11105
41 Ga0070660_100004065 3300005339 Bacteria 10092
42 Ga0070660_100017639 3300005339 Bacteria 5205
43 Ga0070660_100029155 3300005339 Bacteria 4133
44 Ga0070660_100047766 3300005339 Bacteria 3285
45 Ga0070660_100160963 3300005339 Bacteria 1809
46 Ga0070660_100186491 3300005339 Bacteria 1679
47 Ga0070660_100266557 3300005339 Bacteria 1399
48 Ga0070660_100310240 3300005339 Bacteria 1294
49 Ga0070660_100362680 3300005339 Bacteria 1194
50 Ga0070691_10008548 3300005341 Bacteria 4688
51 Ga0070691_10123756 3300005341 Bacteria 1304
52 Ga0070661_100001494 3300005344 Bacteria 16268
53 Ga0070661_100040130 3300005344 Bacteria 3413
54 Ga0070661_100061923 3300005344 Bacteria 2747
55 Ga0070661_100108664 3300005344 Bacteria 2070
56 Ga0070661_100169133 3300005344 Bacteria 1659
57 Ga0070661_100182187 3300005344 Bacteria 1598
58 Ga0070692_10041405 3300005345 Bacteria 2360
59 Ga0070668_100043360 3300005347 Bacteria 3450
60 Ga0070669_100000138 3300005353 Bacteria 65433
61 Ga0070669_100041151 3300005353 Bacteria 3360
62 Ga0070675_100021410 3300005354 Bacteria 5167
63 Ga0070671_100021780 3300005355 Bacteria 5235
64 Ga0070671_100027056 3300005355 Bacteria 4718
65 Ga0070671_100104838 3300005355 Bacteria 2373
66 Ga0070671_100232034 3300005355 Bacteria 1566
67 Ga0070674_100033254 3300005356 Bacteria 3431
68 Ga0070673_100002586 3300005364 Bacteria 11053
69 Ga0070673_100004948 3300005364 Bacteria 8490
70 Ga0070659_100001040 3300005366 Bacteria 20295
71 Ga0070659_100003697 3300005366 Bacteria 10913
72 Ga0070659_100007325 3300005366 Bacteria 8015
73 Ga0070659_100015988 3300005366 Bacteria 5628
74 Ga0070659_100027275 3300005366 Bacteria 4400
75 Ga0070659_100065256 3300005366 Bacteria 2883
76 Ga0070659_100075317 3300005366 Bacteria 2690
77 Ga0070659_100112163 3300005366 Bacteria 2202
78 Ga0070667_100047812 3300005367 Bacteria 3600
79 Ga0070667_100227132 3300005367 Bacteria 1663
80 Ga0070709_10202436 3300005434 Bacteria 1407
81 Ga0070694_100020574 3300005444 Bacteria 4209
82 Ga0070663_100048900 3300005455 Bacteria 3001
83 Ga0070663_100109285 3300005455 Bacteria 2076
84 Ga0070663_100276188 3300005455 Bacteria 1337
85 Ga0070663_100398467 3300005455 Bacteria 1124
86 Ga0070662_100001837 3300005457 Bacteria 13006
87 Ga0070662_100001928 3300005457 Bacteria 12750
88 Ga0070662_100080350 3300005457 Bacteria 2427
89 Ga0070681_10006985 3300005458 Bacteria 10988
90 Ga0070681_10093219 3300005458 Bacteria 2960
91 Ga0070681_10113562 3300005458 Bacteria 2648
92 Ga0070681_10315254 3300005458 Bacteria 1473
93 Ga0070681_10332708 3300005458 Bacteria 1428
94 Ga0068867_100010664 3300005459 Bacteria 6482
95 Ga0068867_100016740 3300005459 Bacteria 5209
96 Ga0070698_100063579 3300005471 Bacteria 3721
97 Ga0070679_100004635 3300005530 Bacteria 12688
98 Ga0070679_100075528 3300005530 Bacteria 3359
99 Ga0070679_100077512 3300005530 Bacteria 3313
100 Ga0070679_100320061 3300005530 Bacteria 1500
101 Ga0070679_100330242 3300005530 Bacteria 1473
102 Ga0070679_100419467 3300005530 Bacteria 1284
103 Ga0070679_100479188 3300005530 Bacteria 1188
104 Ga0070684_100027737 3300005535 Bacteria 4783
105 Ga0070684_100124210 3300005535 Bacteria 2324
106 Ga0070684_100345018 3300005535 Bacteria 1369
107 Ga0070697_100000139 3300005536 Bacteria 58838
108 Ga0070697_100018866 3300005536 Bacteria 5443
109 Ga0068853_100004994 3300005539 Bacteria 10339
110 Ga0068853_100027359 3300005539 Bacteria 4791
111 Ga0068853_100027704 3300005539 Bacteria 4762
112 Ga0068853_100033891 3300005539 Bacteria 4333
113 Ga0068853_100113339 3300005539 Bacteria 2411
114 Ga0068853_100116126 3300005539 Bacteria 2383
115 Ga0068853_100134100 3300005539 Bacteria 2219
116 Ga0070672_100000868 3300005543 Bacteria 18094
117 Ga0070693_100284404 3300005547 Bacteria 1109
118 Ga0070665_100000380 3300005548 Bacteria 65676
119 Ga0070665_100138367 3300005548 Bacteria 2438
120 Ga0068855_100001148 3300005563 Bacteria 32786
121 Ga0068855_100008821 3300005563 Bacteria 12188
122 Ga0068855_100010741 3300005563 Bacteria 11051
123 Ga0068855_100394571 3300005563 Bacteria 1517
124 Ga0068855_100395925 3300005563 Bacteria 1514
125 Ga0068855_100709803 3300005563 Bacteria 1075
126 Ga0070664_100002792 3300005564 Bacteria 14105
127 Ga0070664_100004946 3300005564 Bacteria 10677
128 Ga0070664_100006300 3300005564 Bacteria 9572
129 Ga0070664_100043512 3300005564 Bacteria 3789
130 Ga0070664_100057463 3300005564 Bacteria 3307
131 Ga0068857_100007132 3300005577 Bacteria 9625
132 Ga0068857_100021844 3300005577 Bacteria 5631
133 Ga0068857_100041994 3300005577 Bacteria 4055
134 Ga0068857_100107278 3300005577 Bacteria 2508
135 Ga0068857_100135940 3300005577 Bacteria 2219
136 Ga0068857_100189409 3300005577 Bacteria 1873
137 Ga0068857_100313261 3300005577 Bacteria 1448
138 Ga0068854_100005266 3300005578 Bacteria 8161
139 Ga0068854_100014636 3300005578 Bacteria 5176
140 Ga0068854_100072173 3300005578 Bacteria 2527
141 Ga0068854_100072875 3300005578 Bacteria 2516
142 Ga0068854_100240021 3300005578 Bacteria 1443
143 Ga0068856_100009932 3300005614 Bacteria 9245
144 Ga0068856_100047053 3300005614 Bacteria 4249
145 Ga0068856_100057631 3300005614 Bacteria 3835
146 Ga0068856_100347459 3300005614 Bacteria 1502
147 Ga0068856_100618558 3300005614 Bacteria 1104
148 Ga0068852_100000946 3300005616 Bacteria 19100
149 Ga0068852_100005893 3300005616 Bacteria 8811
150 Ga0068852_100018079 3300005616 Bacteria 5546
151 Ga0068852_100102314 3300005616 Bacteria 2588
152 Ga0068852_100112815 3300005616 Bacteria 2474
153 Ga0068852_100125607 3300005616 Bacteria 2355
154 Ga0068852_100225606 3300005616 Bacteria 1784
155 Ga0068852_100505068 3300005616 Bacteria 1204
156 Ga0068859_100000550 3300005617 Bacteria 37222
157 Ga0068859_100006426 3300005617 Bacteria 11926
158 Ga0068859_100073328 3300005617 Bacteria 3461
159 Ga0068859_100155178 3300005617 Bacteria 2366
160 Ga0068864_100003528 3300005618 Bacteria 12934
161 Ga0068864_100005190 3300005618 Bacteria 10669
162 Ga0068851_10012796 3300005834 Bacteria 3963
163 Ga0068851_10014173 3300005834 Bacteria 3782
164 Ga0068863_100004087 3300005841 Bacteria 14417
165 Ga0068863_100009309 3300005841 Bacteria 9584
166 Ga0068863_100048341 3300005841 Bacteria 4034
167 Ga0068863_100226573 3300005841 Bacteria 1802
168 Ga0068858_100002589 3300005842 Bacteria 18214
169 Ga0068858_100004956 3300005842 Bacteria 13043
