F477144

General Info

Members Datasets Scaffolds Average Seq Length
718 343 1436 252

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100560360|Ga0070708_1005603602
Length 266
Sequence MRRTNFVHCDQWGYHEKVLAHCSRIDAGLCMSPFADLQATELKILAGGSMTGSLNELGPQFERASGHKLTIHFDSTPNLIKQATSGEPFDLAVVPVDVFKDTAAKARFVPGPTIDIARVCYGVIVRAGTPKPDVSTPDALKQTLLNAQSITFLPESAAGAYVLSVFSRLGISEAMKAKTRPQAAPAQIAHAVAKGEADLGVFLVNVLIAPGVELAGPFPAELQQELVFTSAVAADSKNAEAAKAFINYLMTPTAAAVIKAKGMAPG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
332 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 12.26
Rhizosphere 77.72
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100560360 3300005445 Bacteria 1078
2 JGI24746J21847_1003828 3300001977 Bacteria 2377
3 JGI24737J22298_10020484 3300001990 Bacteria 2111
4 JGI24748J21848_1000524 3300002074 Bacteria 4194
5 JGI24738J21930_10017382 3300002075 Bacteria 1512
6 JGI24744J21845_10004801 3300002077 Bacteria 2795
7 JGI25404J52841_10003853 3300003659 Bacteria 3000
8 JGI25404J52841_10015330 3300003659 Bacteria 1663
9 JGI25405J52794_10045588 3300003911 Bacteria 933
10 Ga0070690_100021813 3300005330 Bacteria 3914
11 Ga0070670_100201244 3300005331 Bacteria 1730
12 Ga0070670_100531736 3300005331 Bacteria 1048
13 Ga0070677_10172808 3300005333 Bacteria 1023
14 Ga0070677_10209931 3300005333 Unclassified 945
15 Ga0068869_100277372 3300005334 Bacteria 1347
16 Ga0070666_10071962 3300005335 Bacteria 2354
17 Ga0070666_10237672 3300005335 Bacteria 1288
18 Ga0070680_100268906 3300005336 Bacteria 1443
19 Ga0070682_100122410 3300005337 Bacteria 1749
20 Ga0070682_100280581 3300005337 Bacteria 1214
21 Ga0068868_100022399 3300005338 Bacteria 4767
22 Ga0068868_100389111 3300005338 Bacteria 1201
23 Ga0068868_100521008 3300005338 Bacteria 1044
24 Ga0070660_100098830 3300005339 Bacteria 2310
25 Ga0070660_100112646 3300005339 Bacteria 2166
26 Ga0070689_100001662 3300005340 Bacteria 14205
27 Ga0070691_10011614 3300005341 Bacteria 4023
28 Ga0070687_100029272 3300005343 Bacteria 2680
29 Ga0070687_100092025 3300005343 Bacteria 1680
30 Ga0070661_100036904 3300005344 Bacteria 3554
31 Ga0070661_100267371 3300005344 Bacteria 1323
32 Ga0070661_100371460 3300005344 Bacteria 1126
33 Ga0070692_10027176 3300005345 Bacteria 2834
34 Ga0070668_100038142 3300005347 Bacteria 3671
35 Ga0070668_100343820 3300005347 Bacteria 1261
36 Ga0070669_100069685 3300005353 Bacteria 2598
37 Ga0070669_100096099 3300005353 Bacteria 2229
38 Ga0070675_100047606 3300005354 Bacteria 3513
39 Ga0070675_100728943 3300005354 Unclassified 904
40 Ga0070671_100019919 3300005355 Bacteria 5465
41 Ga0070671_100027961 3300005355 Bacteria 4643
42 Ga0070674_100027518 3300005356 Bacteria 3727
43 Ga0070674_100086602 3300005356 Bacteria 2250
44 Ga0070673_100230069 3300005364 Bacteria 1608
45 Ga0070688_100065983 3300005365 Bacteria 2302
46 Ga0070688_100174912 3300005365 Bacteria 1485
47 Ga0070688_100317403 3300005365 Unclassified 1131
48 Ga0070659_100058345 3300005366 Bacteria 3046
49 Ga0070667_100015429 3300005367 Bacteria 6316
50 Ga0070667_100162617 3300005367 Bacteria 1967
51 Ga0070667_100280910 3300005367 Bacteria 1495
52 Ga0070714_100240437 3300005435 Bacteria 1671
53 Ga0070713_100232416 3300005436 Bacteria 1677
54 Ga0070713_100391914 3300005436 Bacteria 1296
55 Ga0070713_100743772 3300005436 Bacteria 938
56 Ga0070701_10006562 3300005438 Bacteria 4905
57 Ga0070701_10261592 3300005438 Bacteria 1049
58 Ga0070705_100094405 3300005440 Bacteria 1873
59 Ga0070700_100062136 3300005441 Bacteria 2359
60 Ga0070663_100076740 3300005455 Bacteria 2444
61 Ga0070663_100123633 3300005455 Bacteria 1957
62 Ga0070663_100173931 3300005455 Bacteria 1666
63 Ga0070678_100019754 3300005456 Bacteria 4403
64 Ga0070678_100067401 3300005456 Bacteria 2664
65 Ga0070678_100164381 3300005456 Bacteria 1801
66 Ga0070662_100148845 3300005457 Bacteria 1820
67 Ga0070662_100216435 3300005457 Bacteria 1526
68 Ga0068867_100058761 3300005459 Bacteria 2850
69 Ga0068867_100203594 3300005459 Bacteria 1586
70 Ga0070685_10072406 3300005466 Bacteria 2046
71 Ga0070698_100115178 3300005471 Bacteria 2653
72 Ga0070679_100608630 3300005530 Bacteria 1036
73 Ga0070684_100035117 3300005535 Bacteria 4289
74 Ga0070684_100107553 3300005535 Bacteria 2498
75 Ga0070697_100396478 3300005536 Bacteria 1197
76 Ga0068853_100156895 3300005539 Bacteria 2051
77 Ga0068853_100309214 3300005539 Bacteria 1463
78 Ga0068853_100641073 3300005539 Bacteria 1011
79 Ga0070672_100003299 3300005543 Bacteria 10449
80 Ga0070696_100146186 3300005546 Bacteria 1732
81 Ga0070693_100111908 3300005547 Bacteria 1681
