F477121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 310 | 1428 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0265920|Ga0496102_0265920_485_1555 |
| Length | 356 |
| Sequence | MSATSRGSFCDSRNDLTETQASPEKYSKGNYMRLAMIGLGRMGGNIARRLMLGNHEIVAFDRDDGAVAELISEGATGADTLEDVVAKLNTPRIFWVMLPAGGPTQETVDRLIELAAPGDIIIDGGNSFYKDDITRAAAAREKQIHYVDVGTSGGVWGLDRGYCMMIGGDKETVDLLDPIFDTLAPGYGTIPRTPGRGTTDDRAERGYIHAGPNGAGHFVKMVHNGIEYGLMQAYAEGFDILKGKASEKLPAEERYDINLPDVAEVWRRGSVISSWLLDLCAIGLARDSMLEQFTGRVADSGEGRWTIDAAMEEAVPAHVLTAALFARYRSRVDTTFGDKLLSAMRFGFGGHVEMPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 199 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 200 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 201 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 202 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 203 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 204 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 290 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 294 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 296 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 297 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 300 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 301 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 302 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 303 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 304 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 305 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 306 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 307 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 308 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 309 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 310 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.3 |
| Nodule | 0 |
| Rhizoplane | 2.37 |
| Rhizosphere | 89.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0265920 | 3300048905 | Bacteria | 1617 |
| 2 | JGI24740J21852_10005372 | 3300001979 | Bacteria | 5427 |
| 3 | JGI24739J22299_10004790 | 3300001989 | Bacteria | 5167 |
| 4 | JGI24739J22299_10009552 | 3300001989 | Bacteria | 3611 |
| 5 | JGI24739J22299_10049772 | 3300001989 | Bacteria | 1357 |
| 6 | JGI24737J22298_10000687 | 3300001990 | Bacteria | 11875 |
| 7 | JGI24735J21928_10027297 | 3300002067 | Bacteria | 1711 |
| 8 | JGI24738J21930_10002091 | 3300002075 | Bacteria | 5342 |
| 9 | JGI24738J21930_10007677 | 3300002075 | Bacteria | 2478 |
| 10 | JGI25150J39212_1000020 | 3300002774 | Bacteria | 134928 |
| 11 | JGI25151J46595_10055943 | 3300003187 | Bacteria | 1297 |
| 12 | JGI25153J46596_10000017 | 3300003215 | Bacteria | 274325 |
| 13 | rootH2_10075661 | 3300003320 | Bacteria | 6877 |
| 14 | Ga0055536_1011158 | 3300003781 | Bacteria | 3484 |
| 15 | Ga0055530_10016424 | 3300003791 | Bacteria | 2365 |
| 16 | Ga0055540_1005503 | 3300003792 | Bacteria | 5300 |
| 17 | Ga0065165_1000625 | 3300005262 | Bacteria | 51321 |
| 18 | Ga0065714_10109070 | 3300005288 | Bacteria | 1505 |
| 19 | Ga0070658_10008641 | 3300005327 | Bacteria | 8186 |
| 20 | Ga0070658_10038050 | 3300005327 | Bacteria | 3880 |
| 21 | Ga0070658_10040306 | 3300005327 | Bacteria | 3767 |
| 22 | Ga0070658_10222296 | 3300005327 | Bacteria | 1597 |
| 23 | Ga0070658_10246114 | 3300005327 | Bacteria | 1516 |
| 24 | Ga0070658_10318277 | 3300005327 | Bacteria | 1328 |
| 25 | Ga0070676_10004172 | 3300005328 | Bacteria | 7587 |
| 26 | Ga0070683_100025567 | 3300005329 | Bacteria | 5304 |
| 27 | Ga0070683_100218535 | 3300005329 | Bacteria | 1811 |
| 28 | Ga0070690_100091417 | 3300005330 | Bacteria | 2005 |
| 29 | Ga0070670_100016900 | 3300005331 | Bacteria | 6263 |
| 30 | Ga0070670_100025510 | 3300005331 | Bacteria | 5085 |
| 31 | Ga0068869_100003116 | 3300005334 | Bacteria | 10111 |
| 32 | Ga0070666_10062831 | 3300005335 | Bacteria | 2517 |
| 33 | Ga0070680_100000777 | 3300005336 | Bacteria | 22371 |
| 34 | Ga0070680_100001609 | 3300005336 | Bacteria | 16497 |
| 35 | Ga0070680_100008701 | 3300005336 | Bacteria | 7780 |
| 36 | Ga0070680_100255725 | 3300005336 | Bacteria | 1481 |
| 37 | Ga0070680_100310653 | 3300005336 | Bacteria | 1337 |
| 38 | Ga0070682_100035315 | 3300005337 | Bacteria | 3051 |
| 39 | Ga0068868_100011184 | 3300005338 | Bacteria | 6534 |
| 40 | Ga0070660_100003291 | 3300005339 | Bacteria | 11105 |
| 41 | Ga0070660_100004065 | 3300005339 | Bacteria | 10092 |
| 42 | Ga0070660_100017639 | 3300005339 | Bacteria | 5205 |
| 43 | Ga0070660_100029155 | 3300005339 | Bacteria | 4133 |
| 44 | Ga0070660_100047766 | 3300005339 | Bacteria | 3285 |
| 45 | Ga0070660_100160963 | 3300005339 | Bacteria | 1809 |
| 46 | Ga0070660_100186491 | 3300005339 | Bacteria | 1679 |
| 47 | Ga0070660_100266557 | 3300005339 | Bacteria | 1399 |
| 48 | Ga0070660_100310240 | 3300005339 | Bacteria | 1294 |
| 49 | Ga0070660_100362680 | 3300005339 | Bacteria | 1194 |
| 50 | Ga0070691_10008548 | 3300005341 | Bacteria | 4688 |
| 51 | Ga0070691_10123756 | 3300005341 | Bacteria | 1304 |
| 52 | Ga0070661_100001494 | 3300005344 | Bacteria | 16268 |
| 53 | Ga0070661_100040130 | 3300005344 | Bacteria | 3413 |
| 54 | Ga0070661_100061923 | 3300005344 | Bacteria | 2747 |
| 55 | Ga0070661_100108664 | 3300005344 | Bacteria | 2070 |
| 56 | Ga0070661_100169133 | 3300005344 | Bacteria | 1659 |
| 57 | Ga0070661_100182187 | 3300005344 | Bacteria | 1598 |
| 58 | Ga0070692_10041405 | 3300005345 | Bacteria | 2360 |
| 59 | Ga0070668_100043360 | 3300005347 | Bacteria | 3450 |
| 60 | Ga0070669_100000138 | 3300005353 | Bacteria | 65433 |
| 61 | Ga0070669_100041151 | 3300005353 | Bacteria | 3360 |
| 62 | Ga0070675_100021410 | 3300005354 | Bacteria | 5167 |
| 63 | Ga0070671_100021780 | 3300005355 | Bacteria | 5235 |
| 64 | Ga0070671_100027056 | 3300005355 | Bacteria | 4718 |
| 65 | Ga0070671_100104838 | 3300005355 | Bacteria | 2373 |
| 66 | Ga0070671_100232034 | 3300005355 | Bacteria | 1566 |
| 67 | Ga0070674_100033254 | 3300005356 | Bacteria | 3431 |
| 68 | Ga0070673_100002586 | 3300005364 | Bacteria | 11053 |
| 69 | Ga0070673_100004948 | 3300005364 | Bacteria | 8490 |
| 70 | Ga0070659_100001040 | 3300005366 | Bacteria | 20295 |
| 71 | Ga0070659_100003697 | 3300005366 | Bacteria | 10913 |
| 72 | Ga0070659_100007325 | 3300005366 | Bacteria | 8015 |
| 73 | Ga0070659_100015988 | 3300005366 | Bacteria | 5628 |
| 74 | Ga0070659_100027275 | 3300005366 | Bacteria | 4400 |
| 75 | Ga0070659_100065256 | 3300005366 | Bacteria | 2883 |
| 76 | Ga0070659_100075317 | 3300005366 | Bacteria | 2690 |
| 77 | Ga0070659_100112163 | 3300005366 | Bacteria | 2202 |
| 78 | Ga0070667_100047812 | 3300005367 | Bacteria | 3600 |
| 79 | Ga0070667_100227132 | 3300005367 | Bacteria | 1663 |
| 80 | Ga0070709_10202436 | 3300005434 | Bacteria | 1407 |
| 81 | Ga0070694_100020574 | 3300005444 | Bacteria | 4209 |
| 82 | Ga0070663_100048900 | 3300005455 | Bacteria | 3001 |
| 83 | Ga0070663_100109285 | 3300005455 | Bacteria | 2076 |
| 84 | Ga0070663_100276188 | 3300005455 | Bacteria | 1337 |
| 85 | Ga0070663_100398467 | 3300005455 | Bacteria | 1124 |
| 86 | Ga0070662_100001837 | 3300005457 | Bacteria | 13006 |
| 87 | Ga0070662_100001928 | 3300005457 | Bacteria | 12750 |
| 88 | Ga0070662_100080350 | 3300005457 | Bacteria | 2427 |
| 89 | Ga0070681_10006985 | 3300005458 | Bacteria | 10988 |
| 90 | Ga0070681_10093219 | 3300005458 | Bacteria | 2960 |
| 91 | Ga0070681_10113562 | 3300005458 | Bacteria | 2648 |
| 92 | Ga0070681_10315254 | 3300005458 | Bacteria | 1473 |
| 93 | Ga0070681_10332708 | 3300005458 | Bacteria | 1428 |
| 94 | Ga0068867_100010664 | 3300005459 | Bacteria | 6482 |
| 95 | Ga0068867_100016740 | 3300005459 | Bacteria | 5209 |
| 96 | Ga0070698_100063579 | 3300005471 | Bacteria | 3721 |
| 97 | Ga0070679_100004635 | 3300005530 | Bacteria | 12688 |
| 98 | Ga0070679_100075528 | 3300005530 | Bacteria | 3359 |
| 99 | Ga0070679_100077512 | 3300005530 | Bacteria | 3313 |
| 100 | Ga0070679_100320061 | 3300005530 | Bacteria | 1500 |
| 101 | Ga0070679_100330242 | 3300005530 | Bacteria | 1473 |
| 102 | Ga0070679_100419467 | 3300005530 | Bacteria | 1284 |
| 103 | Ga0070679_100479188 | 3300005530 | Bacteria | 1188 |
| 104 | Ga0070684_100027737 | 3300005535 | Bacteria | 4783 |
| 105 | Ga0070684_100124210 | 3300005535 | Bacteria | 2324 |
| 106 | Ga0070684_100345018 | 3300005535 | Bacteria | 1369 |
| 107 | Ga0070697_100000139 | 3300005536 | Bacteria | 58838 |
| 108 | Ga0070697_100018866 | 3300005536 | Bacteria | 5443 |
| 109 | Ga0068853_100004994 | 3300005539 | Bacteria | 10339 |
| 110 | Ga0068853_100027359 | 3300005539 | Bacteria | 4791 |
| 111 | Ga0068853_100027704 | 3300005539 | Bacteria | 4762 |
| 112 | Ga0068853_100033891 | 3300005539 | Bacteria | 4333 |
| 113 | Ga0068853_100113339 | 3300005539 | Bacteria | 2411 |
| 114 | Ga0068853_100116126 | 3300005539 | Bacteria | 2383 |