170 Ga0068858_100023934 3300005842 Bacteria 5690
171 Ga0068858_100025161 3300005842 Bacteria 5539
172 Ga0068858_100235315 3300005842 Bacteria 1737
173 Ga0068860_100004406 3300005843 Bacteria 14383
174 Ga0068860_100006884 3300005843 Bacteria 11399
175 Ga0068860_100284558 3300005843 Bacteria 1616
176 Ga0068862_100006635 3300005844 Bacteria 9599
177 Ga0068862_100021749 3300005844 Bacteria 5364
178 Ga0081538_10018384 3300005981 Bacteria 5251
179 Ga0075368_10087558 3300006042 Bacteria 1272
180 Ga0070712_100185284 3300006175 Bacteria 1625
181 Ga0075366_10026901 3300006195 Bacteria 3372
182 Ga0075366_10067766 3300006195 Bacteria 2124
183 Ga0075366_10180035 3300006195 Bacteria 1284
184 Ga0075370_10000001 3300006353 Bacteria 239876
185 Ga0068871_100405905 3300006358 Bacteria 1214
186 Ga0075428_100131976 3300006844 Bacteria 2716
187 Ga0075431_100288808 3300006847 Bacteria 1660
188 Ga0075433_10010202 3300006852 Bacteria 7533
189 Ga0068865_100005976 3300006881 Bacteria 7418
190 Ga0097620_100000550 3300006931 Bacteria 37222
191 Ga0097620_100006426 3300006931 Bacteria 11926
192 Ga0097620_100073329 3300006931 Bacteria 3461
193 Ga0097620_100155181 3300006931 Bacteria 2366
194 Ga0105240_10010679 3300009093 Bacteria 12886
195 Ga0105240_10015147 3300009093 Bacteria 10494
196 Ga0105240_10018070 3300009093 Bacteria 9481
197 Ga0105240_10065883 3300009093 Bacteria 4495
198 Ga0105240_10085276 3300009093 Bacteria 3870
199 Ga0105240_10150136 3300009093 Bacteria 2776
200 Ga0105245_10000198 3300009098 Bacteria 57372
201 Ga0105245_10063705 3300009098 Bacteria 3330
202 Ga0105247_10018070 3300009101 Bacteria 4229
203 Ga0105243_10010602 3300009148 Bacteria 6996
204 Ga0105243_10298211 3300009148 Bacteria 1460
205 Ga0105241_10027469 3300009174 Bacteria 4239
206 Ga0105241_10284753 3300009174 Bacteria 1413
207 Ga0105248_10000391 3300009177 Bacteria 50565
208 Ga0105248_10031695 3300009177 Bacteria 5906
209 Ga0105237_10243467 3300009545 Bacteria 1800
210 Ga0105238_10007731 3300009551 Bacteria 10750
211 Ga0105238_10014401 3300009551 Bacteria 7994
212 Ga0105238_10052170 3300009551 Bacteria 4112
213 Ga0105239_10053714 3300010375 Bacteria 4419
214 Ga0105239_10477424 3300010375 Bacteria 1416
215 Ga0105239_10732565 3300010375 Bacteria 1131
216 Ga0105246_10073297 3300011119 Bacteria 2417
217 Ga0105246_10368332 3300011119 Bacteria 1183
218 Ga0157373_10010344 3300013100 Bacteria 6869
219 Ga0157373_10031653 3300013100 Bacteria 3807
220 Ga0157373_10076574 3300013100 Bacteria 2360
221 Ga0157373_10081004 3300013100 Bacteria 2289
222 Ga0157373_10142136 3300013100 Bacteria 1688
223 Ga0157371_10002789 3300013102 Bacteria 16391
224 Ga0157371_10002797 3300013102 Bacteria 16362
225 Ga0157371_10293365 3300013102 Bacteria 1176
226 Ga0157370_10006108 3300013104 Bacteria 13365
227 Ga0157370_10025395 3300013104 Bacteria 5864
228 Ga0157370_10032238 3300013104 Bacteria 5118
229 Ga0157370_10069403 3300013104 Bacteria 3329
230 Ga0157370_10097207 3300013104 Bacteria 2762
231 Ga0157370_10130551 3300013104 Bacteria 2343
232 Ga0157370_10204812 3300013104 Bacteria 1830
233 Ga0157370_10284948 3300013104 Bacteria 1526
234 Ga0157370_10295723 3300013104 Bacteria 1495
235 Ga0157370_10349859 3300013104 Bacteria 1362
236 Ga0157369_10002441 3300013105 Bacteria 22331
237 Ga0157369_10007310 3300013105 Bacteria 12712
238 Ga0157369_10085210 3300013105 Bacteria 3377
239 Ga0157369_10098789 3300013105 Bacteria 3112
240 Ga0157369_10102744 3300013105 Bacteria 3045
241 Ga0157369_10290820 3300013105 Bacteria 1701
242 Ga0157369_10504471 3300013105 Bacteria 1252
243 Ga0157374_10086272 3300013296 Bacteria 2986
244 Ga0157378_10001311 3300013297 Bacteria 22380
245 Ga0157378_10437162 3300013297 Bacteria 1296
246 Ga0163162_10064438 3300013306 Bacteria 3710
247 Ga0163162_10072048 3300013306 Bacteria 3509
248 Ga0163162_10122274 3300013306 Bacteria 2708
249 Ga0163162_10511373 3300013306 Bacteria 1331
250 Ga0157372_10003571 3300013307 Bacteria 16739
251 Ga0157372_10012201 3300013307 Bacteria 9153
252 Ga0157372_10244011 3300013307 Bacteria 2084
253 Ga0157375_10026969 3300013308 Bacteria 5363
254 Ga0157375_10100575 3300013308 Bacteria 2972
255 Ga0163163_10003435 3300014325 Bacteria 13462
256 Ga0157377_10022379 3300014745 Bacteria 3336
257 Ga0157379_10006683 3300014968 Bacteria 9959
258 Ga0206353_10434619 3300020082 Bacteria 3038
259 Ga0207425_1000022 3300025245 Bacteria 355305
260 Ga0209129_1000286 3300025258 Bacteria 48191
261 Ga0209233_1013690 3300025261 Bacteria 2311
262 Ga0209676_1009141 3300025292 Bacteria 4313
263 Ga0209025_1001464 3300025294 Bacteria 30863
264 Ga0209758_1000004 3300025297 Bacteria 1375322
265 Ga0209050_1000001 3300025298 Bacteria 3563507
266 Ga0209051_1000246 3300025303 Bacteria 91170
267 Ga0209257_1011642 3300025304 Bacteria 4200
268 Ga0207697_10000297 3300025315 Bacteria 27757
269 Ga0207656_10008833 3300025321 Bacteria 3728
270 Ga0207656_10013262 3300025321 Bacteria 3145
271 Ga0207656_10026133 3300025321 Bacteria 2377
272 Ga0207688_10000214 3300025901 Bacteria 25912
273 Ga0207647_10000450 3300025904 Bacteria 33415
274 Ga0207647_10000550 3300025904 Bacteria 29810
275 Ga0207647_10001333 3300025904 Bacteria 18966
276 Ga0207647_10051388 3300025904 Bacteria 2548
277 Ga0207699_10175992 3300025906 Bacteria 1435
278 Ga0207645_10047073 3300025907 Bacteria 2754
279 Ga0207705_10000647 3300025909 Bacteria 28998
280 Ga0207705_10000733 3300025909 Bacteria 27069
281 Ga0207705_10012679 3300025909 Bacteria 6083
282 Ga0207705_10016400 3300025909 Bacteria 5311
283 Ga0207705_10021334 3300025909 Bacteria 4621
284 Ga0207705_10036186 3300025909 Bacteria 3533
285 Ga0207705_10038781 3300025909 Bacteria 3413
286 Ga0207705_10043296 3300025909 Bacteria 3234
287 Ga0207705_10044634 3300025909 Bacteria 3185
288 Ga0207654_10129313 3300025911 Bacteria 1596
289 Ga0207707_10004869 3300025912 Bacteria 11785
290 Ga0207707_10012471 3300025912 Bacteria 7389
291 Ga0207707_10031408 3300025912 Bacteria 4648
292 Ga0207707_10271783 3300025912 Bacteria 1469
293 Ga0207695_10024131 3300025913 Bacteria 6851
294 Ga0207695_10048907 3300025913 Bacteria 4461
295 Ga0207695_10105071 3300025913 Bacteria 2812
296 Ga0207695_10292239 3300025913 Bacteria 1522
297 Ga0207695_10458431 3300025913 Bacteria 1158
298 Ga0207693_10067961 3300025915 Bacteria 2790
299 Ga0207660_10000720 3300025917 Bacteria 22059
300 Ga0207660_10000753 3300025917 Bacteria 21519