82 Ga0070693_100164847 3300005547 Bacteria 1414
83 Ga0070693_100275982 3300005547 Bacteria 1124
84 Ga0070665_100041916 3300005548 Bacteria 4601
85 Ga0070665_100153300 3300005548 Bacteria 2306
86 Ga0070665_100597368 3300005548 Bacteria 1117
87 Ga0070664_100036292 3300005564 Bacteria 4140
88 Ga0070664_100102739 3300005564 Bacteria 2487
89 Ga0068857_100500721 3300005577 Bacteria 1140
90 Ga0068854_100061089 3300005578 Bacteria 2728
91 Ga0068854_100175615 3300005578 Bacteria 1670
92 Ga0068856_100003347 3300005614 Bacteria 16276
93 Ga0068856_100312836 3300005614 Bacteria 1588
94 Ga0068856_100379643 3300005614 Bacteria 1432
95 Ga0068852_100046625 3300005616 Bacteria 3694
96 Ga0068852_100129085 3300005616 Bacteria 2325
97 Ga0068859_100021148 3300005617 Bacteria 6529
98 Ga0068859_100163980 3300005617 Bacteria 2301
99 Ga0068864_100006339 3300005618 Bacteria 9703
100 Ga0068864_100089179 3300005618 Bacteria 2717
101 Ga0068864_100423324 3300005618 Bacteria 1269
102 Ga0068866_10004065 3300005718 Bacteria 6005
103 Ga0068861_100043820 3300005719 Bacteria 3361
104 Ga0068861_100190918 3300005719 Bacteria 1712
105 Ga0068861_100226964 3300005719 Bacteria 1582
106 Ga0068861_100393163 3300005719 Bacteria 1228
107 Ga0068861_100472242 3300005719 Bacteria 1128
108 Ga0068870_10116407 3300005840 Bacteria 1533
109 Ga0068863_100005456 3300005841 Bacteria 12531
110 Ga0068860_100008760 3300005843 Bacteria 10078
111 Ga0068860_100081543 3300005843 Bacteria 3076
112 Ga0068860_100100065 3300005843 Bacteria 2765
113 Ga0068862_100061588 3300005844 Bacteria 3226
114 Ga0068862_100098063 3300005844 Bacteria 2560
115 Ga0068862_100268495 3300005844 Bacteria 1559
116 Ga0068862_100271003 3300005844 Bacteria 1552
117 Ga0081455_10001734 3300005937 Bacteria 26379
118 Ga0081455_10015026 3300005937 Bacteria 7541
119 Ga0081455_10017479 3300005937 Bacteria 6872
120 Ga0081455_10040027 3300005937 Bacteria 4137
121 Ga0081455_10343491 3300005937 Bacteria 1055
122 Ga0081540_1000007 3300005983 Bacteria 205328
123 Ga0081540_1000105 3300005983 Bacteria 89863
124 Ga0081540_1003965 3300005983 Bacteria 11501
125 Ga0081540_1026858 3300005983 Bacteria 3275
126 Ga0070717_10064461 3300006028 Bacteria 3043
127 Ga0070717_10663546 3300006028 Bacteria 947
128 Ga0075365_10222696 3300006038 Bacteria 1324
129 Ga0075365_10263989 3300006038 Bacteria 1211
130 Ga0075365_10288284 3300006038 Bacteria 1155
131 Ga0075368_10031919 3300006042 Bacteria 2044
132 Ga0075368_10078818 3300006042 Bacteria 1338
133 Ga0075363_100033900 3300006048 Bacteria 2663
134 Ga0075363_100234600 3300006048 Bacteria 1054
135 Ga0070716_100170099 3300006173 Bacteria 1421
136 Ga0070712_100055550 3300006175 Bacteria 2774
137 Ga0070712_100080564 3300006175 Bacteria 2357
138 Ga0075362_10040333 3300006177 Bacteria 2056
139 Ga0075367_10068817 3300006178 Bacteria 2124
140 Ga0075367_10081807 3300006178 Bacteria 1954
141 Ga0075367_10162074 3300006178 Bacteria 1391
142 Ga0075367_10184526 3300006178 Bacteria 1301
143 Ga0075366_10062746 3300006195 Bacteria 2208
144 Ga0097621_100008674 3300006237 Bacteria 7339
145 Ga0097621_100100345 3300006237 Bacteria 2435
146 Ga0075370_10148644 3300006353 Bacteria 1373
147 Ga0068871_100026031 3300006358 Bacteria 4560
148 Ga0068871_100326895 3300006358 Bacteria 1352
149 Ga0068871_100610559 3300006358 Bacteria 992
150 Ga0075428_100027523 3300006844 Bacteria 6290
151 Ga0075430_100084022 3300006846 Bacteria 2667
152 Ga0075431_100122877 3300006847 Bacteria 2679
153 Ga0075431_100183347 3300006847 Bacteria 2148
154 Ga0075433_10027057 3300006852 Bacteria 4862
155 Ga0075434_100012519 3300006871 Bacteria 8046
156 Ga0075434_100014111 3300006871 Bacteria 7630
157 Ga0075434_100225504 3300006871 Bacteria 1893
158 Ga0075429_100472408 3300006880 Bacteria 1099
159 Ga0068865_100095558 3300006881 Bacteria 2165
160 Ga0068865_100467611 3300006881 Unclassified 1046
161 Ga0097620_100021146 3300006931 Bacteria 6529
162 Ga0097620_100163987 3300006931 Bacteria 2301
163 Ga0099794_10066421 3300007265 Bacteria 1760
164 Ga0099794_10163626 3300007265 Bacteria 1132
165 Ga0099795_10031853 3300007788 Bacteria 1819
166 Ga0105240_10255829 3300009093 Bacteria 2022
167 Ga0111539_10076949 3300009094 Bacteria 3928
168 Ga0111539_10293057 3300009094 Bacteria 1893
169 Ga0111539_10567908 3300009094 Bacteria 1321
170 Ga0105245_10027586 3300009098 Bacteria 5003
171 Ga0105245_10063788 3300009098 Bacteria 3328
172 Ga0105245_10258761 3300009098 Bacteria 1693
173 Ga0105247_10012572 3300009101 Bacteria 5084
174 Ga0114129_10050640 3300009147 Bacteria 5833