| 115 | Ga0068853_100134100 | 3300005539 | Bacteria | 2219 |
| 116 | Ga0070672_100000868 | 3300005543 | Bacteria | 18094 |
| 117 | Ga0070693_100284404 | 3300005547 | Bacteria | 1109 |
| 118 | Ga0070665_100000380 | 3300005548 | Bacteria | 65676 |
| 119 | Ga0070665_100138367 | 3300005548 | Bacteria | 2438 |
| 120 | Ga0068855_100001148 | 3300005563 | Bacteria | 32786 |
| 121 | Ga0068855_100008821 | 3300005563 | Bacteria | 12188 |
| 122 | Ga0068855_100010741 | 3300005563 | Bacteria | 11051 |
| 123 | Ga0068855_100394571 | 3300005563 | Bacteria | 1517 |
| 124 | Ga0068855_100395925 | 3300005563 | Bacteria | 1514 |
| 125 | Ga0068855_100709803 | 3300005563 | Bacteria | 1075 |
| 126 | Ga0070664_100002792 | 3300005564 | Bacteria | 14105 |
| 127 | Ga0070664_100004946 | 3300005564 | Bacteria | 10677 |
| 128 | Ga0070664_100006300 | 3300005564 | Bacteria | 9572 |
| 129 | Ga0070664_100043512 | 3300005564 | Bacteria | 3789 |
| 130 | Ga0070664_100057463 | 3300005564 | Bacteria | 3307 |
| 131 | Ga0068857_100007132 | 3300005577 | Bacteria | 9625 |
| 132 | Ga0068857_100021844 | 3300005577 | Bacteria | 5631 |
| 133 | Ga0068857_100041994 | 3300005577 | Bacteria | 4055 |
| 134 | Ga0068857_100107278 | 3300005577 | Bacteria | 2508 |
| 135 | Ga0068857_100135940 | 3300005577 | Bacteria | 2219 |
| 136 | Ga0068857_100189409 | 3300005577 | Bacteria | 1873 |
| 137 | Ga0068857_100313261 | 3300005577 | Bacteria | 1448 |
| 138 | Ga0068854_100005266 | 3300005578 | Bacteria | 8161 |
| 139 | Ga0068854_100014636 | 3300005578 | Bacteria | 5176 |
| 140 | Ga0068854_100072173 | 3300005578 | Bacteria | 2527 |
| 141 | Ga0068854_100072875 | 3300005578 | Bacteria | 2516 |
| 142 | Ga0068854_100240021 | 3300005578 | Bacteria | 1443 |
| 143 | Ga0068856_100009932 | 3300005614 | Bacteria | 9245 |
| 144 | Ga0068856_100047053 | 3300005614 | Bacteria | 4249 |
| 145 | Ga0068856_100057631 | 3300005614 | Bacteria | 3835 |
| 146 | Ga0068856_100347459 | 3300005614 | Bacteria | 1502 |
| 147 | Ga0068856_100618558 | 3300005614 | Bacteria | 1104 |
| 148 | Ga0068852_100000946 | 3300005616 | Bacteria | 19100 |
| 149 | Ga0068852_100005893 | 3300005616 | Bacteria | 8811 |
| 150 | Ga0068852_100018079 | 3300005616 | Bacteria | 5546 |
| 151 | Ga0068852_100102314 | 3300005616 | Bacteria | 2588 |
| 152 | Ga0068852_100112815 | 3300005616 | Bacteria | 2474 |
| 153 | Ga0068852_100125607 | 3300005616 | Bacteria | 2355 |
| 154 | Ga0068852_100225606 | 3300005616 | Bacteria | 1784 |
| 155 | Ga0068852_100505068 | 3300005616 | Bacteria | 1204 |
| 156 | Ga0068859_100000550 | 3300005617 | Bacteria | 37222 |
| 157 | Ga0068859_100006426 | 3300005617 | Bacteria | 11926 |
| 158 | Ga0068859_100073328 | 3300005617 | Bacteria | 3461 |
| 159 | Ga0068859_100155178 | 3300005617 | Bacteria | 2366 |
| 160 | Ga0068864_100003528 | 3300005618 | Bacteria | 12934 |
| 161 | Ga0068864_100005190 | 3300005618 | Bacteria | 10669 |
| 162 | Ga0068851_10012796 | 3300005834 | Bacteria | 3963 |
| 163 | Ga0068851_10014173 | 3300005834 | Bacteria | 3782 |
| 164 | Ga0068863_100004087 | 3300005841 | Bacteria | 14417 |
| 165 | Ga0068863_100009309 | 3300005841 | Bacteria | 9584 |
| 166 | Ga0068863_100048341 | 3300005841 | Bacteria | 4034 |
| 167 | Ga0068863_100226573 | 3300005841 | Bacteria | 1802 |
| 168 | Ga0068858_100002589 | 3300005842 | Bacteria | 18214 |
| 169 | Ga0068858_100004956 | 3300005842 | Bacteria | 13043 |
| 170 | Ga0068858_100023934 | 3300005842 | Bacteria | 5690 |
| 171 | Ga0068858_100025161 | 3300005842 | Bacteria | 5539 |
| 172 | Ga0068858_100235315 | 3300005842 | Bacteria | 1737 |
| 173 | Ga0068860_100004406 | 3300005843 | Bacteria | 14383 |
| 174 | Ga0068860_100006884 | 3300005843 | Bacteria | 11399 |
| 175 | Ga0068860_100284558 | 3300005843 | Bacteria | 1616 |
| 176 | Ga0068862_100006635 | 3300005844 | Bacteria | 9599 |
| 177 | Ga0068862_100021749 | 3300005844 | Bacteria | 5364 |
| 178 | Ga0081538_10018384 | 3300005981 | Bacteria | 5251 |
| 179 | Ga0075368_10087558 | 3300006042 | Bacteria | 1272 |
| 180 | Ga0070712_100185284 | 3300006175 | Bacteria | 1625 |
| 181 | Ga0075366_10026901 | 3300006195 | Bacteria | 3372 |
| 182 | Ga0075366_10067766 | 3300006195 | Bacteria | 2124 |
| 183 | Ga0075366_10180035 | 3300006195 | Bacteria | 1284 |
| 184 | Ga0075370_10000001 | 3300006353 | Bacteria | 239876 |
| 185 | Ga0068871_100405905 | 3300006358 | Bacteria | 1214 |
| 186 | Ga0075428_100131976 | 3300006844 | Bacteria | 2716 |
| 187 | Ga0075431_100288808 | 3300006847 | Bacteria | 1660 |
| 188 | Ga0075433_10010202 | 3300006852 | Bacteria | 7533 |
| 189 | Ga0068865_100005976 | 3300006881 | Bacteria | 7418 |
| 190 | Ga0097620_100000550 | 3300006931 | Bacteria | 37222 |
| 191 | Ga0097620_100006426 | 3300006931 | Bacteria | 11926 |
| 192 | Ga0097620_100073329 | 3300006931 | Bacteria | 3461 |
| 193 | Ga0097620_100155181 | 3300006931 | Bacteria | 2366 |
| 194 | Ga0105240_10010679 | 3300009093 | Bacteria | 12886 |
| 195 | Ga0105240_10015147 | 3300009093 | Bacteria | 10494 |
| 196 | Ga0105240_10018070 | 3300009093 | Bacteria | 9481 |
| 197 | Ga0105240_10065883 | 3300009093 | Bacteria | 4495 |
| 198 | Ga0105240_10085276 | 3300009093 | Bacteria | 3870 |
| 199 | Ga0105240_10150136 | 3300009093 | Bacteria | 2776 |
| 200 | Ga0105245_10000198 | 3300009098 | Bacteria | 57372 |
| 201 | Ga0105245_10063705 | 3300009098 | Bacteria | 3330 |
| 202 | Ga0105247_10018070 | 3300009101 | Bacteria | 4229 |
| 203 | Ga0105243_10010602 | 3300009148 | Bacteria | 6996 |
| 204 | Ga0105243_10298211 | 3300009148 | Bacteria | 1460 |
| 205 | Ga0105241_10027469 | 3300009174 | Bacteria | 4239 |
| 206 | Ga0105241_10284753 | 3300009174 | Bacteria | 1413 |
| 207 | Ga0105248_10000391 | 3300009177 | Bacteria | 50565 |
| 208 | Ga0105248_10031695 | 3300009177 | Bacteria | 5906 |
| 209 | Ga0105237_10243467 | 3300009545 | Bacteria | 1800 |
| 210 | Ga0105238_10007731 | 3300009551 | Bacteria | 10750 |
| 211 | Ga0105238_10014401 | 3300009551 | Bacteria | 7994 |
| 212 | Ga0105238_10052170 | 3300009551 | Bacteria | 4112 |
| 213 | Ga0105239_10053714 | 3300010375 | Bacteria | 4419 |
| 214 | Ga0105239_10477424 | 3300010375 | Bacteria | 1416 |
| 215 | Ga0105239_10732565 | 3300010375 | Bacteria | 1131 |
| 216 | Ga0105246_10073297 | 3300011119 | Bacteria | 2417 |
| 217 | Ga0105246_10368332 | 3300011119 | Bacteria | 1183 |
| 218 | Ga0157373_10010344 | 3300013100 | Bacteria | 6869 |
| 219 | Ga0157373_10031653 | 3300013100 | Bacteria | 3807 |
| 220 | Ga0157373_10076574 | 3300013100 | Bacteria | 2360 |
| 221 | Ga0157373_10081004 | 3300013100 | Bacteria | 2289 |
| 222 | Ga0157373_10142136 | 3300013100 | Bacteria | 1688 |
| 223 | Ga0157371_10002789 | 3300013102 | Bacteria | 16391 |
| 224 | Ga0157371_10002797 | 3300013102 | Bacteria | 16362 |
| 225 | Ga0157371_10293365 | 3300013102 | Bacteria | 1176 |
| 226 | Ga0157370_10006108 | 3300013104 | Bacteria | 13365 |
| 227 | Ga0157370_10025395 | 3300013104 | Bacteria | 5864 |
| 228 | Ga0157370_10032238 | 3300013104 | Bacteria | 5118 |
| 229 | Ga0157370_10069403 | 3300013104 | Bacteria | 3329 |
| 230 | Ga0157370_10097207 | 3300013104 | Bacteria | 2762 |
| 231 | Ga0157370_10130551 | 3300013104 | Bacteria | 2343 |
| 232 | Ga0157370_10204812 | 3300013104 | Bacteria | 1830 |
| 233 | Ga0157370_10284948 | 3300013104 | Bacteria | 1526 |
| 234 | Ga0157370_10295723 | 3300013104 | Bacteria | 1495 |
| 235 | Ga0157370_10349859 | 3300013104 | Bacteria | 1362 |
| 236 | Ga0157369_10002441 | 3300013105 | Bacteria | 22331 |
| 237 | Ga0157369_10007310 | 3300013105 | Bacteria | 12712 |
| 238 | Ga0157369_10085210 | 3300013105 | Bacteria | 3377 |
| 239 | Ga0157369_10098789 | 3300013105 | Bacteria | 3112 |
| 240 | Ga0157369_10102744 | 3300013105 | Bacteria | 3045 |
| 241 | Ga0157369_10290820 | 3300013105 | Bacteria | 1701 |
| 242 | Ga0157369_10504471 | 3300013105 | Bacteria | 1252 |
| 243 | Ga0157374_10086272 | 3300013296 | Bacteria | 2986 |
| 244 | Ga0157378_10001311 | 3300013297 | Bacteria | 22380 |
| 245 | Ga0157378_10437162 | 3300013297 | Bacteria | 1296 |
| 246 | Ga0163162_10064438 | 3300013306 | Bacteria | 3710 |
| 247 | Ga0163162_10072048 | 3300013306 | Bacteria | 3509 |
| 248 | Ga0163162_10122274 | 3300013306 | Bacteria | 2708 |
| 249 | Ga0163162_10511373 | 3300013306 | Bacteria | 1331 |
| 250 | Ga0157372_10003571 | 3300013307 | Bacteria | 16739 |
| 251 | Ga0157372_10012201 | 3300013307 | Bacteria | 9153 |
| 252 | Ga0157372_10244011 | 3300013307 | Bacteria | 2084 |
| 253 | Ga0157375_10026969 | 3300013308 | Bacteria | 5363 |
| 254 | Ga0157375_10100575 | 3300013308 | Bacteria | 2972 |
| 255 | Ga0163163_10003435 | 3300014325 | Bacteria | 13462 |
| 256 | Ga0157377_10022379 | 3300014745 | Bacteria | 3336 |
| 257 | Ga0157379_10006683 | 3300014968 | Bacteria | 9959 |
| 258 | Ga0206353_10434619 | 3300020082 | Bacteria | 3038 |