301 Ga0207660_10002930 3300025917 Bacteria 11151
302 Ga0207660_10002951 3300025917 Bacteria 11121
303 Ga0207660_10004462 3300025917 Bacteria 9124
304 Ga0207660_10026504 3300025917 Bacteria 3948
305 Ga0207660_10400218 3300025917 Bacteria 1106
306 Ga0207657_10002019 3300025919 Bacteria 21940
307 Ga0207657_10002443 3300025919 Bacteria 20074
308 Ga0207657_10003486 3300025919 Bacteria 16785
309 Ga0207657_10003530 3300025919 Bacteria 16704
310 Ga0207657_10009031 3300025919 Bacteria 10066
311 Ga0207657_10010446 3300025919 Bacteria 9265
312 Ga0207657_10011217 3300025919 Bacteria 8909
313 Ga0207657_10016702 3300025919 Bacteria 7071
314 Ga0207657_10028287 3300025919 Bacteria 5116
315 Ga0207657_10065052 3300025919 Bacteria 3110
316 Ga0207657_10296054 3300025919 Bacteria 1282
317 Ga0207657_10317974 3300025919 Bacteria 1231
318 Ga0207649_10008370 3300025920 Bacteria 5637
319 Ga0207649_10010422 3300025920 Bacteria 5107
320 Ga0207649_10021475 3300025920 Bacteria 3717
321 Ga0207649_10028353 3300025920 Bacteria 3296
322 Ga0207649_10056575 3300025920 Bacteria 2450
323 Ga0207652_10001317 3300025921 Bacteria 22056
324 Ga0207652_10002779 3300025921 Bacteria 14710
325 Ga0207652_10052952 3300025921 Bacteria 3486
326 Ga0207652_10115640 3300025921 Bacteria 2383
327 Ga0207652_10287960 3300025921 Bacteria 1482
328 Ga0207646_10162553 3300025922 Bacteria 2015
329 Ga0207681_10002797 3300025923 Bacteria 11046
330 Ga0207681_10045621 3300025923 Bacteria 2944
331 Ga0207694_10001010 3300025924 Bacteria 24549
332 Ga0207694_10009321 3300025924 Bacteria 7406
333 Ga0207694_10102113 3300025924 Bacteria 2273
334 Ga0207659_10011048 3300025926 Bacteria 5691
335 Ga0207659_10277564 3300025926 Bacteria 1369
336 Ga0207687_10004719 3300025927 Bacteria 9067
337 Ga0207644_10021354 3300025931 Bacteria 4409
338 Ga0207644_10021704 3300025931 Bacteria 4378
339 Ga0207644_10028811 3300025931 Bacteria 3848
340 Ga0207644_10067500 3300025931 Bacteria 2607
341 Ga0207644_10178978 3300025931 Bacteria 1661
342 Ga0207690_10004314 3300025932 Bacteria 8395
343 Ga0207690_10004900 3300025932 Bacteria 7896
344 Ga0207690_10031546 3300025932 Bacteria 3392
345 Ga0207690_10061653 3300025932 Bacteria 2550
346 Ga0207690_10069839 3300025932 Bacteria 2418
347 Ga0207690_10174621 3300025932 Bacteria 1612
348 Ga0207690_10247107 3300025932 Bacteria 1376
349 Ga0207706_10001953 3300025933 Bacteria 20227
350 Ga0207706_10002890 3300025933 Bacteria 16629
351 Ga0207706_10019463 3300025933 Bacteria 6107
352 Ga0207706_10109711 3300025933 Bacteria 2428
353 Ga0207709_10069381 3300025935 Bacteria 2231
354 Ga0207709_10101297 3300025935 Bacteria 1905
355 Ga0207669_10052976 3300025937 Bacteria 2441
356 Ga0207704_10043071 3300025938 Bacteria 2662
357 Ga0207691_10000047 3300025940 Bacteria 99519
358 Ga0207691_10073755 3300025940 Bacteria 3078
359 Ga0207691_10228695 3300025940 Bacteria 1611
360 Ga0207711_10001028 3300025941 Bacteria 26716
361 Ga0207711_10003195 3300025941 Bacteria 14296
362 Ga0207711_10003281 3300025941 Bacteria 14062
363 Ga0207689_10000002 3300025942 Bacteria 198437
364 Ga0207689_10014038 3300025942 Bacteria 6819
365 Ga0207661_10047494 3300025944 Bacteria 3409
366 Ga0207661_10322527 3300025944 Bacteria 1389
367 Ga0207679_10034440 3300025945 Bacteria 3573
368 Ga0207679_10058928 3300025945 Bacteria 2848
369 Ga0207667_10004932 3300025949 Bacteria 16295
370 Ga0207667_10007513 3300025949 Bacteria 13084
371 Ga0207667_10015484 3300025949 Bacteria 8660
372 Ga0207667_10017570 3300025949 Bacteria 8045
373 Ga0207667_10029561 3300025949 Bacteria 5941
374 Ga0207667_10051008 3300025949 Bacteria 4363
375 Ga0207667_10061822 3300025949 Bacteria 3917
376 Ga0207651_10010367 3300025960 Bacteria 5162
377 Ga0207651_10027820 3300025960 Bacteria 3557
378 Ga0207651_10254231 3300025960 Bacteria 1439
379 Ga0207712_10000969 3300025961 Bacteria 20659
380 Ga0207712_10095457 3300025961 Bacteria 2199
381 Ga0207668_10113779 3300025972 Bacteria 2035
382 Ga0207640_10010650 3300025981 Bacteria 5186
383 Ga0207640_10024071 3300025981 Bacteria 3668
384 Ga0207640_10283999 3300025981 Bacteria 1301
385 Ga0207658_10003561 3300025986 Bacteria 10994
386 Ga0207658_10023648 3300025986 Bacteria 4291
387 Ga0207658_10230416 3300025986 Bacteria 1563
388 Ga0207677_10361972 3300026023 Bacteria 1219
389 Ga0207703_10002189 3300026035 Bacteria 17150
390 Ga0207703_10030569 3300026035 Bacteria 4258
391 Ga0207703_10065739 3300026035 Bacteria 2981
392 Ga0207703_10204788 3300026035 Bacteria 1755
393 Ga0207639_10000181 3300026041 Bacteria 49444
394 Ga0207639_10002813 3300026041 Bacteria 11673
395 Ga0207639_10013429 3300026041 Bacteria 5733
396 Ga0207639_10014834 3300026041 Bacteria 5488
397 Ga0207639_10028477 3300026041 Bacteria 4079
398 Ga0207639_10030303 3300026041 Bacteria 3967
399 Ga0207639_10088370 3300026041 Bacteria 2473
400 Ga0207639_10111414 3300026041 Bacteria 2231
401 Ga0207678_10001895 3300026067 Bacteria 19090
402 Ga0207678_10003129 3300026067 Bacteria 14975
403 Ga0207678_10047684 3300026067 Bacteria 3704
404 Ga0207678_10061702 3300026067 Bacteria 3224
405 Ga0207678_10062991 3300026067 Bacteria 3187
406 Ga0207678_10172896 3300026067 Bacteria 1844
407 Ga0207702_10025964 3300026078 Bacteria 4863
408 Ga0207702_10031490 3300026078 Bacteria 4420
409 Ga0207702_10045727 3300026078 Bacteria 3683
410 Ga0207702_10196823 3300026078 Bacteria 1866
411 Ga0207702_10314046 3300026078 Bacteria 1491
412 Ga0207641_10000761 3300026088 Bacteria 34699
413 Ga0207641_10002113 3300026088 Bacteria 18795
414 Ga0207648_10001403 3300026089 Bacteria 26509
415 Ga0207648_10017420 3300026089 Bacteria 6538
416 Ga0207648_10048809 3300026089 Bacteria 3706
417 Ga0207676_10000731 3300026095 Bacteria 25737
418 Ga0207676_10012400 3300026095 Bacteria 6106
419 Ga0207676_10565241 3300026095 Bacteria 1088
420 Ga0207674_10000850 3300026116 Bacteria 39849
421 Ga0207674_10011911 3300026116 Bacteria 9750
422 Ga0207674_10012448 3300026116 Bacteria 9507
423 Ga0207674_10016271 3300026116 Bacteria 8146
424 Ga0207674_10035053 3300026116 Bacteria 5238
425 Ga0207674_10036991 3300026116 Bacteria 5080
426 Ga0207674_10054898 3300026116 Bacteria 4053
427 Ga0207674_10422338 3300026116 Bacteria 1288
428 Ga0207683_10115678 3300026121 Bacteria 2404
429 Ga0207698_10006372 3300026142 Bacteria 7355
430 Ga0207698_10009246 3300026142 Bacteria 6272