175 Ga0114129_10619074 3300009147 Bacteria 1401
176 Ga0105243_10020756 3300009148 Bacteria 4984
177 Ga0105243_10107981 3300009148 Bacteria 2323
178 Ga0105243_10420351 3300009148 Bacteria 1247
179 Ga0105243_10442065 3300009148 Bacteria 1218
180 Ga0105241_10093808 3300009174 Bacteria 2373
181 Ga0105241_10418413 3300009174 Bacteria 1179
182 Ga0105242_10085438 3300009176 Bacteria 2646
183 Ga0105248_10090371 3300009177 Bacteria 3448
184 Ga0105248_10095524 3300009177 Bacteria 3347
185 Ga0105248_10234721 3300009177 Bacteria 2065
186 Ga0105248_10283841 3300009177 Bacteria 1864
187 Ga0105248_10454036 3300009177 Bacteria 1444
188 Ga0105237_10059660 3300009545 Bacteria 3816
189 Ga0105237_10134764 3300009545 Bacteria 2464
190 Ga0105237_10625038 3300009545 Bacteria 1084
191 Ga0105238_10049666 3300009551 Bacteria 4224
192 Ga0105238_10232933 3300009551 Bacteria 1818
193 Ga0105238_10763859 3300009551 Bacteria 981
194 Ga0105249_10166479 3300009553 Bacteria 2134
195 Ga0105249_10218549 3300009553 Bacteria 1874
196 Ga0105249_10228388 3300009553 Bacteria 1835
197 Ga0099796_10026830 3300010159 Bacteria 1834
198 Ga0099796_10126705 3300010159 Bacteria 986
199 Ga0105239_10083385 3300010375 Bacteria 3520
200 Ga0105239_10146039 3300010375 Bacteria 2638
201 Ga0105239_10338932 3300010375 Bacteria 1696
202 Ga0105239_10569234 3300010375 Bacteria 1291
203 Ga0105246_10015760 3300011119 Bacteria 4778
204 Ga0157370_10556305 3300013104 Bacteria 1052
205 Ga0157374_10003239 3300013296 Bacteria 13672
206 Ga0157374_10200703 3300013296 Bacteria 1953
207 Ga0157374_10508647 3300013296 Bacteria 1210
208 Ga0157378_10009041 3300013297 Bacteria 8671
209 Ga0157378_10066261 3300013297 Bacteria 3234
210 Ga0157378_10552613 3300013297 Bacteria 1157
211 Ga0163162_10212560 3300013306 Bacteria 2064
212 Ga0163162_10386812 3300013306 Bacteria 1532
213 Ga0163162_10659944 3300013306 Bacteria 1169
214 Ga0163162_11048056 3300013306 Unclassified 923
215 Ga0157375_10047518 3300013308 Bacteria 4192
216 Ga0157375_10103459 3300013308 Bacteria 2935
217 Ga0157375_10156349 3300013308 Bacteria 2419
218 Ga0157375_10201898 3300013308 Bacteria 2144
219 Ga0157375_11166684 3300013308 Bacteria 903
220 Ga0163163_10014945 3300014325 Bacteria 7154
221 Ga0163163_10015790 3300014325 Bacteria 6993
222 Ga0163163_10038493 3300014325 Bacteria 4662
223 Ga0163163_10092019 3300014325 Bacteria 3047
224 Ga0157380_10327978 3300014326 Bacteria 1422
225 Ga0157377_10044111 3300014745 Bacteria 2485
226 Ga0157379_10043542 3300014968 Bacteria 4008
227 Ga0157376_10025997 3300014969 Bacteria 4619
228 Ga0157376_10047907 3300014969 Bacteria 3531
229 Ga0157376_10240321 3300014969 Bacteria 1687
230 Ga0157376_10391642 3300014969 Bacteria 1341
231 Ga0157376_10414288 3300014969 Bacteria 1306
232 Ga0209758_1000125 3300025297 Bacteria 189869
233 Ga0207697_10062448 3300025315 Bacteria 1551
234 Ga0207682_10209306 3300025893 Unclassified 899
235 Ga0207642_10003991 3300025899 Bacteria 4709
236 Ga0207642_10176595 3300025899 Bacteria 1160
237 Ga0207710_10005716 3300025900 Bacteria 5341
238 Ga0207710_10197622 3300025900 Bacteria 992
239 Ga0207688_10004677 3300025901 Bacteria 7461
240 Ga0207688_10072244 3300025901 Bacteria 1960
241 Ga0207688_10144546 3300025901 Bacteria 1401
242 Ga0207680_10217828 3300025903 Bacteria 1307
243 Ga0207645_10007388 3300025907 Bacteria 7770
244 Ga0207645_10116104 3300025907 Bacteria 1735
245 Ga0207645_10339229 3300025907 Bacteria 1004
246 Ga0207643_10000794 3300025908 Bacteria 19261
247 Ga0207654_10115797 3300025911 Bacteria 1675
248 Ga0207671_10117360 3300025914 Bacteria 2031
249 Ga0207671_10214644 3300025914 Bacteria 1506
250 Ga0207693_10033602 3300025915 Bacteria 4046
251 Ga0207663_10037576 3300025916 Bacteria 2920
252 Ga0207660_10327421 3300025917 Bacteria 1224
253 Ga0207662_10000424 3300025918 Bacteria 18665
254 Ga0207662_10102114 3300025918 Bacteria 1778
255 Ga0207662_10220715 3300025918 Bacteria 1234
256 Ga0207657_10093633 3300025919 Bacteria 2502
257 Ga0207657_10111110 3300025919 Bacteria 2263
258 Ga0207649_10016093 3300025920 Bacteria 4212
259 Ga0207649_10330285 3300025920 Bacteria 1123
260 Ga0207649_10418610 3300025920 Bacteria 1006
261 Ga0207652_10011695 3300025921 Bacteria 7082
262 Ga0207652_10319609 3300025921 Bacteria 1401
263 Ga0207681_10113290 3300025923 Bacteria 1977
264 Ga0207694_10029408 3300025924 Bacteria 4193
265 Ga0207694_10422766 3300025924 Bacteria 1110
266 Ga0207650_10019548 3300025925 Bacteria 4762
267 Ga0207650_10472360 3300025925 Unclassified 1046
268 Ga0207659_10024969 3300025926 Bacteria 4011