| 259 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 260 | Ga0209129_1000286 | 3300025258 | Bacteria | 48191 |
| 261 | Ga0209233_1013690 | 3300025261 | Bacteria | 2311 |
| 262 | Ga0209676_1009141 | 3300025292 | Bacteria | 4313 |
| 263 | Ga0209025_1001464 | 3300025294 | Bacteria | 30863 |
| 264 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 265 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 266 | Ga0209051_1000246 | 3300025303 | Bacteria | 91170 |
| 267 | Ga0209257_1011642 | 3300025304 | Bacteria | 4200 |
| 268 | Ga0207697_10000297 | 3300025315 | Bacteria | 27757 |
| 269 | Ga0207656_10008833 | 3300025321 | Bacteria | 3728 |
| 270 | Ga0207656_10013262 | 3300025321 | Bacteria | 3145 |
| 271 | Ga0207656_10026133 | 3300025321 | Bacteria | 2377 |
| 272 | Ga0207688_10000214 | 3300025901 | Bacteria | 25912 |
| 273 | Ga0207647_10000450 | 3300025904 | Bacteria | 33415 |
| 274 | Ga0207647_10000550 | 3300025904 | Bacteria | 29810 |
| 275 | Ga0207647_10001333 | 3300025904 | Bacteria | 18966 |
| 276 | Ga0207647_10051388 | 3300025904 | Bacteria | 2548 |
| 277 | Ga0207699_10175992 | 3300025906 | Bacteria | 1435 |
| 278 | Ga0207645_10047073 | 3300025907 | Bacteria | 2754 |
| 279 | Ga0207705_10000647 | 3300025909 | Bacteria | 28998 |
| 280 | Ga0207705_10000733 | 3300025909 | Bacteria | 27069 |
| 281 | Ga0207705_10012679 | 3300025909 | Bacteria | 6083 |
| 282 | Ga0207705_10016400 | 3300025909 | Bacteria | 5311 |
| 283 | Ga0207705_10021334 | 3300025909 | Bacteria | 4621 |
| 284 | Ga0207705_10036186 | 3300025909 | Bacteria | 3533 |
| 285 | Ga0207705_10038781 | 3300025909 | Bacteria | 3413 |
| 286 | Ga0207705_10043296 | 3300025909 | Bacteria | 3234 |
| 287 | Ga0207705_10044634 | 3300025909 | Bacteria | 3185 |
| 288 | Ga0207654_10129313 | 3300025911 | Bacteria | 1596 |
| 289 | Ga0207707_10004869 | 3300025912 | Bacteria | 11785 |
| 290 | Ga0207707_10012471 | 3300025912 | Bacteria | 7389 |
| 291 | Ga0207707_10031408 | 3300025912 | Bacteria | 4648 |
| 292 | Ga0207707_10271783 | 3300025912 | Bacteria | 1469 |
| 293 | Ga0207695_10024131 | 3300025913 | Bacteria | 6851 |
| 294 | Ga0207695_10048907 | 3300025913 | Bacteria | 4461 |
| 295 | Ga0207695_10105071 | 3300025913 | Bacteria | 2812 |
| 296 | Ga0207695_10292239 | 3300025913 | Bacteria | 1522 |
| 297 | Ga0207695_10458431 | 3300025913 | Bacteria | 1158 |
| 298 | Ga0207693_10067961 | 3300025915 | Bacteria | 2790 |
| 299 | Ga0207660_10000720 | 3300025917 | Bacteria | 22059 |
| 300 | Ga0207660_10000753 | 3300025917 | Bacteria | 21519 |
| 301 | Ga0207660_10002930 | 3300025917 | Bacteria | 11151 |
| 302 | Ga0207660_10002951 | 3300025917 | Bacteria | 11121 |
| 303 | Ga0207660_10004462 | 3300025917 | Bacteria | 9124 |
| 304 | Ga0207660_10026504 | 3300025917 | Bacteria | 3948 |
| 305 | Ga0207660_10400218 | 3300025917 | Bacteria | 1106 |
| 306 | Ga0207657_10002019 | 3300025919 | Bacteria | 21940 |
| 307 | Ga0207657_10002443 | 3300025919 | Bacteria | 20074 |
| 308 | Ga0207657_10003486 | 3300025919 | Bacteria | 16785 |
| 309 | Ga0207657_10003530 | 3300025919 | Bacteria | 16704 |
| 310 | Ga0207657_10009031 | 3300025919 | Bacteria | 10066 |
| 311 | Ga0207657_10010446 | 3300025919 | Bacteria | 9265 |
| 312 | Ga0207657_10011217 | 3300025919 | Bacteria | 8909 |
| 313 | Ga0207657_10016702 | 3300025919 | Bacteria | 7071 |
| 314 | Ga0207657_10028287 | 3300025919 | Bacteria | 5116 |
| 315 | Ga0207657_10065052 | 3300025919 | Bacteria | 3110 |
| 316 | Ga0207657_10296054 | 3300025919 | Bacteria | 1282 |
| 317 | Ga0207657_10317974 | 3300025919 | Bacteria | 1231 |
| 318 | Ga0207649_10008370 | 3300025920 | Bacteria | 5637 |
| 319 | Ga0207649_10010422 | 3300025920 | Bacteria | 5107 |
| 320 | Ga0207649_10021475 | 3300025920 | Bacteria | 3717 |
| 321 | Ga0207649_10028353 | 3300025920 | Bacteria | 3296 |
| 322 | Ga0207649_10056575 | 3300025920 | Bacteria | 2450 |
| 323 | Ga0207652_10001317 | 3300025921 | Bacteria | 22056 |
| 324 | Ga0207652_10002779 | 3300025921 | Bacteria | 14710 |
| 325 | Ga0207652_10052952 | 3300025921 | Bacteria | 3486 |
| 326 | Ga0207652_10115640 | 3300025921 | Bacteria | 2383 |
| 327 | Ga0207652_10287960 | 3300025921 | Bacteria | 1482 |
| 328 | Ga0207646_10162553 | 3300025922 | Bacteria | 2015 |
| 329 | Ga0207681_10002797 | 3300025923 | Bacteria | 11046 |
| 330 | Ga0207681_10045621 | 3300025923 | Bacteria | 2944 |
| 331 | Ga0207694_10001010 | 3300025924 | Bacteria | 24549 |
| 332 | Ga0207694_10009321 | 3300025924 | Bacteria | 7406 |
| 333 | Ga0207694_10102113 | 3300025924 | Bacteria | 2273 |
| 334 | Ga0207659_10011048 | 3300025926 | Bacteria | 5691 |
| 335 | Ga0207659_10277564 | 3300025926 | Bacteria | 1369 |
| 336 | Ga0207687_10004719 | 3300025927 | Bacteria | 9067 |
| 337 | Ga0207644_10021354 | 3300025931 | Bacteria | 4409 |
| 338 | Ga0207644_10021704 | 3300025931 | Bacteria | 4378 |
| 339 | Ga0207644_10028811 | 3300025931 | Bacteria | 3848 |
| 340 | Ga0207644_10067500 | 3300025931 | Bacteria | 2607 |
| 341 | Ga0207644_10178978 | 3300025931 | Bacteria | 1661 |
| 342 | Ga0207690_10004314 | 3300025932 | Bacteria | 8395 |
| 343 | Ga0207690_10004900 | 3300025932 | Bacteria | 7896 |
| 344 | Ga0207690_10031546 | 3300025932 | Bacteria | 3392 |
| 345 | Ga0207690_10061653 | 3300025932 | Bacteria | 2550 |
| 346 | Ga0207690_10069839 | 3300025932 | Bacteria | 2418 |
| 347 | Ga0207690_10174621 | 3300025932 | Bacteria | 1612 |
| 348 | Ga0207690_10247107 | 3300025932 | Bacteria | 1376 |
| 349 | Ga0207706_10001953 | 3300025933 | Bacteria | 20227 |
| 350 | Ga0207706_10002890 | 3300025933 | Bacteria | 16629 |
| 351 | Ga0207706_10019463 | 3300025933 | Bacteria | 6107 |
| 352 | Ga0207706_10109711 | 3300025933 | Bacteria | 2428 |
| 353 | Ga0207709_10069381 | 3300025935 | Bacteria | 2231 |
| 354 | Ga0207709_10101297 | 3300025935 | Bacteria | 1905 |
| 355 | Ga0207669_10052976 | 3300025937 | Bacteria | 2441 |
| 356 | Ga0207704_10043071 | 3300025938 | Bacteria | 2662 |
| 357 | Ga0207691_10000047 | 3300025940 | Bacteria | 99519 |
| 358 | Ga0207691_10073755 | 3300025940 | Bacteria | 3078 |
| 359 | Ga0207691_10228695 | 3300025940 | Bacteria | 1611 |
| 360 | Ga0207711_10001028 | 3300025941 | Bacteria | 26716 |
| 361 | Ga0207711_10003195 | 3300025941 | Bacteria | 14296 |
| 362 | Ga0207711_10003281 | 3300025941 | Bacteria | 14062 |
| 363 | Ga0207689_10000002 | 3300025942 | Bacteria | 198437 |
| 364 | Ga0207689_10014038 | 3300025942 | Bacteria | 6819 |
| 365 | Ga0207661_10047494 | 3300025944 | Bacteria | 3409 |
| 366 | Ga0207661_10322527 | 3300025944 | Bacteria | 1389 |
| 367 | Ga0207679_10034440 | 3300025945 | Bacteria | 3573 |
| 368 | Ga0207679_10058928 | 3300025945 | Bacteria | 2848 |
| 369 | Ga0207667_10004932 | 3300025949 | Bacteria | 16295 |
| 370 | Ga0207667_10007513 | 3300025949 | Bacteria | 13084 |
| 371 | Ga0207667_10015484 | 3300025949 | Bacteria | 8660 |
| 372 | Ga0207667_10017570 | 3300025949 | Bacteria | 8045 |
| 373 | Ga0207667_10029561 | 3300025949 | Bacteria | 5941 |
| 374 | Ga0207667_10051008 | 3300025949 | Bacteria | 4363 |
| 375 | Ga0207667_10061822 | 3300025949 | Bacteria | 3917 |
| 376 | Ga0207651_10010367 | 3300025960 | Bacteria | 5162 |
| 377 | Ga0207651_10027820 | 3300025960 | Bacteria | 3557 |
| 378 | Ga0207651_10254231 | 3300025960 | Bacteria | 1439 |
| 379 | Ga0207712_10000969 | 3300025961 | Bacteria | 20659 |
| 380 | Ga0207712_10095457 | 3300025961 | Bacteria | 2199 |
| 381 | Ga0207668_10113779 | 3300025972 | Bacteria | 2035 |
| 382 | Ga0207640_10010650 | 3300025981 | Bacteria | 5186 |
| 383 | Ga0207640_10024071 | 3300025981 | Bacteria | 3668 |
| 384 | Ga0207640_10283999 | 3300025981 | Bacteria | 1301 |
| 385 | Ga0207658_10003561 | 3300025986 | Bacteria | 10994 |
| 386 | Ga0207658_10023648 | 3300025986 | Bacteria | 4291 |
| 387 | Ga0207658_10230416 | 3300025986 | Bacteria | 1563 |
| 388 | Ga0207677_10361972 | 3300026023 | Bacteria | 1219 |
| 389 | Ga0207703_10002189 | 3300026035 | Bacteria | 17150 |
| 390 | Ga0207703_10030569 | 3300026035 | Bacteria | 4258 |
| 391 | Ga0207703_10065739 | 3300026035 | Bacteria | 2981 |
| 392 | Ga0207703_10204788 | 3300026035 | Bacteria | 1755 |
| 393 | Ga0207639_10000181 | 3300026041 | Bacteria | 49444 |
| 394 | Ga0207639_10002813 | 3300026041 | Bacteria | 11673 |
| 395 | Ga0207639_10013429 | 3300026041 | Bacteria | 5733 |
| 396 | Ga0207639_10014834 | 3300026041 | Bacteria | 5488 |
| 397 | Ga0207639_10028477 | 3300026041 | Bacteria | 4079 |
| 398 | Ga0207639_10030303 | 3300026041 | Bacteria | 3967 |
| 399 | Ga0207639_10088370 | 3300026041 | Bacteria | 2473 |
| 400 | Ga0207639_10111414 | 3300026041 | Bacteria | 2231 |
| 401 | Ga0207678_10001895 | 3300026067 | Bacteria | 19090 |
| 402 | Ga0207678_10003129 | 3300026067 | Bacteria | 14975 |
| 403 | Ga0207678_10047684 | 3300026067 | Bacteria | 3704 |
| 404 | Ga0207678_10061702 | 3300026067 | Bacteria | 3224 |