431 Ga0207698_10046586 3300026142 Bacteria 3276
432 Ga0207698_10050609 3300026142 Bacteria 3170
433 Ga0207698_10069575 3300026142 Bacteria 2784
434 Ga0207698_10093468 3300026142 Bacteria 2469
435 Ga0207698_10147759 3300026142 Bacteria 2035
436 Ga0207698_10319786 3300026142 Bacteria 1453
437 Ga0209813_10005352 3300027866 Bacteria 3109
438 Ga0268266_10000256 3300028379 Bacteria 89436
439 Ga0268266_10102025 3300028379 Bacteria 2530
440 Ga0268265_10007223 3300028380 Bacteria 7505
441 Ga0268265_10047457 3300028380 Bacteria 3218
442 Ga0268265_10232819 3300028380 Bacteria 1620
443 Ga0268265_10245348 3300028380 Bacteria 1583
444 Ga0268264_10000755 3300028381 Bacteria 36243
445 Ga0268264_10032295 3300028381 Bacteria 4295
446 Ga0265318_10069592 3300028577 Bacteria 1305
447 Ga0307515_10000186 3300028794 Bacteria 153531
448 Ga0307515_10030060 3300028794 Bacteria 9147
449 Ga0265338_10006667 3300028800 Bacteria 14602
450 Ga0265332_10042963 3300031238 Bacteria 1953
451 Ga0265320_10000088 3300031240 Bacteria 77379
452 Ga0265325_10019084 3300031241 Bacteria 3795
453 Ga0265340_10001665 3300031247 Bacteria 12773
454 Ga0265340_10003297 3300031247 Bacteria 9149
455 Ga0265339_10084722 3300031249 Bacteria 1670
456 Ga0265316_10006090 3300031344 Bacteria 11574
457 Ga0265316_10018815 3300031344 Bacteria 5929
458 Ga0265316_10085401 3300031344 Bacteria 2415
459 Ga0265313_10034458 3300031595 Bacteria 2560
460 Ga0316575_10008358 3300031665 Bacteria 3768
461 Ga0316575_10032612 3300031665 Bacteria 2041
462 Ga0265314_10008687 3300031711 Bacteria 8689
463 Ga0265314_10011566 3300031711 Bacteria 7272
464 Ga0265342_10009933 3300031712 Bacteria 6653
465 Ga0265342_10013637 3300031712 Bacteria 5439
466 Ga0316576_10228756 3300031727 Bacteria 1398
467 Ga0316577_10094086 3300031733 Bacteria 1678
468 Ga0307413_10033399 3300031824 Bacteria 2929
469 Ga0307410_10103090 3300031852 Bacteria 2048
470 Ga0307410_10440576 3300031852 Bacteria 1061
471 Ga0307407_10088573 3300031903 Bacteria 1891
472 Ga0307412_10019158 3300031911 Bacteria 4136
473 Ga0307409_100018531 3300031995 Bacteria 4684
474 Ga0307409_100074682 3300031995 Bacteria 2710
475 Ga0307414_10009782 3300032004 Bacteria 5526
476 Ga0307414_10010095 3300032004 Bacteria 5459
477 Ga0307414_10044469 3300032004 Bacteria 3033
478 Ga0307414_10154988 3300032004 Bacteria 1812
479 Ga0307414_10465226 3300032004 Bacteria 1112
480 Ga0307411_10000948 3300032005 Bacteria 11083
481 Ga0307411_10020582 3300032005 Bacteria 3841
482 Ga0307411_10025486 3300032005 Bacteria 3544
483 Ga0307411_10027338 3300032005 Bacteria 3450
484 Ga0307415_100001833 3300032126 Bacteria 10420
485 Ga0307415_100033428 3300032126 Bacteria 3338
486 Ga0373946_0001529 3300035171 Bacteria 8044
487 Ga0373924_0129707 3300035410 Bacteria 1097
488 Ga0373931_0177169 3300035691 Bacteria 1260
489 Ga0373935_0016342 3300035692 Bacteria 4490
490 Ga0373927_0006248 3300035695 Bacteria 8131
491 Ga0373937_0060514 3300036401 Bacteria 3480
492 Ga0395899_0000154 3300037312 Bacteria 104239
493 Ga0395899_0105544 3300037312 Bacteria 2029
494 Ga0395899_0275004 3300037312 Bacteria 1147
495 Ga0395900_0000293 3300037418 Bacteria 75318
496 Ga0395900_0000837 3300037418 Bacteria 40521
497 Ga0395900_0001617 3300037418 Bacteria 26505
498 Ga0395900_0005458 3300037418 Bacteria 13315
499 Ga0395900_0014026 3300037418 Bacteria 8183
500 Ga0395900_0023841 3300037418 Bacteria 6261
501 Ga0395900_0039225 3300037418 Bacteria 4880
502 Ga0395900_0070364 3300037418 Bacteria 3597
503 Ga0395900_0073310 3300037418 Bacteria 3520
504 Ga0395900_0102369 3300037418 Bacteria 2942
505 Ga0395900_0194366 3300037418 Bacteria 2056
506 Ga0395900_0218670 3300037418 Bacteria 1921
507 Ga0395900_0297051 3300037418 Bacteria 1602
508 Ga0395900_0509950 3300037418 Bacteria 1152
509 Ga0395898_0000219 3300037466 Bacteria 146838
510 Ga0395898_0001594 3300037466 Bacteria 30951
511 Ga0395898_0022892 3300037466 Bacteria 6318
512 Ga0395898_0033483 3300037466 Bacteria 5127
513 Ga0395898_0038614 3300037466 Bacteria 4730
514 Ga0395898_0121876 3300037466 Bacteria 2498
515 Ga0395898_0127894 3300037466 Bacteria 2434
516 Ga0395898_0166718 3300037466 Bacteria 2106
517 Ga0395898_0243070 3300037466 Bacteria 1717
518 Ga0395905_0000094 3300037471 Bacteria 147776
519 Ga0395905_0001923 3300037471 Bacteria 23843
520 Ga0395905_0004005 3300037471 Bacteria 15480
521 Ga0395905_0014247 3300037471 Bacteria 7596
522 Ga0395905_0016641 3300037471 Bacteria 6990
523 Ga0395905_0016712 3300037471 Bacteria 6973
524 Ga0395905_0021348 3300037471 Bacteria 6124
525 Ga0395905_0024162 3300037471 Bacteria 5736
526 Ga0395905_0028215 3300037471 Bacteria 5291
527 Ga0395905_0066005 3300037471 Bacteria 3388
528 Ga0395905_0120879 3300037471 Bacteria 2462
529 Ga0395905_0160391 3300037471 Bacteria 2114
530 Ga0395905_0203178 3300037471 Bacteria 1857
531 Ga0395905_0213911 3300037471 Bacteria 1805
532 Ga0395905_0380168 3300037471 Bacteria 1306
533 Ga0395905_0397782 3300037471 Bacteria 1272
534 Ga0395905_0439035 3300037471 Bacteria 1202
535 Ga0395905_0466562 3300037471 Bacteria 1161
536 Ga0395901_0000228 3300038443 Bacteria 70677
537 Ga0395901_0002443 3300038443 Bacteria 18837
538 Ga0395901_0003671 3300038443 Bacteria 15477
539 Ga0395901_0008002 3300038443 Bacteria 10671
540 Ga0395901_0012539 3300038443 Bacteria 8601
541 Ga0395901_0041312 3300038443 Bacteria 4779
542 Ga0395901_0044513 3300038443 Bacteria 4603
543 Ga0395901_0061864 3300038443 Bacteria 3895
544 Ga0395901_0075485 3300038443 Bacteria 3516
545 Ga0395901_0076069 3300038443 Bacteria 3502
546 Ga0395901_0086429 3300038443 Bacteria 3279
547 Ga0395901_0139342 3300038443 Bacteria 2549
548 Ga0395901_0197458 3300038443 Bacteria 2109
549 Ga0395901_0234317 3300038443 Bacteria 1916
550 Ga0395901_0240762 3300038443 Bacteria 1887
551 Ga0395901_0287881 3300038443 Bacteria 1706
552 Ga0395901_0455821 3300038443 Bacteria 1307
553 Ga0395901_0529857 3300038443 Bacteria 1196
554 Ga0395901_0624640 3300038443 Bacteria 1084
555 Ga0395901_0752757 3300038443 Bacteria 967
556 Ga0436360_0764336 3300039438 Bacteria 1608
557 Ga0436363_1352830 3300039450 Bacteria 1624
558 Ga0451807_0903417 3300041486 Bacteria 1196
559 Ga0439448_0002573 3300042005 Bacteria 4944
560 Ga0439449_0000498 3300042007 Bacteria 14738
561 Ga0439452_011492 3300042010 Bacteria 2541
562 Ga0439455_0000252 3300042012 Bacteria 6482