269 Ga0207687_10020983 3300025927 Bacteria 4337
270 Ga0207687_10066178 3300025927 Bacteria 2568
271 Ga0207700_10157416 3300025928 Bacteria 1884
272 Ga0207700_10546522 3300025928 Bacteria 1028
273 Ga0207700_10576234 3300025928 Bacteria 1000
274 Ga0207664_10729915 3300025929 Bacteria 891
275 Ga0207644_10015484 3300025931 Bacteria 5120
276 Ga0207644_10029172 3300025931 Bacteria 3825
277 Ga0207706_10018822 3300025933 Bacteria 6211
278 Ga0207686_10167007 3300025934 Bacteria 1548
279 Ga0207709_10017967 3300025935 Bacteria 3955
280 Ga0207709_10153042 3300025935 Bacteria 1600
281 Ga0207670_10053842 3300025936 Bacteria 2713
282 Ga0207670_10087056 3300025936 Bacteria 2200
283 Ga0207704_10071538 3300025938 Bacteria 2201
284 Ga0207704_10206741 3300025938 Bacteria 1441
285 Ga0207704_10614655 3300025938 Unclassified 891
286 Ga0207665_10113190 3300025939 Bacteria 1909
287 Ga0207691_10002691 3300025940 Bacteria 17379
288 Ga0207711_10022868 3300025941 Bacteria 5232
289 Ga0207711_10087104 3300025941 Bacteria 2739
290 Ga0207689_10088660 3300025942 Bacteria 2541
291 Ga0207689_10126834 3300025942 Bacteria 2099
292 Ga0207689_10278928 3300025942 Bacteria 1384
293 Ga0207661_10014563 3300025944 Bacteria 5769
294 Ga0207679_10028966 3300025945 Bacteria 3850
295 Ga0207679_10176092 3300025945 Bacteria 1766
296 Ga0207667_10228090 3300025949 Bacteria 1907
297 Ga0207651_10250583 3300025960 Bacteria 1449
298 Ga0207712_10021041 3300025961 Bacteria 4278
299 Ga0207712_10189533 3300025961 Bacteria 1622
300 Ga0207712_10231411 3300025961 Bacteria 1484
301 Ga0207668_10154049 3300025972 Bacteria 1783
302 Ga0207640_10234715 3300025981 Bacteria 1413
303 Ga0207677_10011070 3300026023 Bacteria 5127
304 Ga0207677_10218335 3300026023 Bacteria 1527
305 Ga0207677_10242156 3300026023 Bacteria 1460
306 Ga0207677_10539596 3300026023 Bacteria 1015
307 Ga0207703_10517122 3300026035 Bacteria 1122
308 Ga0207639_10054996 3300026041 Bacteria 3044
309 Ga0207639_10101798 3300026041 Bacteria 2324
310 Ga0207639_10207058 3300026041 Bacteria 1686
311 Ga0207678_10003923 3300026067 Bacteria 13383
312 Ga0207678_10060137 3300026067 Bacteria 3268
313 Ga0207678_10246715 3300026067 Bacteria 1529
314 Ga0207678_10321441 3300026067 Bacteria 1331
315 Ga0207708_10000784 3300026075 Bacteria 23952
316 Ga0207708_10028255 3300026075 Bacteria 4247
317 Ga0207708_10115077 3300026075 Bacteria 2091
318 Ga0207708_10189790 3300026075 Bacteria 1635
319 Ga0207702_10000548 3300026078 Bacteria 41978
320 Ga0207702_10033740 3300026078 Bacteria 4276
321 Ga0207702_10251491 3300026078 Bacteria 1660
322 Ga0207641_10006530 3300026088 Bacteria 9810
323 Ga0207648_10002310 3300026089 Bacteria 20581
324 Ga0207648_10229800 3300026089 Bacteria 1650
325 Ga0207676_10002295 3300026095 Bacteria 13719
326 Ga0207676_10108437 3300026095 Bacteria 2318
327 Ga0207676_10218661 3300026095 Bacteria 1695
328 Ga0207674_10135379 3300026116 Bacteria 2426
329 Ga0207675_100002371 3300026118 Bacteria 18651
330 Ga0207675_100112829 3300026118 Bacteria 2566
331 Ga0207675_100130814 3300026118 Bacteria 2380
332 Ga0207683_10019832 3300026121 Bacteria 5743
333 Ga0207683_10021694 3300026121 Bacteria 5504
334 Ga0207683_10040045 3300026121 Bacteria 4087
335 Ga0207683_10124367 3300026121 Bacteria 2317
336 Ga0207683_10184101 3300026121 Bacteria 1894
337 Ga0207698_10034409 3300026142 Bacteria 3693
338 Ga0207698_10457529 3300026142 Bacteria 1233
339 Ga0209179_1015555 3300027512 Bacteria 1415
340 Ga0209588_1009865 3300027671 Bacteria 2862
341 Ga0209813_10065818 3300027866 Bacteria 1168
342 Ga0268266_10165814 3300028379 Bacteria 2001
343 Ga0268266_10275628 3300028379 Bacteria 1563
344 Ga0268266_10594340 3300028379 Bacteria 1063
345 Ga0268265_10013453 3300028380 Bacteria 5560
346 Ga0268265_10063828 3300028380 Bacteria 2835
347 Ga0268265_10070998 3300028380 Bacteria 2710
348 Ga0268265_10516126 3300028380 Bacteria 1129
349 Ga0268264_10042233 3300028381 Bacteria 3775
350 Ga0268264_10296560 3300028381 Bacteria 1520
351 Ga0265334_10008302 3300028573 Bacteria 4418
352 Ga0307517_10039620 3300028786 Bacteria 5167
353 Ga0307515_10006012 3300028794 Bacteria 24419
354 Ga0265330_10070693 3300031235 Bacteria 1510
355 Ga0265332_10001513 3300031238 Bacteria 12909
356 Ga0265332_10005019 3300031238 Bacteria 6151
357 Ga0265332_10032406 3300031238 Bacteria 2278
358 Ga0265325_10088971 3300031241 Bacteria 1525
359 Ga0265329_10010128 3300031242 Bacteria 3478
360 Ga0265329_10014396 3300031242 Bacteria 2795
361 Ga0265340_10005971 3300031247 Bacteria 6729
362 Ga0265339_10004623 3300031249 Bacteria 9354