| 405 | Ga0207678_10062991 | 3300026067 | Bacteria | 3187 |
| 406 | Ga0207678_10172896 | 3300026067 | Bacteria | 1844 |
| 407 | Ga0207702_10025964 | 3300026078 | Bacteria | 4863 |
| 408 | Ga0207702_10031490 | 3300026078 | Bacteria | 4420 |
| 409 | Ga0207702_10045727 | 3300026078 | Bacteria | 3683 |
| 410 | Ga0207702_10196823 | 3300026078 | Bacteria | 1866 |
| 411 | Ga0207702_10314046 | 3300026078 | Bacteria | 1491 |
| 412 | Ga0207641_10000761 | 3300026088 | Bacteria | 34699 |
| 413 | Ga0207641_10002113 | 3300026088 | Bacteria | 18795 |
| 414 | Ga0207648_10001403 | 3300026089 | Bacteria | 26509 |
| 415 | Ga0207648_10017420 | 3300026089 | Bacteria | 6538 |
| 416 | Ga0207648_10048809 | 3300026089 | Bacteria | 3706 |
| 417 | Ga0207676_10000731 | 3300026095 | Bacteria | 25737 |
| 418 | Ga0207676_10012400 | 3300026095 | Bacteria | 6106 |
| 419 | Ga0207676_10565241 | 3300026095 | Bacteria | 1088 |
| 420 | Ga0207674_10000850 | 3300026116 | Bacteria | 39849 |
| 421 | Ga0207674_10011911 | 3300026116 | Bacteria | 9750 |
| 422 | Ga0207674_10012448 | 3300026116 | Bacteria | 9507 |
| 423 | Ga0207674_10016271 | 3300026116 | Bacteria | 8146 |
| 424 | Ga0207674_10035053 | 3300026116 | Bacteria | 5238 |
| 425 | Ga0207674_10036991 | 3300026116 | Bacteria | 5080 |
| 426 | Ga0207674_10054898 | 3300026116 | Bacteria | 4053 |
| 427 | Ga0207674_10422338 | 3300026116 | Bacteria | 1288 |
| 428 | Ga0207683_10115678 | 3300026121 | Bacteria | 2404 |
| 429 | Ga0207698_10006372 | 3300026142 | Bacteria | 7355 |
| 430 | Ga0207698_10009246 | 3300026142 | Bacteria | 6272 |
| 431 | Ga0207698_10046586 | 3300026142 | Bacteria | 3276 |
| 432 | Ga0207698_10050609 | 3300026142 | Bacteria | 3170 |
| 433 | Ga0207698_10069575 | 3300026142 | Bacteria | 2784 |
| 434 | Ga0207698_10093468 | 3300026142 | Bacteria | 2469 |
| 435 | Ga0207698_10147759 | 3300026142 | Bacteria | 2035 |
| 436 | Ga0207698_10319786 | 3300026142 | Bacteria | 1453 |
| 437 | Ga0209813_10005352 | 3300027866 | Bacteria | 3109 |
| 438 | Ga0268266_10000256 | 3300028379 | Bacteria | 89436 |
| 439 | Ga0268266_10102025 | 3300028379 | Bacteria | 2530 |
| 440 | Ga0268265_10007223 | 3300028380 | Bacteria | 7505 |
| 441 | Ga0268265_10047457 | 3300028380 | Bacteria | 3218 |
| 442 | Ga0268265_10232819 | 3300028380 | Bacteria | 1620 |
| 443 | Ga0268265_10245348 | 3300028380 | Bacteria | 1583 |
| 444 | Ga0268264_10000755 | 3300028381 | Bacteria | 36243 |
| 445 | Ga0268264_10032295 | 3300028381 | Bacteria | 4295 |
| 446 | Ga0265318_10069592 | 3300028577 | Bacteria | 1305 |
| 447 | Ga0307515_10000186 | 3300028794 | Bacteria | 153531 |
| 448 | Ga0307515_10030060 | 3300028794 | Bacteria | 9147 |
| 449 | Ga0265338_10006667 | 3300028800 | Bacteria | 14602 |
| 450 | Ga0265332_10042963 | 3300031238 | Bacteria | 1953 |
| 451 | Ga0265320_10000088 | 3300031240 | Bacteria | 77379 |
| 452 | Ga0265325_10019084 | 3300031241 | Bacteria | 3795 |
| 453 | Ga0265340_10001665 | 3300031247 | Bacteria | 12773 |
| 454 | Ga0265340_10003297 | 3300031247 | Bacteria | 9149 |
| 455 | Ga0265339_10084722 | 3300031249 | Bacteria | 1670 |
| 456 | Ga0265316_10006090 | 3300031344 | Bacteria | 11574 |
| 457 | Ga0265316_10018815 | 3300031344 | Bacteria | 5929 |
| 458 | Ga0265316_10085401 | 3300031344 | Bacteria | 2415 |
| 459 | Ga0265313_10034458 | 3300031595 | Bacteria | 2560 |
| 460 | Ga0316575_10008358 | 3300031665 | Bacteria | 3768 |
| 461 | Ga0316575_10032612 | 3300031665 | Bacteria | 2041 |
| 462 | Ga0265314_10008687 | 3300031711 | Bacteria | 8689 |
| 463 | Ga0265314_10011566 | 3300031711 | Bacteria | 7272 |
| 464 | Ga0265342_10009933 | 3300031712 | Bacteria | 6653 |
| 465 | Ga0265342_10013637 | 3300031712 | Bacteria | 5439 |
| 466 | Ga0316576_10228756 | 3300031727 | Bacteria | 1398 |
| 467 | Ga0316577_10094086 | 3300031733 | Bacteria | 1678 |
| 468 | Ga0307413_10033399 | 3300031824 | Bacteria | 2929 |
| 469 | Ga0307410_10103090 | 3300031852 | Bacteria | 2048 |
| 470 | Ga0307410_10440576 | 3300031852 | Bacteria | 1061 |
| 471 | Ga0307407_10088573 | 3300031903 | Bacteria | 1891 |
| 472 | Ga0307412_10019158 | 3300031911 | Bacteria | 4136 |
| 473 | Ga0307409_100018531 | 3300031995 | Bacteria | 4684 |
| 474 | Ga0307409_100074682 | 3300031995 | Bacteria | 2710 |
| 475 | Ga0307414_10009782 | 3300032004 | Bacteria | 5526 |
| 476 | Ga0307414_10010095 | 3300032004 | Bacteria | 5459 |
| 477 | Ga0307414_10044469 | 3300032004 | Bacteria | 3033 |
| 478 | Ga0307414_10154988 | 3300032004 | Bacteria | 1812 |
| 479 | Ga0307414_10465226 | 3300032004 | Bacteria | 1112 |
| 480 | Ga0307411_10000948 | 3300032005 | Bacteria | 11083 |
| 481 | Ga0307411_10020582 | 3300032005 | Bacteria | 3841 |
| 482 | Ga0307411_10025486 | 3300032005 | Bacteria | 3544 |
| 483 | Ga0307411_10027338 | 3300032005 | Bacteria | 3450 |
| 484 | Ga0307415_100001833 | 3300032126 | Bacteria | 10420 |
| 485 | Ga0307415_100033428 | 3300032126 | Bacteria | 3338 |
| 486 | Ga0373946_0001529 | 3300035171 | Bacteria | 8044 |
| 487 | Ga0373924_0129707 | 3300035410 | Bacteria | 1097 |
| 488 | Ga0373931_0177169 | 3300035691 | Bacteria | 1260 |
| 489 | Ga0373935_0016342 | 3300035692 | Bacteria | 4490 |
| 490 | Ga0373927_0006248 | 3300035695 | Bacteria | 8131 |
| 491 | Ga0373937_0060514 | 3300036401 | Bacteria | 3480 |
| 492 | Ga0395899_0000154 | 3300037312 | Bacteria | 104239 |
| 493 | Ga0395899_0105544 | 3300037312 | Bacteria | 2029 |
| 494 | Ga0395899_0275004 | 3300037312 | Bacteria | 1147 |
| 495 | Ga0395900_0000293 | 3300037418 | Bacteria | 75318 |
| 496 | Ga0395900_0000837 | 3300037418 | Bacteria | 40521 |
| 497 | Ga0395900_0001617 | 3300037418 | Bacteria | 26505 |
| 498 | Ga0395900_0005458 | 3300037418 | Bacteria | 13315 |
| 499 | Ga0395900_0014026 | 3300037418 | Bacteria | 8183 |
| 500 | Ga0395900_0023841 | 3300037418 | Bacteria | 6261 |
| 501 | Ga0395900_0039225 | 3300037418 | Bacteria | 4880 |
| 502 | Ga0395900_0070364 | 3300037418 | Bacteria | 3597 |
| 503 | Ga0395900_0073310 | 3300037418 | Bacteria | 3520 |
| 504 | Ga0395900_0102369 | 3300037418 | Bacteria | 2942 |
| 505 | Ga0395900_0194366 | 3300037418 | Bacteria | 2056 |
| 506 | Ga0395900_0218670 | 3300037418 | Bacteria | 1921 |
| 507 | Ga0395900_0297051 | 3300037418 | Bacteria | 1602 |
| 508 | Ga0395900_0509950 | 3300037418 | Bacteria | 1152 |
| 509 | Ga0395898_0000219 | 3300037466 | Bacteria | 146838 |
| 510 | Ga0395898_0001594 | 3300037466 | Bacteria | 30951 |
| 511 | Ga0395898_0022892 | 3300037466 | Bacteria | 6318 |
| 512 | Ga0395898_0033483 | 3300037466 | Bacteria | 5127 |
| 513 | Ga0395898_0038614 | 3300037466 | Bacteria | 4730 |
| 514 | Ga0395898_0121876 | 3300037466 | Bacteria | 2498 |
| 515 | Ga0395898_0127894 | 3300037466 | Bacteria | 2434 |
| 516 | Ga0395898_0166718 | 3300037466 | Bacteria | 2106 |
| 517 | Ga0395898_0243070 | 3300037466 | Bacteria | 1717 |
| 518 | Ga0395905_0000094 | 3300037471 | Bacteria | 147776 |
| 519 | Ga0395905_0001923 | 3300037471 | Bacteria | 23843 |
| 520 | Ga0395905_0004005 | 3300037471 | Bacteria | 15480 |
| 521 | Ga0395905_0014247 | 3300037471 | Bacteria | 7596 |
| 522 | Ga0395905_0016641 | 3300037471 | Bacteria | 6990 |
| 523 | Ga0395905_0016712 | 3300037471 | Bacteria | 6973 |
| 524 | Ga0395905_0021348 | 3300037471 | Bacteria | 6124 |
| 525 | Ga0395905_0024162 | 3300037471 | Bacteria | 5736 |
| 526 | Ga0395905_0028215 | 3300037471 | Bacteria | 5291 |
| 527 | Ga0395905_0066005 | 3300037471 | Bacteria | 3388 |
| 528 | Ga0395905_0120879 | 3300037471 | Bacteria | 2462 |
| 529 | Ga0395905_0160391 | 3300037471 | Bacteria | 2114 |
| 530 | Ga0395905_0203178 | 3300037471 | Bacteria | 1857 |
| 531 | Ga0395905_0213911 | 3300037471 | Bacteria | 1805 |
| 532 | Ga0395905_0380168 | 3300037471 | Bacteria | 1306 |
| 533 | Ga0395905_0397782 | 3300037471 | Bacteria | 1272 |
| 534 | Ga0395905_0439035 | 3300037471 | Bacteria | 1202 |
| 535 | Ga0395905_0466562 | 3300037471 | Bacteria | 1161 |
| 536 | Ga0395901_0000228 | 3300038443 | Bacteria | 70677 |
| 537 | Ga0395901_0002443 | 3300038443 | Bacteria | 18837 |
| 538 | Ga0395901_0003671 | 3300038443 | Bacteria | 15477 |
| 539 | Ga0395901_0008002 | 3300038443 | Bacteria | 10671 |
| 540 | Ga0395901_0012539 | 3300038443 | Bacteria | 8601 |
| 541 | Ga0395901_0041312 | 3300038443 | Bacteria | 4779 |
| 542 | Ga0395901_0044513 | 3300038443 | Bacteria | 4603 |
| 543 | Ga0395901_0061864 | 3300038443 | Bacteria | 3895 |
| 544 | Ga0395901_0075485 | 3300038443 | Bacteria | 3516 |
| 545 | Ga0395901_0076069 | 3300038443 | Bacteria | 3502 |
| 546 | Ga0395901_0086429 | 3300038443 | Bacteria | 3279 |
| 547 | Ga0395901_0139342 | 3300038443 | Bacteria | 2549 |
| 548 | Ga0395901_0197458 | 3300038443 | Bacteria | 2109 |
| 549 | Ga0395901_0234317 | 3300038443 | Bacteria | 1916 |
| 550 | Ga0395901_0240762 | 3300038443 | Bacteria | 1887 |