563 Ga0439458_0000255 3300042157 Bacteria 12956
564 Ga0439458_0006263 3300042157 Bacteria 2653
565 Ga0450908_025005 3300042184 Bacteria 1043
566 Ga0439464_0000114 3300042439 Bacteria 12425
567 Ga0439460_0046173 3300042461 Bacteria 1294
568 Ga0466963_0035095 3300044694 Bacteria 3266
569 Ga0466963_0083554 3300044694 Bacteria 2165
570 Ga0466957_0312078 3300044842 Bacteria 1059
571 Ga0466960_0036053 3300044901 Bacteria 2315
572 Ga0466959_0027362 3300045049 Bacteria 4230
573 Ga0466958_0145877 3300045836 Bacteria 1491
574 Ga0466967_0061960 3300045976 Bacteria 3319
575 Ga0466967_0072406 3300045976 Bacteria 3089
576 Ga0466967_0082937 3300045976 Bacteria 2898
577 Ga0466967_0086492 3300045976 Bacteria 2840
578 Ga0495627_000224 3300046453 Bacteria 60727
579 Ga0495627_000650 3300046453 Bacteria 26905
580 Ga0495592_0055356 3300046454 Bacteria 2935
581 Ga0495638_0004955 3300046460 Bacteria 9998
582 Ga0495651_0046190 3300046462 Bacteria 3371
583 Ga0495653_0041584 3300046463 Bacteria 3587
584 Ga0495650_0001756 3300046471 Bacteria 19720
585 Ga0495582_0063922 3300046473 Bacteria 2032
586 Ga0495639_0048020 3300046475 Bacteria 1935
587 Ga0495664_0039770 3300046477 Bacteria 2779
588 Ga0495594_0075152 3300046499 Bacteria 1883
589 Ga0495596_0006414 3300046500 Bacteria 5412
590 Ga0495608_0089155 3300046511 Bacteria 1996
591 Ga0495610_0001358 3300046512 Bacteria 21731
592 Ga0495610_0006803 3300046512 Bacteria 7759
593 Ga0495618_0023989 3300046514 Bacteria 3776
594 Ga0495618_0105126 3300046514 Bacteria 1808
595 Ga0495628_0096379 3300046516 Bacteria 2285
596 Ga0495637_0026938 3300046520 Bacteria 2575
597 Ga0495643_0000007 3300046522 Bacteria 383435
598 Ga0495643_0062327 3300046522 Bacteria 1974
599 Ga0495648_0007929 3300046524 Bacteria 8425
600 Ga0495666_0007474 3300046526 Bacteria 5471
601 Ga0495652_0049977 3300046529 Bacteria 3577
602 Ga0495640_0051265 3300046533 Bacteria 2837
603 Ga0495633_0041501 3300046558 Bacteria 2188
604 Ga0495667_0038098 3300046559 Bacteria 3202
605 Ga0495668_0118643 3300046616 Bacteria 1447
606 Ga0495625_0000025 3300046660 Bacteria 267383
607 Ga0495625_0000665 3300046660 Bacteria 48983
608 Ga0495625_0001685 3300046660 Bacteria 25771
609 Ga0495635_0036810 3300046663 Bacteria 3389
610 Ga0495588_0035246 3300046674 Bacteria 2535
611 Ga0495657_0037685 3300046675 Bacteria 3330
612 Ga0495599_0000776 3300046678 Bacteria 17964
613 Ga0495646_0035166 3300046680 Bacteria 3108
614 Ga0495669_0000556 3300046684 Bacteria 16545
615 Ga0495669_0037764 3300046684 Bacteria 2138
616 Ga0495670_0000014 3300046691 Bacteria 138993
617 Ga0495649_0012204 3300046694 Bacteria 5009
618 Ga0495674_0056993 3300047319 Bacteria 3420
619 Ga0495680_0032197 3300047322 Bacteria 4260
620 Ga0495673_0000078 3300047469 Bacteria 203066
621 Ga0495681_0000011 3300047470 Bacteria 201843
622 Ga0495684_0099297 3300047471 Bacteria 2201
623 Ga0495686_0000147 3300047472 Bacteria 139008
624 Ga0495686_0000661 3300047472 Bacteria 46810
625 Ga0495686_0121210 3300047472 Bacteria 1558
626 Ga0495686_0185313 3300047472 Bacteria 1203
627 Ga0496101_0073859 3300048904 Bacteria 2506
628 Ga0496102_0275836 3300048905 Bacteria 1585
629 Ga0496107_0032008 3300048910 Bacteria 3757
630 Ga0496107_0136217 3300048910 Bacteria 1814
631 Ga0496108_0033094 3300048911 Bacteria 4294
632 Ga0496108_0316070 3300048911 Bacteria 1361
633 Ga0496109_0180520 3300048912 Bacteria 1982
634 Ga0496110_0076090 3300048913 Bacteria 2984
635 Ga0496110_0130977 3300048913 Bacteria 2265
636 Ga0496111_0146163 3300048914 Bacteria 1753
637 Ga0496112_0027433 3300048915 Bacteria 5490
638 Ga0496112_0042055 3300048915 Bacteria 4472
639 Ga0496112_0182833 3300048915 Bacteria 2060
640 Ga0496112_0210036 3300048915 Bacteria 1904
641 Ga0496114_0090799 3300048917 Bacteria 2593
642 Ga0496117_0021492 3300048920 Bacteria 5217
643 Ga0496118_0001617 3300048921 Bacteria 33315
644 Ga0496120_0161911 3300048923 Bacteria 1115
645 Ga0496121_0000031 3300048924 Bacteria 384119
646 Ga0496121_0003131 3300048924 Bacteria 23873
647 Ga0496123_0002459 3300048926 Bacteria 22941
648 Ga0496124_0015727 3300048927 Bacteria 7234
649 Ga0496124_0142495 3300048927 Bacteria 1890
650 Ga0501031_0059130 3300049568 Bacteria 2498
651 Ga0501032_0053364 3300049569 Bacteria 2723
652 Ga0501033_0014079 3300049570 Bacteria 6082
653 Ga0501033_0054652 3300049570 Bacteria 2953
654 Ga0501033_0151270 3300049570 Bacteria 1674
655 Ga0501034_0005027 3300049571 Bacteria 14533
656 Ga0501034_0482573 3300049571 Bacteria 1155
657 Ga0501036_0282734 3300049572 Bacteria 1388
658 Ga0501038_0015781 3300049574 Bacteria 6864
659 Ga0501043_0020865 3300049579 Bacteria 5139
660 Ga0501043_0047606 3300049579 Bacteria 3371
661 Ga0501047_0001117 3300049581 Bacteria 26643
662 Ga0501047_0013021 3300049581 Bacteria 7877
663 Ga0501047_0040926 3300049581 Bacteria 4480
664 Ga0501067_0109079 3300049583 Bacteria 1539
665 Ga0501069_0036991 3300049585 Bacteria 2693
666 Ga0501070_0000020 3300049586 Bacteria 169025
667 Ga0501070_0061488 3300049586 Bacteria 3111
668 Ga0501080_0011676 3300049742 Bacteria 8046
669 Ga0501080_0075002 3300049742 Bacteria 3147
670 Ga0501083_0006223 3300049744 Bacteria 8467
671 Ga0501035_0006911 3300049822 Bacteria 10599
672 Ga0501035_0088838 3300049822 Bacteria 2722
673 Ga0501044_0014571 3300049823 Bacteria 8481
674 Ga0501044_0020893 3300049823 Bacteria 6989
675 Ga0501044_0078876 3300049823 Bacteria 3337
676 Ga0501044_0097527 3300049823 Bacteria 2960
677 Ga0501044_0202547 3300049823 Bacteria 1942
678 Ga0501044_0211422 3300049823 Bacteria 1894
679 nmdc:mga0k408_161782_c1 3300050493 Bacteria 1334
680 nmdc:mga0k408_25112_c1 3300050493 Bacteria 3372
681 nmdc:mga0k408_34852_c2 3300050493 Bacteria 2192
682 nmdc:mga04h51_59395_c1 3300050495 Bacteria 1307
683 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
684 nmdc:mga06r32_145461_c1 3300050510 Bacteria 2348
685 nmdc:mga08x19_143565_c1 3300050514 Bacteria 1613
686 nmdc:mga0a205_5975_c1 3300050515 Bacteria 10970
687 Ga0495601_0009915 3300053077 Bacteria 5644
688 Ga0495601_0011636 3300053077 Bacteria 5272
689 Ga0495595_0028222 3300053084 Bacteria 2506
690 Ga0495619_0164263 3300053085 Bacteria 1534
691 Ga0500641_0021781 3300053096 Bacteria 2448
692 Ga0500562_002575 3300053108 Bacteria 4520
693 Ga0500593_074444 3300053117 Bacteria 1468
694 Ga0500597_024094 3300053120 Bacteria 2439
695 Ga0500618_000514 3300053125 Bacteria 24477