363 Ga0265339_10005449 3300031249 Bacteria 8477
364 Ga0265331_10029831 3300031250 Bacteria 2720
365 Ga0265331_10031762 3300031250 Bacteria 2622
366 Ga0265331_10101952 3300031250 Bacteria 1320
367 Ga0265331_10249441 3300031250 Bacteria 796
368 Ga0265316_10046003 3300031344 Bacteria 3461
369 Ga0307509_10135476 3300031507 Bacteria 2409
370 Ga0307508_10000032 3300031616 Bacteria 163293
371 Ga0265314_10004484 3300031711 Bacteria 12947
372 Ga0265314_10042579 3300031711 Bacteria 3237
373 Ga0265342_10002428 3300031712 Bacteria 16105
374 Ga0265342_10005254 3300031712 Bacteria 9929
375 Ga0265342_10160721 3300031712 Bacteria 1242
376 Ga0307516_10126244 3300031730 Bacteria 2343
377 Ga0307510_10016157 3300033180 Bacteria 8816
378 Ga0373948_0033716 3300034817 Bacteria 1044
379 Ga0373934_0123469 3300035086 Bacteria 1054
380 Ga0373923_0001173 3300035111 Bacteria 7304
381 Ga0373936_0242128 3300035113 Bacteria 804
382 Ga0373945_0001390 3300035116 Bacteria 7348
383 Ga0373945_0036020 3300035116 Bacteria 1771
384 Ga0373953_0003727 3300035117 Bacteria 4785
385 Ga0373954_0299384 3300035118 Bacteria 793
386 Ga0373943_0008899 3300035170 Bacteria 4498
387 Ga0373946_0012725 3300035171 Bacteria 3153
388 Ga0373955_0002349 3300035172 Bacteria 8228
389 Ga0373955_0088500 3300035172 Bacteria 1761
390 Ga0373961_0021624 3300035241 Bacteria 1713
391 Ga0373924_0002221 3300035410 Bacteria 6504
392 Ga0373924_0017333 3300035410 Bacteria 2762
393 Ga0373931_0057519 3300035691 Bacteria 2086
394 Ga0373935_0000291 3300035692 Bacteria 24802
395 Ga0373935_0027445 3300035692 Bacteria 3518
396 Ga0373935_0428586 3300035692 Bacteria 953
397 Ga0373927_0002882 3300035695 Bacteria 12525
398 Ga0373927_0010828 3300035695 Bacteria 6076
399 Ga0373927_0013220 3300035695 Bacteria 5489
400 Ga0373927_0017091 3300035695 Bacteria 4780
401 Ga0373927_0025259 3300035695 Bacteria 3882
402 Ga0373927_0173228 3300035695 Bacteria 1415
403 Ga0373927_0330621 3300035695 Bacteria 1004
404 Ga0373933_0191541 3300035724 Bacteria 1306
405 Ga0373947_0005730 3300035725 Bacteria 7243
406 Ga0373947_0010154 3300035725 Bacteria 5407
407 Ga0373947_0024192 3300035725 Bacteria 3537
408 Ga0373947_0025283 3300035725 Bacteria 3462
409 Ga0373947_0028707 3300035725 Bacteria 3263
410 Ga0373947_0036395 3300035725 Bacteria 2919
411 Ga0373947_0205031 3300035725 Bacteria 1291
412 Ga0373937_0000004 3300036401 Bacteria 212269
413 Ga0373937_0007886 3300036401 Bacteria 9228
414 Ga0373937_0033145 3300036401 Bacteria 4689
415 Ga0373937_0325797 3300036401 Unclassified 1454
416 Ga0373937_0612864 3300036401 Bacteria 1033
417 Ga0373925_0000460 3300037068 Bacteria 41057
418 Ga0373925_0012254 3300037068 Bacteria 6204
419 Ga0373925_0023291 3300037068 Bacteria 4519
420 Ga0373925_0090021 3300037068 Bacteria 2345
421 Ga0373925_0096835 3300037068 Bacteria 2263
422 Ga0373925_0108321 3300037068 Bacteria 2144
423 Ga0373925_0118203 3300037068 Bacteria 2055
424 Ga0373925_0210499 3300037068 Bacteria 1549
425 Ga0373925_0505692 3300037068 Bacteria 992
426 Ga0373925_0507438 3300037068 Bacteria 990
427 Ga0436363_0335374 3300039450 Unclassified 2702
428 Ga0451798_0887340 3300041458 Unclassified 909
429 Ga0451843_0872454 3300041509 Bacteria 829
430 Ga0466963_0427385 3300044694 Bacteria 934
431 Ga0466967_0067366 3300045976 Bacteria 3193
432 Ga0495617_021764 3300046452 Bacteria 2166
433 Ga0495627_093152 3300046453 Bacteria 865
434 Ga0495592_0000029 3300046454 Bacteria 131879
435 Ga0495603_0000217 3300046455 Bacteria 29788
436 Ga0495603_0039310 3300046455 Bacteria 2835
437 Ga0495603_0050966 3300046455 Bacteria 2460
438 Ga0495603_0052598 3300046455 Bacteria 2417
439 Ga0495603_0062923 3300046455 Bacteria 2190
440 Ga0495629_0000862 3300046459 Bacteria 24478
441 Ga0495629_0257994 3300046459 Bacteria 1198
442 Ga0495638_0103778 3300046460 Bacteria 1697
443 Ga0495638_0189245 3300046460 Bacteria 1169
444 Ga0495641_0003672 3300046461 Bacteria 11330
445 Ga0495641_0017426 3300046461 Bacteria 3744
446 Ga0495641_0019640 3300046461 Bacteria 3450
447 Ga0495641_0158565 3300046461 Bacteria 1012
448 Ga0495651_0001409 3300046462 Bacteria 18662
449 Ga0495653_0000012 3300046463 Bacteria 266880
450 Ga0495650_0060149 3300046471 Bacteria 1527
451 Ga0495580_0005364 3300046472 Bacteria 10616
452 Ga0495580_0047602 3300046472 Bacteria 3039
453 Ga0495580_0293655 3300046472 Bacteria 1108
454 Ga0495582_0000990 3300046473 Bacteria 15910
455 Ga0495582_0025773 3300046473 Bacteria 3221
456 Ga0495582_0226321 3300046473 Bacteria 1071
457 Ga0495605_0026778 3300046474 Bacteria 2994