| 551 | Ga0395901_0287881 | 3300038443 | Bacteria | 1706 |
| 552 | Ga0395901_0455821 | 3300038443 | Bacteria | 1307 |
| 553 | Ga0395901_0529857 | 3300038443 | Bacteria | 1196 |
| 554 | Ga0395901_0624640 | 3300038443 | Bacteria | 1084 |
| 555 | Ga0395901_0752757 | 3300038443 | Bacteria | 967 |
| 556 | Ga0436360_0764336 | 3300039438 | Bacteria | 1608 |
| 557 | Ga0436363_1352830 | 3300039450 | Bacteria | 1624 |
| 558 | Ga0451807_0903417 | 3300041486 | Bacteria | 1196 |
| 559 | Ga0439448_0002573 | 3300042005 | Bacteria | 4944 |
| 560 | Ga0439449_0000498 | 3300042007 | Bacteria | 14738 |
| 561 | Ga0439452_011492 | 3300042010 | Bacteria | 2541 |
| 562 | Ga0439455_0000252 | 3300042012 | Bacteria | 6482 |
| 563 | Ga0439458_0000255 | 3300042157 | Bacteria | 12956 |
| 564 | Ga0439458_0006263 | 3300042157 | Bacteria | 2653 |
| 565 | Ga0450908_025005 | 3300042184 | Bacteria | 1043 |
| 566 | Ga0439464_0000114 | 3300042439 | Bacteria | 12425 |
| 567 | Ga0439460_0046173 | 3300042461 | Bacteria | 1294 |
| 568 | Ga0466963_0035095 | 3300044694 | Bacteria | 3266 |
| 569 | Ga0466963_0083554 | 3300044694 | Bacteria | 2165 |
| 570 | Ga0466957_0312078 | 3300044842 | Bacteria | 1059 |
| 571 | Ga0466960_0036053 | 3300044901 | Bacteria | 2315 |
| 572 | Ga0466959_0027362 | 3300045049 | Bacteria | 4230 |
| 573 | Ga0466958_0145877 | 3300045836 | Bacteria | 1491 |
| 574 | Ga0466967_0061960 | 3300045976 | Bacteria | 3319 |
| 575 | Ga0466967_0072406 | 3300045976 | Bacteria | 3089 |
| 576 | Ga0466967_0082937 | 3300045976 | Bacteria | 2898 |
| 577 | Ga0466967_0086492 | 3300045976 | Bacteria | 2840 |
| 578 | Ga0495627_000224 | 3300046453 | Bacteria | 60727 |
| 579 | Ga0495627_000650 | 3300046453 | Bacteria | 26905 |
| 580 | Ga0495592_0055356 | 3300046454 | Bacteria | 2935 |
| 581 | Ga0495638_0004955 | 3300046460 | Bacteria | 9998 |
| 582 | Ga0495651_0046190 | 3300046462 | Bacteria | 3371 |
| 583 | Ga0495653_0041584 | 3300046463 | Bacteria | 3587 |
| 584 | Ga0495650_0001756 | 3300046471 | Bacteria | 19720 |
| 585 | Ga0495582_0063922 | 3300046473 | Bacteria | 2032 |
| 586 | Ga0495639_0048020 | 3300046475 | Bacteria | 1935 |
| 587 | Ga0495664_0039770 | 3300046477 | Bacteria | 2779 |
| 588 | Ga0495594_0075152 | 3300046499 | Bacteria | 1883 |
| 589 | Ga0495596_0006414 | 3300046500 | Bacteria | 5412 |
| 590 | Ga0495608_0089155 | 3300046511 | Bacteria | 1996 |
| 591 | Ga0495610_0001358 | 3300046512 | Bacteria | 21731 |
| 592 | Ga0495610_0006803 | 3300046512 | Bacteria | 7759 |
| 593 | Ga0495618_0023989 | 3300046514 | Bacteria | 3776 |
| 594 | Ga0495618_0105126 | 3300046514 | Bacteria | 1808 |
| 595 | Ga0495628_0096379 | 3300046516 | Bacteria | 2285 |
| 596 | Ga0495637_0026938 | 3300046520 | Bacteria | 2575 |
| 597 | Ga0495643_0000007 | 3300046522 | Bacteria | 383435 |
| 598 | Ga0495643_0062327 | 3300046522 | Bacteria | 1974 |
| 599 | Ga0495648_0007929 | 3300046524 | Bacteria | 8425 |
| 600 | Ga0495666_0007474 | 3300046526 | Bacteria | 5471 |
| 601 | Ga0495652_0049977 | 3300046529 | Bacteria | 3577 |
| 602 | Ga0495640_0051265 | 3300046533 | Bacteria | 2837 |
| 603 | Ga0495633_0041501 | 3300046558 | Bacteria | 2188 |
| 604 | Ga0495667_0038098 | 3300046559 | Bacteria | 3202 |
| 605 | Ga0495668_0118643 | 3300046616 | Bacteria | 1447 |
| 606 | Ga0495625_0000025 | 3300046660 | Bacteria | 267383 |
| 607 | Ga0495625_0000665 | 3300046660 | Bacteria | 48983 |
| 608 | Ga0495625_0001685 | 3300046660 | Bacteria | 25771 |
| 609 | Ga0495635_0036810 | 3300046663 | Bacteria | 3389 |
| 610 | Ga0495588_0035246 | 3300046674 | Bacteria | 2535 |
| 611 | Ga0495657_0037685 | 3300046675 | Bacteria | 3330 |
| 612 | Ga0495599_0000776 | 3300046678 | Bacteria | 17964 |
| 613 | Ga0495646_0035166 | 3300046680 | Bacteria | 3108 |
| 614 | Ga0495669_0000556 | 3300046684 | Bacteria | 16545 |
| 615 | Ga0495669_0037764 | 3300046684 | Bacteria | 2138 |
| 616 | Ga0495670_0000014 | 3300046691 | Bacteria | 138993 |
| 617 | Ga0495649_0012204 | 3300046694 | Bacteria | 5009 |
| 618 | Ga0495674_0056993 | 3300047319 | Bacteria | 3420 |
| 619 | Ga0495680_0032197 | 3300047322 | Bacteria | 4260 |
| 620 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 621 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 622 | Ga0495684_0099297 | 3300047471 | Bacteria | 2201 |
| 623 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 624 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 625 | Ga0495686_0121210 | 3300047472 | Bacteria | 1558 |
| 626 | Ga0495686_0185313 | 3300047472 | Bacteria | 1203 |
| 627 | Ga0496101_0073859 | 3300048904 | Bacteria | 2506 |
| 628 | Ga0496102_0275836 | 3300048905 | Bacteria | 1585 |
| 629 | Ga0496107_0032008 | 3300048910 | Bacteria | 3757 |
| 630 | Ga0496107_0136217 | 3300048910 | Bacteria | 1814 |
| 631 | Ga0496108_0033094 | 3300048911 | Bacteria | 4294 |
| 632 | Ga0496108_0316070 | 3300048911 | Bacteria | 1361 |
| 633 | Ga0496109_0180520 | 3300048912 | Bacteria | 1982 |
| 634 | Ga0496110_0076090 | 3300048913 | Bacteria | 2984 |
| 635 | Ga0496110_0130977 | 3300048913 | Bacteria | 2265 |
| 636 | Ga0496111_0146163 | 3300048914 | Bacteria | 1753 |
| 637 | Ga0496112_0027433 | 3300048915 | Bacteria | 5490 |
| 638 | Ga0496112_0042055 | 3300048915 | Bacteria | 4472 |
| 639 | Ga0496112_0182833 | 3300048915 | Bacteria | 2060 |
| 640 | Ga0496112_0210036 | 3300048915 | Bacteria | 1904 |
| 641 | Ga0496114_0090799 | 3300048917 | Bacteria | 2593 |
| 642 | Ga0496117_0021492 | 3300048920 | Bacteria | 5217 |
| 643 | Ga0496118_0001617 | 3300048921 | Bacteria | 33315 |
| 644 | Ga0496120_0161911 | 3300048923 | Bacteria | 1115 |
| 645 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 646 | Ga0496121_0003131 | 3300048924 | Bacteria | 23873 |
| 647 | Ga0496123_0002459 | 3300048926 | Bacteria | 22941 |
| 648 | Ga0496124_0015727 | 3300048927 | Bacteria | 7234 |
| 649 | Ga0496124_0142495 | 3300048927 | Bacteria | 1890 |
| 650 | Ga0501031_0059130 | 3300049568 | Bacteria | 2498 |
| 651 | Ga0501032_0053364 | 3300049569 | Bacteria | 2723 |
| 652 | Ga0501033_0014079 | 3300049570 | Bacteria | 6082 |
| 653 | Ga0501033_0054652 | 3300049570 | Bacteria | 2953 |
| 654 | Ga0501033_0151270 | 3300049570 | Bacteria | 1674 |
| 655 | Ga0501034_0005027 | 3300049571 | Bacteria | 14533 |
| 656 | Ga0501034_0482573 | 3300049571 | Bacteria | 1155 |
| 657 | Ga0501036_0282734 | 3300049572 | Bacteria | 1388 |
| 658 | Ga0501038_0015781 | 3300049574 | Bacteria | 6864 |
| 659 | Ga0501043_0020865 | 3300049579 | Bacteria | 5139 |
| 660 | Ga0501043_0047606 | 3300049579 | Bacteria | 3371 |
| 661 | Ga0501047_0001117 | 3300049581 | Bacteria | 26643 |
| 662 | Ga0501047_0013021 | 3300049581 | Bacteria | 7877 |
| 663 | Ga0501047_0040926 | 3300049581 | Bacteria | 4480 |
| 664 | Ga0501067_0109079 | 3300049583 | Bacteria | 1539 |
| 665 | Ga0501069_0036991 | 3300049585 | Bacteria | 2693 |
| 666 | Ga0501070_0000020 | 3300049586 | Bacteria | 169025 |
| 667 | Ga0501070_0061488 | 3300049586 | Bacteria | 3111 |
| 668 | Ga0501080_0011676 | 3300049742 | Bacteria | 8046 |
| 669 | Ga0501080_0075002 | 3300049742 | Bacteria | 3147 |
| 670 | Ga0501083_0006223 | 3300049744 | Bacteria | 8467 |
| 671 | Ga0501035_0006911 | 3300049822 | Bacteria | 10599 |
| 672 | Ga0501035_0088838 | 3300049822 | Bacteria | 2722 |
| 673 | Ga0501044_0014571 | 3300049823 | Bacteria | 8481 |
| 674 | Ga0501044_0020893 | 3300049823 | Bacteria | 6989 |
| 675 | Ga0501044_0078876 | 3300049823 | Bacteria | 3337 |
| 676 | Ga0501044_0097527 | 3300049823 | Bacteria | 2960 |
| 677 | Ga0501044_0202547 | 3300049823 | Bacteria | 1942 |
| 678 | Ga0501044_0211422 | 3300049823 | Bacteria | 1894 |
| 679 | nmdc:mga0k408_161782_c1 | 3300050493 | Bacteria | 1334 |
| 680 | nmdc:mga0k408_25112_c1 | 3300050493 | Bacteria | 3372 |
| 681 | nmdc:mga0k408_34852_c2 | 3300050493 | Bacteria | 2192 |
| 682 | nmdc:mga04h51_59395_c1 | 3300050495 | Bacteria | 1307 |
| 683 | nmdc:mga07m45_2_c1 | 3300050496 | Bacteria | 451154 |
| 684 | nmdc:mga06r32_145461_c1 | 3300050510 | Bacteria | 2348 |
| 685 | nmdc:mga08x19_143565_c1 | 3300050514 | Bacteria | 1613 |
| 686 | nmdc:mga0a205_5975_c1 | 3300050515 | Bacteria | 10970 |
| 687 | Ga0495601_0009915 | 3300053077 | Bacteria | 5644 |
| 688 | Ga0495601_0011636 | 3300053077 | Bacteria | 5272 |
| 689 | Ga0495595_0028222 | 3300053084 | Bacteria | 2506 |
| 690 | Ga0495619_0164263 | 3300053085 | Bacteria | 1534 |
| 691 | Ga0500641_0021781 | 3300053096 | Bacteria | 2448 |
| 692 | Ga0500562_002575 | 3300053108 | Bacteria | 4520 |
| 693 | Ga0500593_074444 | 3300053117 | Bacteria | 1468 |
| 694 | Ga0500597_024094 | 3300053120 | Bacteria | 2439 |
| 695 | Ga0500618_000514 | 3300053125 | Bacteria | 24477 |
| 696 | Ga0500559_0004706 | 3300053136 | Bacteria | 6423 |
| 697 | Ga0500559_0022361 | 3300053136 | Bacteria | 2681 |
| 698 | Ga0500616_0008861 | 3300053153 | Bacteria | 6182 |