696 Ga0500559_0004706 3300053136 Bacteria 6423
697 Ga0500559_0022361 3300053136 Bacteria 2681
698 Ga0500616_0008861 3300053153 Bacteria 6182
699 Ga0500622_0034813 3300053156 Bacteria 2637
700 Ga0500624_000020 3300053157 Bacteria 118392
701 Ga0500637_0000022 3300053178 Bacteria 61494
702 Ga0501084_0000171 3300054114 Bacteria 50689
703 2511120387 2510917020 Bacteria 5657507
704 2511130088 2510917021 Bacteria 5705459
705 2643924796 2643221583 Bacteria 5218014
706 2738745027 2738541281 Bacteria 5112672
707 2739354257 2738543032 Bacteria 5115625
708 2793978932 2791355406 Bacteria 11364898
709 2830076896 2830075706 Bacteria 3855215
710 2885430718 2885429604 Bacteria 3642894
711 2919514470 2919513703 Bacteria 3844312
712 2919678829 2919675420 Bacteria 3969095
713 2946789656 2946787523 Bacteria 4366789
714 8048137243 8048127548 Bacteria 11053136
715 Ga0496102_0265920
716 JGI24740J21852_10005372
717 JGI24739J22299_10004790
718 JGI24739J22299_10009552
719 JGI24739J22299_10049772
720 JGI24737J22298_10000687
721 JGI24735J21928_10027297
722 JGI24738J21930_10002091
723 JGI24738J21930_10007677
724 JGI25150J39212_1000020
725 JGI25151J46595_10055943
726 JGI25153J46596_10000017
727 rootH2_10075661
728 Ga0055536_1011158
729 Ga0055530_10016424
730 Ga0055540_1005503
731 Ga0065165_1000625
732 Ga0065714_10109070
733 Ga0070658_10008641
734 Ga0070658_10038050
735 Ga0070658_10040306
736 Ga0070658_10222296
737 Ga0070658_10246114
738 Ga0070658_10318277
739 Ga0070676_10004172
740 Ga0070683_100025567
741 Ga0070683_100218535
742 Ga0070690_100091417
743 Ga0070670_100016900
744 Ga0070670_100025510
745 Ga0068869_100003116
746 Ga0070666_10062831
747 Ga0070680_100000777
748 Ga0070680_100001609
749 Ga0070680_100008701
750 Ga0070680_100255725
751 Ga0070680_100310653
752 Ga0070682_100035315
753 Ga0068868_100011184
754 Ga0070660_100003291
755 Ga0070660_100004065
756 Ga0070660_100017639
757 Ga0070660_100029155
758 Ga0070660_100047766
759 Ga0070660_100160963
760 Ga0070660_100186491
761 Ga0070660_100266557
762 Ga0070660_100310240
763 Ga0070660_100362680
764 Ga0070691_10008548
765 Ga0070691_10123756
766 Ga0070661_100001494
767 Ga0070661_100040130
768 Ga0070661_100061923
769 Ga0070661_100108664
770 Ga0070661_100169133
771 Ga0070661_100182187
772 Ga0070692_10041405
773 Ga0070668_100043360
774 Ga0070669_100000138
775 Ga0070669_100041151
776 Ga0070675_100021410
777 Ga0070671_100021780
778 Ga0070671_100027056
779 Ga0070671_100104838
780 Ga0070671_100232034
781 Ga0070674_100033254
782 Ga0070673_100002586
783 Ga0070673_100004948
784 Ga0070659_100001040
785 Ga0070659_100003697
786 Ga0070659_100007325
787 Ga0070659_100015988
788 Ga0070659_100027275
789 Ga0070659_100065256
790 Ga0070659_100075317
791 Ga0070659_100112163
792 Ga0070667_100047812
793 Ga0070667_100227132
794 Ga0070709_10202436
795 Ga0070694_100020574
796 Ga0070663_100048900
797 Ga0070663_100109285
798 Ga0070663_100276188
799 Ga0070663_100398467
800 Ga0070662_100001837
801 Ga0070662_100001928
802 Ga0070662_100080350
803 Ga0070681_10006985
804 Ga0070681_10093219
805 Ga0070681_10113562
806 Ga0070681_10315254
807 Ga0070681_10332708
808 Ga0068867_100010664
809 Ga0068867_100016740
810 Ga0070698_100063579
811 Ga0070679_100004635
812 Ga0070679_100075528
813 Ga0070679_100077512
814 Ga0070679_100320061
815 Ga0070679_100330242
816 Ga0070679_100419467
817 Ga0070679_100479188
818 Ga0070684_100027737
819 Ga0070684_100124210
820 Ga0070684_100345018
821 Ga0070697_100000139
822 Ga0070697_100018866
823 Ga0068853_100004994
824 Ga0068853_100027359
825 Ga0068853_100027704
826 Ga0068853_100033891
827 Ga0068853_100113339
828 Ga0068853_100116126
829 Ga0068853_100134100
830 Ga0070672_100000868
831 Ga0070693_100284404
832 Ga0070665_100000380
833 Ga0070665_100138367
834 Ga0068855_100001148
835 Ga0068855_100008821
836 Ga0068855_100010741
837 Ga0068855_100394571
838 Ga0068855_100395925
839 Ga0068855_100709803
840 Ga0070664_100002792
841 Ga0070664_100004946
842 Ga0070664_100006300
843 Ga0070664_100043512
844 Ga0070664_100057463
845 Ga0068857_100007132
846 Ga0068857_100021844
847 Ga0068857_100041994
848 Ga0068857_100107278
849 Ga0068857_100135940
850 Ga0068857_100189409
851 Ga0068857_100313261
852 Ga0068854_100005266
853 Ga0068854_100014636
854 Ga0068854_100072173
855 Ga0068854_100072875
856 Ga0068854_100240021
857 Ga0068856_100009932
858 Ga0068856_100047053
859 Ga0068856_100057631
860 Ga0068856_100347459
861 Ga0068856_100618558
862 Ga0068852_100000946
863 Ga0068852_100005893
864 Ga0068852_100018079
865 Ga0068852_100102314
866 Ga0068852_100112815
867 Ga0068852_100125607
868 Ga0068852_100225606
869 Ga0068852_100505068
870 Ga0068859_100000550
871 Ga0068859_100006426
872 Ga0068859_100073328
873 Ga0068859_100155178
874 Ga0068864_100003528
875 Ga0068864_100005190
876 Ga0068851_10012796
877 Ga0068851_10014173
878 Ga0068863_100004087
879 Ga0068863_100009309
880 Ga0068863_100048341
881 Ga0068863_100226573
882 Ga0068858_100002589
883 Ga0068858_100004956
884 Ga0068858_100023934
885 Ga0068858_100025161
886 Ga0068858_100235315
887 Ga0068860_100004406
888 Ga0068860_100006884
889 Ga0068860_100284558
890 Ga0068862_100006635
891 Ga0068862_100021749
892 Ga0081538_10018384
893 Ga0075368_10087558
894 Ga0070712_100185284
895 Ga0075366_10026901
896 Ga0075366_10067766
897 Ga0075366_10180035
898 Ga0075370_10000001
899 Ga0068871_100405905
900 Ga0075428_100131976
901 Ga0075431_100288808
902 Ga0075433_10010202
903 Ga0068865_100005976
904 Ga0097620_100000550
905 Ga0097620_100006426
906 Ga0097620_100073329
907 Ga0097620_100155181
908 Ga0105240_10010679
909 Ga0105240_10015147
910 Ga0105240_10018070
911 Ga0105240_10065883
912 Ga0105240_10085276
913 Ga0105240_10150136
914 Ga0105245_10000198
915 Ga0105245_10063705
916 Ga0105247_10018070
917 Ga0105243_10010602
918 Ga0105243_10298211
919 Ga0105241_10027469
920 Ga0105241_10284753
921 Ga0105248_10000391
922 Ga0105248_10031695
923 Ga0105237_10243467
924 Ga0105238_10007731
925 Ga0105238_10014401
926 Ga0105238_10052170
927 Ga0105239_10053714
928 Ga0105239_10477424
929 Ga0105239_10732565
930 Ga0105246_10073297
931 Ga0105246_10368332
932 Ga0157373_10010344
933 Ga0157373_10031653
934 Ga0157373_10076574
935 Ga0157373_10081004
936 Ga0157373_10142136
937 Ga0157371_10002789
938 Ga0157371_10002797
939 Ga0157371_10293365
940 Ga0157370_10006108
941 Ga0157370_10025395
942 Ga0157370_10032238