458 Ga0495605_0176373 3300046474 Bacteria 942
459 Ga0495639_0000544 3300046475 Bacteria 17562
460 Ga0495639_0021776 3300046475 Bacteria 2808
461 Ga0495639_0056218 3300046475 Bacteria 1796
462 Ga0495662_0010406 3300046476 Bacteria 4557
463 Ga0495664_0000004 3300046477 Bacteria 489411
464 Ga0495664_0001505 3300046477 Bacteria 12344
465 Ga0495664_0082445 3300046477 Bacteria 1929
466 Ga0495664_0157547 3300046477 Bacteria 1378
467 Ga0495664_0319671 3300046477 Bacteria 936
468 Ga0495584_0017649 3300046491 Bacteria 3631
469 Ga0495584_0062283 3300046491 Bacteria 1875
470 Ga0495584_0243886 3300046491 Bacteria 914
471 Ga0495585_0113784 3300046492 Bacteria 1437
472 Ga0495594_0000128 3300046499 Bacteria 35750
473 Ga0495608_0000017 3300046511 Bacteria 192929
474 Ga0495608_0147239 3300046511 Bacteria 1502
475 Ga0495616_0049664 3300046513 Bacteria 2102
476 Ga0495618_0000006 3300046514 Bacteria 229906
477 Ga0495618_0066500 3300046514 Bacteria 2291
478 Ga0495618_0277958 3300046514 Bacteria 1045
479 Ga0495620_0078562 3300046515 Bacteria 1338
480 Ga0495628_0000001 3300046516 Bacteria 917742
481 Ga0495630_0120545 3300046517 Bacteria 1990
482 Ga0495630_0453158 3300046517 Bacteria 983
483 Ga0495631_0205868 3300046518 Bacteria 841
484 Ga0495632_0090785 3300046519 Bacteria 1448
485 Ga0495644_0069798 3300046523 Bacteria 1320
486 Ga0495663_0123259 3300046525 Bacteria 869
487 Ga0495666_0070401 3300046526 Bacteria 1663
488 Ga0495652_0000002 3300046529 Bacteria 946606
489 Ga0495665_0006186 3300046531 Bacteria 6465
490 Ga0495665_0094072 3300046531 Bacteria 1575
491 Ga0495665_0211751 3300046531 Bacteria 1003
492 Ga0495640_0000001 3300046533 Bacteria 853827
493 Ga0495640_0002595 3300046533 Bacteria 14526
494 Ga0495640_0119257 3300046533 Bacteria 1717
495 Ga0495586_0142836 3300046535 Bacteria 1344
496 Ga0495587_0000008 3300046536 Bacteria 271097
497 Ga0495598_0001556 3300046537 Bacteria 4597
498 Ga0495645_0000002 3300046543 Bacteria 651644
499 Ga0495622_0037475 3300046557 Bacteria 2259
500 Ga0495622_0071643 3300046557 Bacteria 1599
501 Ga0495667_0000029 3300046559 Bacteria 151568
502 Ga0495656_0020279 3300046615 Bacteria 2577
503 Ga0495668_0055390 3300046616 Bacteria 2190
504 Ga0495634_0001583 3300046642 Bacteria 19998
505 Ga0495611_0208317 3300046648 Bacteria 911
506 Ga0495625_0068851 3300046660 Bacteria 2487
507 Ga0495635_0000002 3300046663 Bacteria 490490
508 Ga0495635_0000436 3300046663 Bacteria 26341
509 Ga0495661_0100548 3300046665 Bacteria 1628
510 Ga0495588_0076469 3300046674 Bacteria 1745
511 Ga0495588_0198910 3300046674 Bacteria 1058
512 Ga0495657_0000459 3300046675 Bacteria 38116
513 Ga0495599_0000104 3300046678 Bacteria 59442
514 Ga0495623_0000691 3300046679 Bacteria 22400
515 Ga0495646_0000064 3300046680 Bacteria 50992
516 Ga0495647_0000394 3300046681 Bacteria 12460
517 Ga0495658_0003203 3300046683 Bacteria 8153
518 Ga0495658_0080898 3300046683 Bacteria 1906
519 Ga0495658_0086047 3300046683 Bacteria 1854
520 Ga0495658_0226303 3300046683 Bacteria 1172
521 Ga0495669_0000650 3300046684 Bacteria 15146
522 Ga0495669_0041655 3300046684 Bacteria 2040
523 Ga0495613_0027954 3300046689 Bacteria 4198
524 Ga0495613_0102792 3300046689 Bacteria 2063
525 Ga0495613_0367519 3300046689 Bacteria 985
526 Ga0495624_0023168 3300046690 Bacteria 4096
527 Ga0495671_0093497 3300046692 Bacteria 1471
528 Ga0495589_0035287 3300046794 Bacteria 2508
529 Ga0495589_0042333 3300046794 Bacteria 2270
530 Ga0495589_0164450 3300046794 Bacteria 1056
531 Ga0495600_0000010 3300046809 Bacteria 143675
532 Ga0495600_0125125 3300046809 Bacteria 1672
533 Ga0495581_0003127 3300047315 Bacteria 9472
534 Ga0495581_0027892 3300047315 Bacteria 3275
535 Ga0495581_0078625 3300047315 Bacteria 1909
536 Ga0495581_0082644 3300047315 Bacteria 1860
537 Ga0495581_0089977 3300047315 Bacteria 1780
538 Ga0495604_0000009 3300047317 Bacteria 326341
539 Ga0495636_0160807 3300047318 Bacteria 1012
540 Ga0495674_0000002 3300047319 Bacteria 642785
541 Ga0495674_0008459 3300047319 Bacteria 9804
542 Ga0495674_0182507 3300047319 Bacteria 1747
543 Ga0495672_0060865 3300047320 Bacteria 2178
544 Ga0495676_0056443 3300047321 Bacteria 3105
545 Ga0495676_0082609 3300047321 Bacteria 2431
546 Ga0495676_0094806 3300047321 Bacteria 2222
547 Ga0495680_0000752 3300047322 Bacteria 36296
548 Ga0495675_0000517 3300047444 Bacteria 25028
549 Ga0495679_033846 3300047446 Bacteria 1630
550 Ga0495684_0000006 3300047471 Bacteria 247568
551 Ga0495593_0000439 3300047673 Bacteria 23237
552 Ga0495593_0015688 3300047673 Bacteria 4287
553 Ga0495593_0254338 3300047673 Bacteria 879