| 699 | Ga0500622_0034813 | 3300053156 | Bacteria | 2637 |
| 700 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 701 | Ga0500637_0000022 | 3300053178 | Bacteria | 61494 |
| 702 | Ga0501084_0000171 | 3300054114 | Bacteria | 50689 |
| 703 | 2511120387 | 2510917020 | Bacteria | 5657507 |
| 704 | 2511130088 | 2510917021 | Bacteria | 5705459 |
| 705 | 2643924796 | 2643221583 | Bacteria | 5218014 |
| 706 | 2738745027 | 2738541281 | Bacteria | 5112672 |
| 707 | 2739354257 | 2738543032 | Bacteria | 5115625 |
| 708 | 2793978932 | 2791355406 | Bacteria | 11364898 |
| 709 | 2830076896 | 2830075706 | Bacteria | 3855215 |
| 710 | 2885430718 | 2885429604 | Bacteria | 3642894 |
| 711 | 2919514470 | 2919513703 | Bacteria | 3844312 |
| 712 | 2919678829 | 2919675420 | Bacteria | 3969095 |
| 713 | 2946789656 | 2946787523 | Bacteria | 4366789 |
| 714 | 8048137243 | 8048127548 | Bacteria | 11053136 |
| 715 | Ga0496102_0265920 | |||
| 716 | JGI24740J21852_10005372 | |||
| 717 | JGI24739J22299_10004790 | |||
| 718 | JGI24739J22299_10009552 | |||
| 719 | JGI24739J22299_10049772 | |||
| 720 | JGI24737J22298_10000687 | |||
| 721 | JGI24735J21928_10027297 | |||
| 722 | JGI24738J21930_10002091 | |||
| 723 | JGI24738J21930_10007677 | |||
| 724 | JGI25150J39212_1000020 | |||
| 725 | JGI25151J46595_10055943 | |||
| 726 | JGI25153J46596_10000017 | |||
| 727 | rootH2_10075661 | |||
| 728 | Ga0055536_1011158 | |||
| 729 | Ga0055530_10016424 | |||
| 730 | Ga0055540_1005503 | |||
| 731 | Ga0065165_1000625 | |||
| 732 | Ga0065714_10109070 | |||
| 733 | Ga0070658_10008641 | |||
| 734 | Ga0070658_10038050 | |||
| 735 | Ga0070658_10040306 | |||
| 736 | Ga0070658_10222296 | |||
| 737 | Ga0070658_10246114 | |||
| 738 | Ga0070658_10318277 | |||
| 739 | Ga0070676_10004172 | |||
| 740 | Ga0070683_100025567 | |||
| 741 | Ga0070683_100218535 | |||
| 742 | Ga0070690_100091417 | |||
| 743 | Ga0070670_100016900 | |||
| 744 | Ga0070670_100025510 | |||
| 745 | Ga0068869_100003116 | |||
| 746 | Ga0070666_10062831 | |||
| 747 | Ga0070680_100000777 | |||
| 748 | Ga0070680_100001609 | |||
| 749 | Ga0070680_100008701 | |||
| 750 | Ga0070680_100255725 | |||
| 751 | Ga0070680_100310653 | |||
| 752 | Ga0070682_100035315 | |||
| 753 | Ga0068868_100011184 | |||
| 754 | Ga0070660_100003291 | |||
| 755 | Ga0070660_100004065 | |||
| 756 | Ga0070660_100017639 | |||
| 757 | Ga0070660_100029155 | |||
| 758 | Ga0070660_100047766 | |||
| 759 | Ga0070660_100160963 | |||
| 760 | Ga0070660_100186491 | |||
| 761 | Ga0070660_100266557 | |||
| 762 | Ga0070660_100310240 | |||
| 763 | Ga0070660_100362680 | |||
| 764 | Ga0070691_10008548 | |||
| 765 | Ga0070691_10123756 | |||
| 766 | Ga0070661_100001494 | |||
| 767 | Ga0070661_100040130 | |||
| 768 | Ga0070661_100061923 | |||
| 769 | Ga0070661_100108664 | |||
| 770 | Ga0070661_100169133 | |||
| 771 | Ga0070661_100182187 | |||
| 772 | Ga0070692_10041405 | |||
| 773 | Ga0070668_100043360 | |||
| 774 | Ga0070669_100000138 | |||
| 775 | Ga0070669_100041151 | |||
| 776 | Ga0070675_100021410 | |||
| 777 | Ga0070671_100021780 | |||
| 778 | Ga0070671_100027056 | |||
| 779 | Ga0070671_100104838 | |||
| 780 | Ga0070671_100232034 | |||
| 781 | Ga0070674_100033254 | |||
| 782 | Ga0070673_100002586 | |||
| 783 | Ga0070673_100004948 | |||
| 784 | Ga0070659_100001040 | |||
| 785 | Ga0070659_100003697 | |||
| 786 | Ga0070659_100007325 | |||
| 787 | Ga0070659_100015988 | |||
| 788 | Ga0070659_100027275 | |||
| 789 | Ga0070659_100065256 | |||
| 790 | Ga0070659_100075317 | |||
| 791 | Ga0070659_100112163 | |||
| 792 | Ga0070667_100047812 | |||
| 793 | Ga0070667_100227132 | |||
| 794 | Ga0070709_10202436 | |||
| 795 | Ga0070694_100020574 | |||
| 796 | Ga0070663_100048900 | |||
| 797 | Ga0070663_100109285 | |||
| 798 | Ga0070663_100276188 | |||
| 799 | Ga0070663_100398467 | |||
| 800 | Ga0070662_100001837 | |||
| 801 | Ga0070662_100001928 | |||
| 802 | Ga0070662_100080350 | |||
| 803 | Ga0070681_10006985 | |||
| 804 | Ga0070681_10093219 | |||
| 805 | Ga0070681_10113562 | |||
| 806 | Ga0070681_10315254 | |||
| 807 | Ga0070681_10332708 | |||
| 808 | Ga0068867_100010664 | |||
| 809 | Ga0068867_100016740 | |||
| 810 | Ga0070698_100063579 | |||
| 811 | Ga0070679_100004635 | |||
| 812 | Ga0070679_100075528 | |||
| 813 | Ga0070679_100077512 | |||
| 814 | Ga0070679_100320061 | |||
| 815 | Ga0070679_100330242 | |||
| 816 | Ga0070679_100419467 | |||
| 817 | Ga0070679_100479188 | |||
| 818 | Ga0070684_100027737 | |||
| 819 | Ga0070684_100124210 | |||
| 820 | Ga0070684_100345018 | |||
| 821 | Ga0070697_100000139 | |||
| 822 | Ga0070697_100018866 | |||
| 823 | Ga0068853_100004994 | |||
| 824 | Ga0068853_100027359 | |||
| 825 | Ga0068853_100027704 | |||
| 826 | Ga0068853_100033891 | |||
| 827 | Ga0068853_100113339 | |||
| 828 | Ga0068853_100116126 | |||
| 829 | Ga0068853_100134100 | |||
| 830 | Ga0070672_100000868 | |||
| 831 | Ga0070693_100284404 | |||
| 832 | Ga0070665_100000380 | |||
| 833 | Ga0070665_100138367 | |||
| 834 | Ga0068855_100001148 | |||
| 835 | Ga0068855_100008821 | |||
| 836 | Ga0068855_100010741 | |||
| 837 | Ga0068855_100394571 | |||
| 838 | Ga0068855_100395925 | |||
| 839 | Ga0068855_100709803 | |||
| 840 | Ga0070664_100002792 | |||
| 841 | Ga0070664_100004946 | |||
| 842 | Ga0070664_100006300 | |||
| 843 | Ga0070664_100043512 | |||
| 844 | Ga0070664_100057463 | |||
| 845 | Ga0068857_100007132 | |||
| 846 | Ga0068857_100021844 | |||
| 847 | Ga0068857_100041994 | |||
| 848 | Ga0068857_100107278 | |||
| 849 | Ga0068857_100135940 | |||
| 850 | Ga0068857_100189409 | |||
| 851 | Ga0068857_100313261 | |||
| 852 | Ga0068854_100005266 | |||
| 853 | Ga0068854_100014636 | |||
| 854 | Ga0068854_100072173 | |||
| 855 | Ga0068854_100072875 | |||
| 856 | Ga0068854_100240021 | |||
| 857 | Ga0068856_100009932 | |||
| 858 | Ga0068856_100047053 | |||
| 859 | Ga0068856_100057631 | |||
| 860 | Ga0068856_100347459 | |||
| 861 | Ga0068856_100618558 | |||
| 862 | Ga0068852_100000946 | |||
| 863 | Ga0068852_100005893 | |||
| 864 | Ga0068852_100018079 | |||
| 865 | Ga0068852_100102314 | |||
| 866 | Ga0068852_100112815 | |||
| 867 | Ga0068852_100125607 | |||
| 868 | Ga0068852_100225606 | |||
| 869 | Ga0068852_100505068 | |||
| 870 | Ga0068859_100000550 | |||
| 871 | Ga0068859_100006426 | |||
| 872 | Ga0068859_100073328 | |||
| 873 | Ga0068859_100155178 | |||
| 874 | Ga0068864_100003528 | |||
| 875 | Ga0068864_100005190 | |||
| 876 | Ga0068851_10012796 | |||
| 877 | Ga0068851_10014173 | |||
| 878 | Ga0068863_100004087 | |||
| 879 | Ga0068863_100009309 | |||
| 880 | Ga0068863_100048341 | |||
| 881 | Ga0068863_100226573 | |||
| 882 | Ga0068858_100002589 | |||
| 883 | Ga0068858_100004956 | |||
| 884 | Ga0068858_100023934 | |||
| 885 | Ga0068858_100025161 | |||
| 886 | Ga0068858_100235315 | |||
| 887 | Ga0068860_100004406 | |||
| 888 | Ga0068860_100006884 | |||
| 889 | Ga0068860_100284558 | |||
| 890 | Ga0068862_100006635 | |||
| 891 | Ga0068862_100021749 | |||
| 892 | Ga0081538_10018384 | |||
| 893 | Ga0075368_10087558 | |||
| 894 | Ga0070712_100185284 | |||
| 895 | Ga0075366_10026901 | |||
| 896 | Ga0075366_10067766 | |||
| 897 | Ga0075366_10180035 | |||
| 898 | Ga0075370_10000001 | |||
| 899 | Ga0068871_100405905 | |||
| 900 | Ga0075428_100131976 | |||
| 901 | Ga0075431_100288808 | |||
| 902 | Ga0075433_10010202 | |||
| 903 | Ga0068865_100005976 | |||
| 904 | Ga0097620_100000550 | |||
| 905 | Ga0097620_100006426 | |||
| 906 | Ga0097620_100073329 | |||
| 907 | Ga0097620_100155181 | |||
| 908 | Ga0105240_10010679 | |||
| 909 | Ga0105240_10015147 | |||
| 910 | Ga0105240_10018070 | |||
| 911 | Ga0105240_10065883 | |||
| 912 | Ga0105240_10085276 | |||
| 913 | Ga0105240_10150136 | |||
| 914 | Ga0105245_10000198 | |||
| 915 | Ga0105245_10063705 | |||
| 916 | Ga0105247_10018070 | |||
| 917 | Ga0105243_10010602 | |||
| 918 | Ga0105243_10298211 | |||
| 919 | Ga0105241_10027469 | |||
| 920 | Ga0105241_10284753 | |||
| 921 | Ga0105248_10000391 | |||
| 922 | Ga0105248_10031695 | |||
| 923 | Ga0105237_10243467 | |||
| 924 | Ga0105238_10007731 | |||
| 925 | Ga0105238_10014401 | |||
| 926 | Ga0105238_10052170 | |||
| 927 | Ga0105239_10053714 | |||
| 928 | Ga0105239_10477424 | |||
| 929 | Ga0105239_10732565 | |||
| 930 | Ga0105246_10073297 | |||
| 931 | Ga0105246_10368332 | |||
| 932 | Ga0157373_10010344 | |||
| 933 | Ga0157373_10031653 | |||
| 934 | Ga0157373_10076574 | |||
| 935 | Ga0157373_10081004 | |||
| 936 | Ga0157373_10142136 | |||
| 937 | Ga0157371_10002789 | |||
| 938 | Ga0157371_10002797 | |||
| 939 | Ga0157371_10293365 | |||
| 940 | Ga0157370_10006108 | |||
| 941 | Ga0157370_10025395 | |||
| 942 | Ga0157370_10032238 | |||
| 943 | Ga0157370_10069403 | |||
| 944 | Ga0157370_10097207 | |||
| 945 | Ga0157370_10130551 | |||
| 946 | Ga0157370_10204812 | |||