943 Ga0157370_10069403
944 Ga0157370_10097207
945 Ga0157370_10130551
946 Ga0157370_10204812
947 Ga0157370_10284948
948 Ga0157370_10295723
949 Ga0157370_10349859
950 Ga0157369_10002441
951 Ga0157369_10007310
952 Ga0157369_10085210
953 Ga0157369_10098789
954 Ga0157369_10102744
955 Ga0157369_10290820
956 Ga0157369_10504471
957 Ga0157374_10086272
958 Ga0157378_10001311
959 Ga0157378_10437162
960 Ga0163162_10064438
961 Ga0163162_10072048
962 Ga0163162_10122274
963 Ga0163162_10511373
964 Ga0157372_10003571
965 Ga0157372_10012201
966 Ga0157372_10244011
967 Ga0157375_10026969
968 Ga0157375_10100575
969 Ga0163163_10003435
970 Ga0157377_10022379
971 Ga0157379_10006683
972 Ga0206353_10434619
973 Ga0207425_1000022
974 Ga0209129_1000286
975 Ga0209233_1013690
976 Ga0209676_1009141
977 Ga0209025_1001464
978 Ga0209758_1000004
979 Ga0209050_1000001
980 Ga0209051_1000246
981 Ga0209257_1011642
982 Ga0207697_10000297
983 Ga0207656_10008833
984 Ga0207656_10013262
985 Ga0207656_10026133
986 Ga0207688_10000214
987 Ga0207647_10000450
988 Ga0207647_10000550
989 Ga0207647_10001333
990 Ga0207647_10051388
991 Ga0207699_10175992
992 Ga0207645_10047073
993 Ga0207705_10000647
994 Ga0207705_10000733
995 Ga0207705_10012679
996 Ga0207705_10016400
997 Ga0207705_10021334
998 Ga0207705_10036186
999 Ga0207705_10038781
1000 Ga0207705_10043296
1001 Ga0207705_10044634
1002 Ga0207654_10129313
1003 Ga0207707_10004869
1004 Ga0207707_10012471
1005 Ga0207707_10031408
1006 Ga0207707_10271783
1007 Ga0207695_10024131
1008 Ga0207695_10048907
1009 Ga0207695_10105071
1010 Ga0207695_10292239
1011 Ga0207695_10458431
1012 Ga0207693_10067961
1013 Ga0207660_10000720
1014 Ga0207660_10000753
1015 Ga0207660_10002930
1016 Ga0207660_10002951
1017 Ga0207660_10004462
1018 Ga0207660_10026504
1019 Ga0207660_10400218
1020 Ga0207657_10002019
1021 Ga0207657_10002443
1022 Ga0207657_10003486
1023 Ga0207657_10003530
1024 Ga0207657_10009031
1025 Ga0207657_10010446
1026 Ga0207657_10011217
1027 Ga0207657_10016702
1028 Ga0207657_10028287
1029 Ga0207657_10065052
1030 Ga0207657_10296054
1031 Ga0207657_10317974
1032 Ga0207649_10008370
1033 Ga0207649_10010422
1034 Ga0207649_10021475
1035 Ga0207649_10028353
1036 Ga0207649_10056575
1037 Ga0207652_10001317
1038 Ga0207652_10002779
1039 Ga0207652_10052952
1040 Ga0207652_10115640
1041 Ga0207652_10287960
1042 Ga0207646_10162553
1043 Ga0207681_10002797
1044 Ga0207681_10045621
1045 Ga0207694_10001010
1046 Ga0207694_10009321
1047 Ga0207694_10102113
1048 Ga0207659_10011048
1049 Ga0207659_10277564
1050 Ga0207687_10004719
1051 Ga0207644_10021354
1052 Ga0207644_10021704
1053 Ga0207644_10028811
1054 Ga0207644_10067500
1055 Ga0207644_10178978
1056 Ga0207690_10004314
1057 Ga0207690_10004900
1058 Ga0207690_10031546
1059 Ga0207690_10061653
1060 Ga0207690_10069839
1061 Ga0207690_10174621
1062 Ga0207690_10247107
1063 Ga0207706_10001953
1064 Ga0207706_10002890
1065 Ga0207706_10019463
1066 Ga0207706_10109711
1067 Ga0207709_10069381
1068 Ga0207709_10101297
1069 Ga0207669_10052976
1070 Ga0207704_10043071
1071 Ga0207691_10000047
1072 Ga0207691_10073755
1073 Ga0207691_10228695
1074 Ga0207711_10001028
1075 Ga0207711_10003195
1076 Ga0207711_10003281
1077 Ga0207689_10000002
1078 Ga0207689_10014038
1079 Ga0207661_10047494
1080 Ga0207661_10322527
1081 Ga0207679_10034440
1082 Ga0207679_10058928
1083 Ga0207667_10004932
1084 Ga0207667_10007513
1085 Ga0207667_10015484
1086 Ga0207667_10017570
1087 Ga0207667_10029561
1088 Ga0207667_10051008
1089 Ga0207667_10061822
1090 Ga0207651_10010367
1091 Ga0207651_10027820
1092 Ga0207651_10254231
1093 Ga0207712_10000969
1094 Ga0207712_10095457
1095 Ga0207668_10113779
1096 Ga0207640_10010650
1097 Ga0207640_10024071
1098 Ga0207640_10283999
1099 Ga0207658_10003561
1100 Ga0207658_10023648
1101 Ga0207658_10230416
1102 Ga0207677_10361972
1103 Ga0207703_10002189
1104 Ga0207703_10030569
1105 Ga0207703_10065739
1106 Ga0207703_10204788
1107 Ga0207639_10000181
1108 Ga0207639_10002813
1109 Ga0207639_10013429
1110 Ga0207639_10014834
1111 Ga0207639_10028477
1112 Ga0207639_10030303
1113 Ga0207639_10088370
1114 Ga0207639_10111414
1115 Ga0207678_10001895
1116 Ga0207678_10003129
1117 Ga0207678_10047684
1118 Ga0207678_10061702
1119 Ga0207678_10062991
1120 Ga0207678_10172896
1121 Ga0207702_10025964
1122 Ga0207702_10031490
1123 Ga0207702_10045727
1124 Ga0207702_10196823
1125 Ga0207702_10314046
1126 Ga0207641_10000761
1127 Ga0207641_10002113
1128 Ga0207648_10001403
1129 Ga0207648_10017420
1130 Ga0207648_10048809
1131 Ga0207676_10000731
1132 Ga0207676_10012400
1133 Ga0207676_10565241
1134 Ga0207674_10000850
1135 Ga0207674_10011911
1136 Ga0207674_10012448
1137 Ga0207674_10016271
1138 Ga0207674_10035053
1139 Ga0207674_10036991
1140 Ga0207674_10054898
1141 Ga0207674_10422338
1142 Ga0207683_10115678
1143 Ga0207698_10006372
1144 Ga0207698_10009246
1145 Ga0207698_10046586
1146 Ga0207698_10050609
1147 Ga0207698_10069575
1148 Ga0207698_10093468
1149 Ga0207698_10147759
1150 Ga0207698_10319786
1151 Ga0209813_10005352
1152 Ga0268266_10000256
1153 Ga0268266_10102025
1154 Ga0268265_10007223
1155 Ga0268265_10047457
1156 Ga0268265_10232819
1157 Ga0268265_10245348
1158 Ga0268264_10000755
1159 Ga0268264_10032295
1160 Ga0265318_10069592
1161 Ga0307515_10000186
1162 Ga0307515_10030060
1163 Ga0265338_10006667
1164 Ga0265332_10042963
1165 Ga0265320_10000088
1166 Ga0265325_10019084
1167 Ga0265340_10001665
1168 Ga0265340_10003297
1169 Ga0265339_10084722
1170 Ga0265316_10006090
1171 Ga0265316_10018815
1172 Ga0265316_10085401
1173 Ga0265313_10034458
1174 Ga0316575_10008358
1175 Ga0316575_10032612
1176 Ga0265314_10008687
1177 Ga0265314_10011566
1178 Ga0265342_10009933
1179 Ga0265342_10013637
1180 Ga0316576_10228756
1181 Ga0316577_10094086
1182 Ga0307413_10033399
1183 Ga0307410_10103090
1184 Ga0307410_10440576
1185 Ga0307407_10088573
1186 Ga0307412_10019158
1187 Ga0307409_100018531
1188 Ga0307409_100074682
1189 Ga0307414_10009782
1190 Ga0307414_10010095
1191 Ga0307414_10044469
1192 Ga0307414_10154988
1193 Ga0307414_10465226
1194 Ga0307411_10000948
1195 Ga0307411_10020582
1196 Ga0307411_10025486
1197 Ga0307411_10027338
1198 Ga0307415_100001833
1199 Ga0307415_100033428
1200 Ga0373946_0001529
1201 Ga0373924_0129707
1202 Ga0373931_0177169
1203 Ga0373935_0016342
1204 Ga0373927_0006248
1205 Ga0373937_0060514
1206 Ga0395899_0000154
1207 Ga0395899_0105544