554 Ga0495602_0000005 3300048088 Bacteria 325957
555 Ga0495602_0097375 3300048088 Bacteria 2424
556 Ga0495614_0072055 3300048089 Bacteria 1490
557 Ga0496100_0008677 3300048903 Bacteria 5676
558 Ga0496100_0010419 3300048903 Bacteria 5260
559 Ga0496101_0002062 3300048904 Bacteria 12221
560 Ga0496101_0040893 3300048904 Bacteria 3302
561 Ga0496101_0144084 3300048904 Bacteria 1818
562 Ga0496101_0148820 3300048904 Bacteria 1789
563 Ga0496101_0311046 3300048904 Bacteria 1235
564 Ga0496102_0001771 3300048905 Bacteria 18745
565 Ga0496102_0009880 3300048905 Bacteria 8205
566 Ga0496102_0017733 3300048905 Bacteria 6241
567 Ga0496102_0300737 3300048905 Bacteria 1512
568 Ga0496102_0525027 3300048905 Bacteria 1106
569 Ga0496103_0005658 3300048906 Bacteria 7469
570 Ga0496103_0017084 3300048906 Bacteria 4338
571 Ga0496103_0049281 3300048906 Bacteria 2604
572 Ga0496103_0098855 3300048906 Bacteria 1846
573 Ga0496103_0148171 3300048906 Bacteria 1503
574 Ga0496103_0153370 3300048906 Bacteria 1476
575 Ga0496104_0001864 3300048907 Bacteria 18251
576 Ga0496104_0009785 3300048907 Bacteria 8547
577 Ga0496104_0013405 3300048907 Bacteria 7385
578 Ga0496104_0039870 3300048907 Bacteria 4399
579 Ga0496104_0082659 3300048907 Bacteria 3063
580 Ga0496104_0136187 3300048907 Bacteria 2360
581 Ga0496104_0360244 3300048907 Bacteria 1367
582 Ga0496105_0001436 3300048908 Bacteria 16761
583 Ga0496105_0002420 3300048908 Bacteria 13523
584 Ga0496105_0006858 3300048908 Bacteria 8763
585 Ga0496105_0012967 3300048908 Bacteria 6605
586 Ga0496105_0050186 3300048908 Bacteria 3446
587 Ga0496106_0020513 3300048909 Bacteria 4905
588 Ga0496106_0026257 3300048909 Bacteria 4335
589 Ga0496106_0080447 3300048909 Bacteria 2502
590 Ga0496106_0165987 3300048909 Unclassified 1748
591 Ga0496106_0175635 3300048909 Bacteria 1699
592 Ga0496107_0003490 3300048910 Bacteria 10516
593 Ga0496107_0012097 3300048910 Bacteria 6018
594 Ga0496107_0036192 3300048910 Bacteria 3540
595 Ga0496107_0081293 3300048910 Bacteria 2363
596 Ga0496107_0186014 3300048910 Bacteria 1543
597 Ga0496107_0192376 3300048910 Bacteria 1516
598 Ga0496108_0000386 3300048911 Bacteria 36634
599 Ga0496108_0002833 3300048911 Bacteria 13915
600 Ga0496108_0011203 3300048911 Bacteria 7286
601 Ga0496108_0019931 3300048911 Bacteria 5508
602 Ga0496108_0079232 3300048911 Bacteria 2781
603 Ga0496108_0308332 3300048911 Bacteria 1379
604 Ga0496109_0001313 3300048912 Bacteria 20515
605 Ga0496109_0004171 3300048912 Bacteria 12067
606 Ga0496109_0016420 3300048912 Bacteria 6472
607 Ga0496109_0128912 3300048912 Bacteria 2360
608 Ga0496109_0290514 3300048912 Bacteria 1541
609 Ga0496109_0640984 3300048912 Bacteria 999
610 Ga0496110_0055465 3300048913 Bacteria 3487
611 Ga0496110_0068174 3300048913 Bacteria 3148
612 Ga0496110_0087144 3300048913 Bacteria 2789
613 Ga0496110_0102662 3300048913 Bacteria 2564
614 Ga0496110_0179418 3300048913 Bacteria 1923
615 Ga0496111_0000388 3300048914 Bacteria 21996
616 Ga0496111_0012071 3300048914 Bacteria 5841
617 Ga0496111_0019842 3300048914 Bacteria 4674
618 Ga0496112_0000017 3300048915 Bacteria 191284
619 Ga0496112_0000426 3300048915 Bacteria 27828
620 Ga0496112_0013582 3300048915 Bacteria 7524
621 Ga0496112_0201840 3300048915 Bacteria 1947
622 Ga0496112_0206504 3300048915 Bacteria 1922
623 Ga0496112_0310408 3300048915 Bacteria 1522
624 Ga0496112_0351790 3300048915 Bacteria 1416
625 Ga0496112_0674532 3300048915 Bacteria 962
626 Ga0496113_0000395 3300048916 Bacteria 21041
627 Ga0496113_0039315 3300048916 Bacteria 3481
628 Ga0496113_0105066 3300048916 Bacteria 2192
629 Ga0496113_0111346 3300048916 Bacteria 2131
630 Ga0496113_0771676 3300048916 Unclassified 765
631 Ga0496114_0005094 3300048917 Bacteria 10241
632 Ga0496114_0028261 3300048917 Bacteria 4600
633 Ga0496114_0098347 3300048917 Bacteria 2495
634 Ga0496114_0155661 3300048917 Bacteria 1984
635 Ga0496115_0000535 3300048918 Bacteria 29580
636 Ga0496115_0009860 3300048918 Bacteria 7113
637 Ga0496115_0020774 3300048918 Bacteria 5066
638 Ga0496115_0024331 3300048918 Bacteria 4705
639 Ga0496115_0027378 3300048918 Bacteria 4457
640 Ga0496115_0030874 3300048918 Bacteria 4218
641 Ga0496115_0061373 3300048918 Bacteria 3030
642 Ga0496115_0278933 3300048918 Bacteria 1372
643 Ga0496115_0378115 3300048918 Bacteria 1152
644 Ga0496117_0030138 3300048920 Bacteria 4169
645 Ga0496119_0177624 3300048922 Bacteria 1119
646 Ga0496121_0024355 3300048924 Bacteria 5791
647 Ga0496121_0043531 3300048924 Bacteria 3887
648 Ga0496121_0124416 3300048924 Bacteria 1941