| 947 | Ga0157370_10284948 | |||
| 948 | Ga0157370_10295723 | |||
| 949 | Ga0157370_10349859 | |||
| 950 | Ga0157369_10002441 | |||
| 951 | Ga0157369_10007310 | |||
| 952 | Ga0157369_10085210 | |||
| 953 | Ga0157369_10098789 | |||
| 954 | Ga0157369_10102744 | |||
| 955 | Ga0157369_10290820 | |||
| 956 | Ga0157369_10504471 | |||
| 957 | Ga0157374_10086272 | |||
| 958 | Ga0157378_10001311 | |||
| 959 | Ga0157378_10437162 | |||
| 960 | Ga0163162_10064438 | |||
| 961 | Ga0163162_10072048 | |||
| 962 | Ga0163162_10122274 | |||
| 963 | Ga0163162_10511373 | |||
| 964 | Ga0157372_10003571 | |||
| 965 | Ga0157372_10012201 | |||
| 966 | Ga0157372_10244011 | |||
| 967 | Ga0157375_10026969 | |||
| 968 | Ga0157375_10100575 | |||
| 969 | Ga0163163_10003435 | |||
| 970 | Ga0157377_10022379 | |||
| 971 | Ga0157379_10006683 | |||
| 972 | Ga0206353_10434619 | |||
| 973 | Ga0207425_1000022 | |||
| 974 | Ga0209129_1000286 | |||
| 975 | Ga0209233_1013690 | |||
| 976 | Ga0209676_1009141 | |||
| 977 | Ga0209025_1001464 | |||
| 978 | Ga0209758_1000004 | |||
| 979 | Ga0209050_1000001 | |||
| 980 | Ga0209051_1000246 | |||
| 981 | Ga0209257_1011642 | |||
| 982 | Ga0207697_10000297 | |||
| 983 | Ga0207656_10008833 | |||
| 984 | Ga0207656_10013262 | |||
| 985 | Ga0207656_10026133 | |||
| 986 | Ga0207688_10000214 | |||
| 987 | Ga0207647_10000450 | |||
| 988 | Ga0207647_10000550 | |||
| 989 | Ga0207647_10001333 | |||
| 990 | Ga0207647_10051388 | |||
| 991 | Ga0207699_10175992 | |||
| 992 | Ga0207645_10047073 | |||
| 993 | Ga0207705_10000647 | |||
| 994 | Ga0207705_10000733 | |||
| 995 | Ga0207705_10012679 | |||
| 996 | Ga0207705_10016400 | |||
| 997 | Ga0207705_10021334 | |||
| 998 | Ga0207705_10036186 | |||
| 999 | Ga0207705_10038781 | |||
| 1000 | Ga0207705_10043296 | |||
| 1001 | Ga0207705_10044634 | |||
| 1002 | Ga0207654_10129313 | |||
| 1003 | Ga0207707_10004869 | |||
| 1004 | Ga0207707_10012471 | |||
| 1005 | Ga0207707_10031408 | |||
| 1006 | Ga0207707_10271783 | |||
| 1007 | Ga0207695_10024131 | |||
| 1008 | Ga0207695_10048907 | |||
| 1009 | Ga0207695_10105071 | |||
| 1010 | Ga0207695_10292239 | |||
| 1011 | Ga0207695_10458431 | |||
| 1012 | Ga0207693_10067961 | |||
| 1013 | Ga0207660_10000720 | |||
| 1014 | Ga0207660_10000753 | |||
| 1015 | Ga0207660_10002930 | |||
| 1016 | Ga0207660_10002951 | |||
| 1017 | Ga0207660_10004462 | |||
| 1018 | Ga0207660_10026504 | |||
| 1019 | Ga0207660_10400218 | |||
| 1020 | Ga0207657_10002019 | |||
| 1021 | Ga0207657_10002443 | |||
| 1022 | Ga0207657_10003486 | |||
| 1023 | Ga0207657_10003530 | |||
| 1024 | Ga0207657_10009031 | |||
| 1025 | Ga0207657_10010446 | |||
| 1026 | Ga0207657_10011217 | |||
| 1027 | Ga0207657_10016702 | |||
| 1028 | Ga0207657_10028287 | |||
| 1029 | Ga0207657_10065052 | |||
| 1030 | Ga0207657_10296054 | |||
| 1031 | Ga0207657_10317974 | |||
| 1032 | Ga0207649_10008370 | |||
| 1033 | Ga0207649_10010422 | |||
| 1034 | Ga0207649_10021475 | |||
| 1035 | Ga0207649_10028353 | |||
| 1036 | Ga0207649_10056575 | |||
| 1037 | Ga0207652_10001317 | |||
| 1038 | Ga0207652_10002779 | |||
| 1039 | Ga0207652_10052952 | |||
| 1040 | Ga0207652_10115640 | |||
| 1041 | Ga0207652_10287960 | |||
| 1042 | Ga0207646_10162553 | |||
| 1043 | Ga0207681_10002797 | |||
| 1044 | Ga0207681_10045621 | |||
| 1045 | Ga0207694_10001010 | |||
| 1046 | Ga0207694_10009321 | |||
| 1047 | Ga0207694_10102113 | |||
| 1048 | Ga0207659_10011048 | |||
| 1049 | Ga0207659_10277564 | |||
| 1050 | Ga0207687_10004719 | |||
| 1051 | Ga0207644_10021354 | |||
| 1052 | Ga0207644_10021704 | |||
| 1053 | Ga0207644_10028811 | |||
| 1054 | Ga0207644_10067500 | |||
| 1055 | Ga0207644_10178978 | |||
| 1056 | Ga0207690_10004314 | |||
| 1057 | Ga0207690_10004900 | |||
| 1058 | Ga0207690_10031546 | |||
| 1059 | Ga0207690_10061653 | |||
| 1060 | Ga0207690_10069839 | |||
| 1061 | Ga0207690_10174621 | |||
| 1062 | Ga0207690_10247107 | |||
| 1063 | Ga0207706_10001953 | |||
| 1064 | Ga0207706_10002890 | |||
| 1065 | Ga0207706_10019463 | |||
| 1066 | Ga0207706_10109711 | |||
| 1067 | Ga0207709_10069381 | |||
| 1068 | Ga0207709_10101297 | |||
| 1069 | Ga0207669_10052976 | |||
| 1070 | Ga0207704_10043071 | |||
| 1071 | Ga0207691_10000047 | |||
| 1072 | Ga0207691_10073755 | |||
| 1073 | Ga0207691_10228695 | |||
| 1074 | Ga0207711_10001028 | |||
| 1075 | Ga0207711_10003195 | |||
| 1076 | Ga0207711_10003281 | |||
| 1077 | Ga0207689_10000002 | |||
| 1078 | Ga0207689_10014038 | |||
| 1079 | Ga0207661_10047494 | |||
| 1080 | Ga0207661_10322527 | |||
| 1081 | Ga0207679_10034440 | |||
| 1082 | Ga0207679_10058928 | |||
| 1083 | Ga0207667_10004932 | |||
| 1084 | Ga0207667_10007513 | |||
| 1085 | Ga0207667_10015484 | |||
| 1086 | Ga0207667_10017570 | |||
| 1087 | Ga0207667_10029561 | |||
| 1088 | Ga0207667_10051008 | |||
| 1089 | Ga0207667_10061822 | |||
| 1090 | Ga0207651_10010367 | |||
| 1091 | Ga0207651_10027820 | |||
| 1092 | Ga0207651_10254231 | |||
| 1093 | Ga0207712_10000969 | |||
| 1094 | Ga0207712_10095457 | |||
| 1095 | Ga0207668_10113779 | |||
| 1096 | Ga0207640_10010650 | |||
| 1097 | Ga0207640_10024071 | |||
| 1098 | Ga0207640_10283999 | |||
| 1099 | Ga0207658_10003561 | |||
| 1100 | Ga0207658_10023648 | |||
| 1101 | Ga0207658_10230416 | |||
| 1102 | Ga0207677_10361972 | |||
| 1103 | Ga0207703_10002189 | |||
| 1104 | Ga0207703_10030569 | |||
| 1105 | Ga0207703_10065739 | |||
| 1106 | Ga0207703_10204788 | |||
| 1107 | Ga0207639_10000181 | |||
| 1108 | Ga0207639_10002813 | |||
| 1109 | Ga0207639_10013429 | |||
| 1110 | Ga0207639_10014834 | |||
| 1111 | Ga0207639_10028477 | |||
| 1112 | Ga0207639_10030303 | |||
| 1113 | Ga0207639_10088370 | |||
| 1114 | Ga0207639_10111414 | |||
| 1115 | Ga0207678_10001895 | |||
| 1116 | Ga0207678_10003129 | |||
| 1117 | Ga0207678_10047684 | |||
| 1118 | Ga0207678_10061702 | |||
| 1119 | Ga0207678_10062991 | |||
| 1120 | Ga0207678_10172896 | |||
| 1121 | Ga0207702_10025964 | |||
| 1122 | Ga0207702_10031490 | |||
| 1123 | Ga0207702_10045727 | |||
| 1124 | Ga0207702_10196823 | |||
| 1125 | Ga0207702_10314046 | |||
| 1126 | Ga0207641_10000761 | |||
| 1127 | Ga0207641_10002113 | |||
| 1128 | Ga0207648_10001403 | |||
| 1129 | Ga0207648_10017420 | |||
| 1130 | Ga0207648_10048809 | |||
| 1131 | Ga0207676_10000731 | |||
| 1132 | Ga0207676_10012400 | |||
| 1133 | Ga0207676_10565241 | |||
| 1134 | Ga0207674_10000850 | |||
| 1135 | Ga0207674_10011911 | |||
| 1136 | Ga0207674_10012448 | |||
| 1137 | Ga0207674_10016271 | |||
| 1138 | Ga0207674_10035053 | |||
| 1139 | Ga0207674_10036991 | |||
| 1140 | Ga0207674_10054898 | |||
| 1141 | Ga0207674_10422338 | |||
| 1142 | Ga0207683_10115678 | |||
| 1143 | Ga0207698_10006372 | |||
| 1144 | Ga0207698_10009246 | |||
| 1145 | Ga0207698_10046586 | |||
| 1146 | Ga0207698_10050609 | |||
| 1147 | Ga0207698_10069575 | |||
| 1148 | Ga0207698_10093468 | |||
| 1149 | Ga0207698_10147759 | |||
| 1150 | Ga0207698_10319786 | |||
| 1151 | Ga0209813_10005352 | |||
| 1152 | Ga0268266_10000256 | |||
| 1153 | Ga0268266_10102025 | |||
| 1154 | Ga0268265_10007223 | |||
| 1155 | Ga0268265_10047457 | |||
| 1156 | Ga0268265_10232819 | |||
| 1157 | Ga0268265_10245348 | |||
| 1158 | Ga0268264_10000755 | |||
| 1159 | Ga0268264_10032295 | |||
| 1160 | Ga0265318_10069592 | |||
| 1161 | Ga0307515_10000186 | |||
| 1162 | Ga0307515_10030060 | |||
| 1163 | Ga0265338_10006667 | |||
| 1164 | Ga0265332_10042963 | |||
| 1165 | Ga0265320_10000088 | |||
| 1166 | Ga0265325_10019084 | |||
| 1167 | Ga0265340_10001665 | |||
| 1168 | Ga0265340_10003297 | |||
| 1169 | Ga0265339_10084722 | |||
| 1170 | Ga0265316_10006090 | |||
| 1171 | Ga0265316_10018815 | |||
| 1172 | Ga0265316_10085401 | |||
| 1173 | Ga0265313_10034458 | |||
| 1174 | Ga0316575_10008358 | |||
| 1175 | Ga0316575_10032612 | |||
| 1176 | Ga0265314_10008687 | |||
| 1177 | Ga0265314_10011566 | |||
| 1178 | Ga0265342_10009933 | |||
| 1179 | Ga0265342_10013637 | |||
| 1180 | Ga0316576_10228756 | |||
| 1181 | Ga0316577_10094086 | |||
| 1182 | Ga0307413_10033399 | |||
| 1183 | Ga0307410_10103090 | |||
| 1184 | Ga0307410_10440576 | |||
| 1185 | Ga0307407_10088573 | |||
| 1186 | Ga0307412_10019158 | |||
| 1187 | Ga0307409_100018531 | |||
| 1188 | Ga0307409_100074682 | |||
| 1189 | Ga0307414_10009782 | |||
| 1190 | Ga0307414_10010095 | |||
| 1191 | Ga0307414_10044469 | |||
| 1192 | Ga0307414_10154988 | |||
| 1193 | Ga0307414_10465226 | |||
| 1194 | Ga0307411_10000948 | |||
| 1195 | Ga0307411_10020582 | |||
| 1196 | Ga0307411_10025486 | |||
| 1197 | Ga0307411_10027338 | |||
| 1198 | Ga0307415_100001833 | |||
| 1199 | Ga0307415_100033428 | |||
| 1200 | Ga0373946_0001529 | |||
| 1201 | Ga0373924_0129707 | |||
| 1202 | Ga0373931_0177169 | |||
| 1203 | Ga0373935_0016342 | |||
| 1204 | Ga0373927_0006248 | |||
| 1205 | Ga0373937_0060514 | |||
| 1206 | Ga0395899_0000154 | |||