1208 Ga0395899_0275004
1209 Ga0395900_0000293
1210 Ga0395900_0000837
1211 Ga0395900_0001617
1212 Ga0395900_0005458
1213 Ga0395900_0014026
1214 Ga0395900_0023841
1215 Ga0395900_0039225
1216 Ga0395900_0070364
1217 Ga0395900_0073310
1218 Ga0395900_0102369
1219 Ga0395900_0194366
1220 Ga0395900_0218670
1221 Ga0395900_0297051
1222 Ga0395900_0509950
1223 Ga0395898_0000219
1224 Ga0395898_0001594
1225 Ga0395898_0022892
1226 Ga0395898_0033483
1227 Ga0395898_0038614
1228 Ga0395898_0121876
1229 Ga0395898_0127894
1230 Ga0395898_0166718
1231 Ga0395898_0243070
1232 Ga0395905_0000094
1233 Ga0395905_0001923
1234 Ga0395905_0004005
1235 Ga0395905_0014247
1236 Ga0395905_0016641
1237 Ga0395905_0016712
1238 Ga0395905_0021348
1239 Ga0395905_0024162
1240 Ga0395905_0028215
1241 Ga0395905_0066005
1242 Ga0395905_0120879
1243 Ga0395905_0160391
1244 Ga0395905_0203178
1245 Ga0395905_0213911
1246 Ga0395905_0380168
1247 Ga0395905_0397782
1248 Ga0395905_0439035
1249 Ga0395905_0466562
1250 Ga0395901_0000228
1251 Ga0395901_0002443
1252 Ga0395901_0003671
1253 Ga0395901_0008002
1254 Ga0395901_0012539
1255 Ga0395901_0041312
1256 Ga0395901_0044513
1257 Ga0395901_0061864
1258 Ga0395901_0075485
1259 Ga0395901_0076069
1260 Ga0395901_0086429
1261 Ga0395901_0139342
1262 Ga0395901_0197458
1263 Ga0395901_0234317
1264 Ga0395901_0240762
1265 Ga0395901_0287881
1266 Ga0395901_0455821
1267 Ga0395901_0529857
1268 Ga0395901_0624640
1269 Ga0395901_0752757
1270 Ga0436360_0764336
1271 Ga0436363_1352830
1272 Ga0451807_0903417
1273 Ga0439448_0002573
1274 Ga0439449_0000498
1275 Ga0439452_011492
1276 Ga0439455_0000252
1277 Ga0439458_0000255
1278 Ga0439458_0006263
1279 Ga0450908_025005
1280 Ga0439464_0000114
1281 Ga0439460_0046173
1282 Ga0466963_0035095
1283 Ga0466963_0083554
1284 Ga0466957_0312078
1285 Ga0466960_0036053
1286 Ga0466959_0027362
1287 Ga0466958_0145877
1288 Ga0466967_0061960
1289 Ga0466967_0072406
1290 Ga0466967_0082937
1291 Ga0466967_0086492
1292 Ga0495627_000224
1293 Ga0495627_000650
1294 Ga0495592_0055356
1295 Ga0495638_0004955
1296 Ga0495651_0046190
1297 Ga0495653_0041584
1298 Ga0495650_0001756
1299 Ga0495582_0063922
1300 Ga0495639_0048020
1301 Ga0495664_0039770
1302 Ga0495594_0075152
1303 Ga0495596_0006414
1304 Ga0495608_0089155
1305 Ga0495610_0001358
1306 Ga0495610_0006803
1307 Ga0495618_0023989
1308 Ga0495618_0105126
1309 Ga0495628_0096379
1310 Ga0495637_0026938
1311 Ga0495643_0000007
1312 Ga0495643_0062327
1313 Ga0495648_0007929
1314 Ga0495666_0007474
1315 Ga0495652_0049977
1316 Ga0495640_0051265
1317 Ga0495633_0041501
1318 Ga0495667_0038098
1319 Ga0495668_0118643
1320 Ga0495625_0000025
1321 Ga0495625_0000665
1322 Ga0495625_0001685
1323 Ga0495635_0036810
1324 Ga0495588_0035246
1325 Ga0495657_0037685
1326 Ga0495599_0000776
1327 Ga0495646_0035166
1328 Ga0495669_0000556
1329 Ga0495669_0037764
1330 Ga0495670_0000014
1331 Ga0495649_0012204
1332 Ga0495674_0056993
1333 Ga0495680_0032197
1334 Ga0495673_0000078
1335 Ga0495681_0000011
1336 Ga0495684_0099297
1337 Ga0495686_0000147
1338 Ga0495686_0000661
1339 Ga0495686_0121210
1340 Ga0495686_0185313
1341 Ga0496101_0073859
1342 Ga0496102_0275836
1343 Ga0496107_0032008
1344 Ga0496107_0136217
1345 Ga0496108_0033094
1346 Ga0496108_0316070
1347 Ga0496109_0180520
1348 Ga0496110_0076090
1349 Ga0496110_0130977
1350 Ga0496111_0146163
1351 Ga0496112_0027433
1352 Ga0496112_0042055
1353 Ga0496112_0182833
1354 Ga0496112_0210036
1355 Ga0496114_0090799
1356 Ga0496117_0021492
1357 Ga0496118_0001617
1358 Ga0496120_0161911
1359 Ga0496121_0000031
1360 Ga0496121_0003131
1361 Ga0496123_0002459
1362 Ga0496124_0015727
1363 Ga0496124_0142495
1364 Ga0501031_0059130
1365 Ga0501032_0053364
1366 Ga0501033_0014079
1367 Ga0501033_0054652
1368 Ga0501033_0151270
1369 Ga0501034_0005027
1370 Ga0501034_0482573
1371 Ga0501036_0282734
1372 Ga0501038_0015781
1373 Ga0501043_0020865
1374 Ga0501043_0047606
1375 Ga0501047_0001117
1376 Ga0501047_0013021
1377 Ga0501047_0040926
1378 Ga0501067_0109079
1379 Ga0501069_0036991
1380 Ga0501070_0000020
1381 Ga0501070_0061488
1382 Ga0501080_0011676
1383 Ga0501080_0075002
1384 Ga0501083_0006223
1385 Ga0501035_0006911
1386 Ga0501035_0088838
1387 Ga0501044_0014571
1388 Ga0501044_0020893
1389 Ga0501044_0078876
1390 Ga0501044_0097527
1391 Ga0501044_0202547
1392 Ga0501044_0211422
1393 nmdc:mga0k408_161782_c1
1394 nmdc:mga0k408_25112_c1
1395 nmdc:mga0k408_34852_c2
1396 nmdc:mga04h51_59395_c1
1397 nmdc:mga07m45_2_c1
1398 nmdc:mga06r32_145461_c1
1399 nmdc:mga08x19_143565_c1
1400 nmdc:mga0a205_5975_c1
1401 Ga0495601_0009915
1402 Ga0495601_0011636
1403 Ga0495595_0028222
1404 Ga0495619_0164263
1405 Ga0500641_0021781
1406 Ga0500562_002575
1407 Ga0500593_074444
1408 Ga0500597_024094
1409 Ga0500618_000514
1410 Ga0500559_0004706
1411 Ga0500559_0022361
1412 Ga0500616_0008861
1413 Ga0500622_0034813
1414 Ga0500624_000020
1415 Ga0500637_0000022
1416 Ga0501084_0000171
1417 2511120387
1418 2511130088
1419 2643924796
1420 2738745027
1421 2739354257
1422 2793978932
1423 2830076896
1424 2885430718
1425 2919514470
1426 2919678829
1427 2946789656
1428 8048137243

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

33

190

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

216

338

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9498 1 32
5y7a-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn 0.9496 2 31
6foy-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 9 0.9484 1 31
6foz-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 0.9482 2 31
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9391 2 31
ID Description Score Start End Superfamily
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 1 178 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 1 137 3.40.50.720
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 1 178 3.40.50.720
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9371 2 31 3.50.50.60
3rp8A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9309 2 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9956 1 115 GO:0004616
GO:0050661
AF-A0A0L0LZ89-F1-model_v4 deleted 0.9934 1 115
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9917 47 154 GO:0004616
GO:0050661
AF-A0A7W0X915-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.991 1 134 GO:0004616
GO:0050661
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9903 1 88 GO:0004616
GO:0050661

Map