| 1207 | Ga0395899_0105544 | |||
| 1208 | Ga0395899_0275004 | |||
| 1209 | Ga0395900_0000293 | |||
| 1210 | Ga0395900_0000837 | |||
| 1211 | Ga0395900_0001617 | |||
| 1212 | Ga0395900_0005458 | |||
| 1213 | Ga0395900_0014026 | |||
| 1214 | Ga0395900_0023841 | |||
| 1215 | Ga0395900_0039225 | |||
| 1216 | Ga0395900_0070364 | |||
| 1217 | Ga0395900_0073310 | |||
| 1218 | Ga0395900_0102369 | |||
| 1219 | Ga0395900_0194366 | |||
| 1220 | Ga0395900_0218670 | |||
| 1221 | Ga0395900_0297051 | |||
| 1222 | Ga0395900_0509950 | |||
| 1223 | Ga0395898_0000219 | |||
| 1224 | Ga0395898_0001594 | |||
| 1225 | Ga0395898_0022892 | |||
| 1226 | Ga0395898_0033483 | |||
| 1227 | Ga0395898_0038614 | |||
| 1228 | Ga0395898_0121876 | |||
| 1229 | Ga0395898_0127894 | |||
| 1230 | Ga0395898_0166718 | |||
| 1231 | Ga0395898_0243070 | |||
| 1232 | Ga0395905_0000094 | |||
| 1233 | Ga0395905_0001923 | |||
| 1234 | Ga0395905_0004005 | |||
| 1235 | Ga0395905_0014247 | |||
| 1236 | Ga0395905_0016641 | |||
| 1237 | Ga0395905_0016712 | |||
| 1238 | Ga0395905_0021348 | |||
| 1239 | Ga0395905_0024162 | |||
| 1240 | Ga0395905_0028215 | |||
| 1241 | Ga0395905_0066005 | |||
| 1242 | Ga0395905_0120879 | |||
| 1243 | Ga0395905_0160391 | |||
| 1244 | Ga0395905_0203178 | |||
| 1245 | Ga0395905_0213911 | |||
| 1246 | Ga0395905_0380168 | |||
| 1247 | Ga0395905_0397782 | |||
| 1248 | Ga0395905_0439035 | |||
| 1249 | Ga0395905_0466562 | |||
| 1250 | Ga0395901_0000228 | |||
| 1251 | Ga0395901_0002443 | |||
| 1252 | Ga0395901_0003671 | |||
| 1253 | Ga0395901_0008002 | |||
| 1254 | Ga0395901_0012539 | |||
| 1255 | Ga0395901_0041312 | |||
| 1256 | Ga0395901_0044513 | |||
| 1257 | Ga0395901_0061864 | |||
| 1258 | Ga0395901_0075485 | |||
| 1259 | Ga0395901_0076069 | |||
| 1260 | Ga0395901_0086429 | |||
| 1261 | Ga0395901_0139342 | |||
| 1262 | Ga0395901_0197458 | |||
| 1263 | Ga0395901_0234317 | |||
| 1264 | Ga0395901_0240762 | |||
| 1265 | Ga0395901_0287881 | |||
| 1266 | Ga0395901_0455821 | |||
| 1267 | Ga0395901_0529857 | |||
| 1268 | Ga0395901_0624640 | |||
| 1269 | Ga0395901_0752757 | |||
| 1270 | Ga0436360_0764336 | |||
| 1271 | Ga0436363_1352830 | |||
| 1272 | Ga0451807_0903417 | |||
| 1273 | Ga0439448_0002573 | |||
| 1274 | Ga0439449_0000498 | |||
| 1275 | Ga0439452_011492 | |||
| 1276 | Ga0439455_0000252 | |||
| 1277 | Ga0439458_0000255 | |||
| 1278 | Ga0439458_0006263 | |||
| 1279 | Ga0450908_025005 | |||
| 1280 | Ga0439464_0000114 | |||
| 1281 | Ga0439460_0046173 | |||
| 1282 | Ga0466963_0035095 | |||
| 1283 | Ga0466963_0083554 | |||
| 1284 | Ga0466957_0312078 | |||
| 1285 | Ga0466960_0036053 | |||
| 1286 | Ga0466959_0027362 | |||
| 1287 | Ga0466958_0145877 | |||
| 1288 | Ga0466967_0061960 | |||
| 1289 | Ga0466967_0072406 | |||
| 1290 | Ga0466967_0082937 | |||
| 1291 | Ga0466967_0086492 | |||
| 1292 | Ga0495627_000224 | |||
| 1293 | Ga0495627_000650 | |||
| 1294 | Ga0495592_0055356 | |||
| 1295 | Ga0495638_0004955 | |||
| 1296 | Ga0495651_0046190 | |||
| 1297 | Ga0495653_0041584 | |||
| 1298 | Ga0495650_0001756 | |||
| 1299 | Ga0495582_0063922 | |||
| 1300 | Ga0495639_0048020 | |||
| 1301 | Ga0495664_0039770 | |||
| 1302 | Ga0495594_0075152 | |||
| 1303 | Ga0495596_0006414 | |||
| 1304 | Ga0495608_0089155 | |||
| 1305 | Ga0495610_0001358 | |||
| 1306 | Ga0495610_0006803 | |||
| 1307 | Ga0495618_0023989 | |||
| 1308 | Ga0495618_0105126 | |||
| 1309 | Ga0495628_0096379 | |||
| 1310 | Ga0495637_0026938 | |||
| 1311 | Ga0495643_0000007 | |||
| 1312 | Ga0495643_0062327 | |||
| 1313 | Ga0495648_0007929 | |||
| 1314 | Ga0495666_0007474 | |||
| 1315 | Ga0495652_0049977 | |||
| 1316 | Ga0495640_0051265 | |||
| 1317 | Ga0495633_0041501 | |||
| 1318 | Ga0495667_0038098 | |||
| 1319 | Ga0495668_0118643 | |||
| 1320 | Ga0495625_0000025 | |||
| 1321 | Ga0495625_0000665 | |||
| 1322 | Ga0495625_0001685 | |||
| 1323 | Ga0495635_0036810 | |||
| 1324 | Ga0495588_0035246 | |||
| 1325 | Ga0495657_0037685 | |||
| 1326 | Ga0495599_0000776 | |||
| 1327 | Ga0495646_0035166 | |||
| 1328 | Ga0495669_0000556 | |||
| 1329 | Ga0495669_0037764 | |||
| 1330 | Ga0495670_0000014 | |||
| 1331 | Ga0495649_0012204 | |||
| 1332 | Ga0495674_0056993 | |||
| 1333 | Ga0495680_0032197 | |||
| 1334 | Ga0495673_0000078 | |||
| 1335 | Ga0495681_0000011 | |||
| 1336 | Ga0495684_0099297 | |||
| 1337 | Ga0495686_0000147 | |||
| 1338 | Ga0495686_0000661 | |||
| 1339 | Ga0495686_0121210 | |||
| 1340 | Ga0495686_0185313 | |||
| 1341 | Ga0496101_0073859 | |||
| 1342 | Ga0496102_0275836 | |||
| 1343 | Ga0496107_0032008 | |||
| 1344 | Ga0496107_0136217 | |||
| 1345 | Ga0496108_0033094 | |||
| 1346 | Ga0496108_0316070 | |||
| 1347 | Ga0496109_0180520 | |||
| 1348 | Ga0496110_0076090 | |||
| 1349 | Ga0496110_0130977 | |||
| 1350 | Ga0496111_0146163 | |||
| 1351 | Ga0496112_0027433 | |||
| 1352 | Ga0496112_0042055 | |||
| 1353 | Ga0496112_0182833 | |||
| 1354 | Ga0496112_0210036 | |||
| 1355 | Ga0496114_0090799 | |||
| 1356 | Ga0496117_0021492 | |||
| 1357 | Ga0496118_0001617 | |||
| 1358 | Ga0496120_0161911 | |||
| 1359 | Ga0496121_0000031 | |||
| 1360 | Ga0496121_0003131 | |||
| 1361 | Ga0496123_0002459 | |||
| 1362 | Ga0496124_0015727 | |||
| 1363 | Ga0496124_0142495 | |||
| 1364 | Ga0501031_0059130 | |||
| 1365 | Ga0501032_0053364 | |||
| 1366 | Ga0501033_0014079 | |||
| 1367 | Ga0501033_0054652 | |||
| 1368 | Ga0501033_0151270 | |||
| 1369 | Ga0501034_0005027 | |||
| 1370 | Ga0501034_0482573 | |||
| 1371 | Ga0501036_0282734 | |||
| 1372 | Ga0501038_0015781 | |||
| 1373 | Ga0501043_0020865 | |||
| 1374 | Ga0501043_0047606 | |||
| 1375 | Ga0501047_0001117 | |||
| 1376 | Ga0501047_0013021 | |||
| 1377 | Ga0501047_0040926 | |||
| 1378 | Ga0501067_0109079 | |||
| 1379 | Ga0501069_0036991 | |||
| 1380 | Ga0501070_0000020 | |||
| 1381 | Ga0501070_0061488 | |||
| 1382 | Ga0501080_0011676 | |||
| 1383 | Ga0501080_0075002 | |||
| 1384 | Ga0501083_0006223 | |||
| 1385 | Ga0501035_0006911 | |||
| 1386 | Ga0501035_0088838 | |||
| 1387 | Ga0501044_0014571 | |||
| 1388 | Ga0501044_0020893 | |||
| 1389 | Ga0501044_0078876 | |||
| 1390 | Ga0501044_0097527 | |||
| 1391 | Ga0501044_0202547 | |||
| 1392 | Ga0501044_0211422 | |||
| 1393 | nmdc:mga0k408_161782_c1 | |||
| 1394 | nmdc:mga0k408_25112_c1 | |||
| 1395 | nmdc:mga0k408_34852_c2 | |||
| 1396 | nmdc:mga04h51_59395_c1 | |||
| 1397 | nmdc:mga07m45_2_c1 | |||
| 1398 | nmdc:mga06r32_145461_c1 | |||
| 1399 | nmdc:mga08x19_143565_c1 | |||
| 1400 | nmdc:mga0a205_5975_c1 | |||
| 1401 | Ga0495601_0009915 | |||
| 1402 | Ga0495601_0011636 | |||
| 1403 | Ga0495595_0028222 | |||
| 1404 | Ga0495619_0164263 | |||
| 1405 | Ga0500641_0021781 | |||
| 1406 | Ga0500562_002575 | |||
| 1407 | Ga0500593_074444 | |||
| 1408 | Ga0500597_024094 | |||
| 1409 | Ga0500618_000514 | |||
| 1410 | Ga0500559_0004706 | |||
| 1411 | Ga0500559_0022361 | |||
| 1412 | Ga0500616_0008861 | |||
| 1413 | Ga0500622_0034813 | |||
| 1414 | Ga0500624_000020 | |||
| 1415 | Ga0500637_0000022 | |||
| 1416 | Ga0501084_0000171 | |||
| 1417 | 2511120387 | |||
| 1418 | 2511130088 | |||
| 1419 | 2643924796 | |||
| 1420 | 2738745027 | |||
| 1421 | 2739354257 | |||
| 1422 | 2793978932 | |||
| 1423 | 2830076896 | |||
| 1424 | 2885430718 | |||
| 1425 | 2919514470 | |||
| 1426 | 2919678829 | |||
| 1427 | 2946789656 | |||
| 1428 | 8048137243 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pvi-assembly1.cif.gz_A | crystal structure of phqk in complex with paraherquamide l | 0.9498 | 1 | 32 |
| 5y7a-assembly1.cif.gz_A | crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn | 0.9496 | 2 | 31 |
| 6foy-assembly2.cif.gz_B | the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 9 | 0.9484 | 1 | 31 |
| 6foz-assembly1.cif.gz_A | the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 | 0.9482 | 2 | 31 |
| 6ici-assembly1.cif.gz_A | crystal structure of human mical3 | 0.9391 | 2 | 31 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 1 | 178 | 3.40.50.720 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9411 | 1 | 137 | 3.40.50.720 |
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9384 | 1 | 178 | 3.40.50.720 |
| 5nahA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9371 | 2 | 31 | 3.50.50.60 |
| 3rp8A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9309 | 2 | 30 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2WQY9-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9956 | 1 | 115 |
GO:0004616
GO:0050661 |
| AF-A0A0L0LZ89-F1-model_v4 | deleted | 0.9934 | 1 | 115 |
|
| AF-A0A6I5CPF4-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9917 | 47 | 154 |
GO:0004616
GO:0050661 |
| AF-A0A7W0X915-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.991 | 1 | 134 |
GO:0004616
GO:0050661 |
| AF-A0A525I822-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9903 | 1 | 88 |
GO:0004616
GO:0050661 |