649 Ga0496124_0167459 3300048927 Bacteria 1706
650 Ga0496126_0019903 3300048929 Bacteria 6598
651 Ga0496126_0135596 3300048929 Bacteria 2124
652 Ga0496126_0289113 3300048929 Bacteria 1356
653 Ga0496126_0368417 3300048929 Bacteria 1172
654 Ga0495682_0052594 3300049460 Bacteria 1480
655 nmdc:mga03n38_160505_c1 3300050490 Bacteria 1138
656 nmdc:mga03n38_28157_c1 3300050490 Bacteria 2339
657 nmdc:mga03n38_58595_c1 3300050490 Bacteria 1745
658 nmdc:mga00v17_69404_c1 3300050491 Bacteria 2181
659 nmdc:mga0yw44_10144_c1 3300050492 Bacteria 4798
660 nmdc:mga0yw44_156426_c1 3300050492 Bacteria 1490
661 nmdc:mga06z11_155813_c1 3300050494 Bacteria 1302
662 nmdc:mga06z11_207641_c1 3300050494 Bacteria 1140
663 nmdc:mga06z11_215508_c1 3300050494 Bacteria 1120
664 nmdc:mga06z11_222403_c1 3300050494 Bacteria 1104
665 nmdc:mga06z11_5286_c1 3300050494 Bacteria 5169
666 nmdc:mga04h51_105806_c1 3300050495 Bacteria 1031
667 nmdc:mga07m45_137503_c1 3300050496 Bacteria 1414
668 nmdc:mga07m45_38017_c1 3300050496 Bacteria 2685
669 nmdc:mga05p37_6242_c1 3300050507 Bacteria 14032
670 nmdc:mga05p37_682404_c1 3300050507 Bacteria 1144
671 nmdc:mga09592_154205_c1 3300050508 Bacteria 1982
672 nmdc:mga0qj67_95982_c1 3300050509 Bacteria 2387
673 nmdc:mga06r32_127007_c1 3300050510 Bacteria 2519
674 nmdc:mga06r32_169452_c1 3300050510 Bacteria 2167
675 nmdc:mga06r32_54843_c1 3300050510 Bacteria 3822
676 nmdc:mga08y16_110342_c1 3300050511 Bacteria 2864
677 nmdc:mga0n895_18346_c1 3300050512 Bacteria 6471
678 nmdc:mga0n895_411548_c1 3300050512 Bacteria 1367
679 nmdc:mga0n895_56218_c1 3300050512 Bacteria 3876
680 nmdc:mga0rr50_236733_c1 3300050513 Bacteria 1512
681 nmdc:mga0a205_99385_c1 3300050515 Bacteria 2808
682 Ga0495601_0000002 3300053077 Bacteria 528704
683 Ga0495601_0021177 3300053077 Bacteria 3980
684 Ga0495601_0042386 3300053077 Bacteria 2856
685 Ga0495612_0000010 3300053078 Bacteria 227618
686 Ga0495655_0006829 3300053083 Bacteria 2094
687 Ga0495655_0028988 3300053083 Bacteria 1327
688 Ga0495655_0036411 3300053083 Bacteria 1230
689 Ga0495595_0000777 3300053084 Bacteria 12093
690 Ga0495619_0000019 3300053085 Bacteria 209518
691 Ga0495619_0020844 3300053085 Bacteria 4181
692 Ga0495619_0033342 3300053085 Bacteria 3344
693 Ga0495619_0175356 3300053085 Bacteria 1483
694 Ga0495619_0221361 3300053085 Unclassified 1311
695 Ga0500643_008988 3300053087 Bacteria 3860
696 Ga0500644_0001293 3300053088 Bacteria 6806
697 Ga0500651_0006213 3300053093 Bacteria 6869
698 Ga0500651_0069381 3300053093 Bacteria 2194
699 Ga0500566_0006011 3300053094 Bacteria 7218
700 Ga0500566_0031929 3300053094 Bacteria 3070
701 Ga0500641_0017678 3300053096 Bacteria 2671
702 Ga0500562_068420 3300053108 Bacteria 957
703 Ga0500595_000002 3300053119 Bacteria 1074388
704 Ga0500595_000537 3300053119 Bacteria 22809
705 Ga0500595_003301 3300053119 Bacteria 7598
706 Ga0500595_024557 3300053119 Bacteria 2102
707 Ga0500642_0081958 3300053130 Bacteria 1483
708 Ga0500568_0046742 3300053139 Bacteria 1717
709 Ga0500590_065714 3300053148 Bacteria 1813
710 Ga0500616_0000002 3300053153 Bacteria 1611257
711 Ga0500616_0046128 3300053153 Bacteria 2318
712 Ga0500616_0095147 3300053153 Bacteria 1466
713 Ga0500638_047821 3300053162 Bacteria 2070
714 Ga0500636_0010368 3300053177 Bacteria 5435
715 Ga0500637_0000042 3300053178 Bacteria 46215
716 Ga0500645_000099 3300053730 Bacteria 68426
717 Ga0500645_071614 3300053730 Bacteria 995
718 Ga0500661_000056 3300055283 Bacteria 17736
719 Ga0070708_100560360
720 JGI24746J21847_1003828
721 JGI24737J22298_10020484
722 JGI24748J21848_1000524
723 JGI24738J21930_10017382
724 JGI24744J21845_10004801
725 JGI25404J52841_10003853
726 JGI25404J52841_10015330
727 JGI25405J52794_10045588
728 Ga0070690_100021813
729 Ga0070670_100201244
730 Ga0070670_100531736
731 Ga0070677_10172808
732 Ga0070677_10209931
733 Ga0068869_100277372
734 Ga0070666_10071962
735 Ga0070666_10237672
736 Ga0070680_100268906
737 Ga0070682_100122410
738 Ga0070682_100280581
739 Ga0068868_100022399
740 Ga0068868_100389111
741 Ga0068868_100521008
742 Ga0070660_100098830
743 Ga0070660_100112646
744 Ga0070689_100001662
745 Ga0070691_10011614
746 Ga0070687_100029272
747 Ga0070687_100092025
748 Ga0070661_100036904
749 Ga0070661_100267371
750 Ga0070661_100371460
751 Ga0070692_10027176
752 Ga0070668_100038142
753 Ga0070668_100343820
754 Ga0070669_100069685
755 Ga0070669_100096099
756 Ga0070675_100047606
757 Ga0070675_100728943
758 Ga0070671_100019919
759 Ga0070671_100027961
760 Ga0070674_100027518
761 Ga0070674_100086602
762 Ga0070673_100230069
763 Ga0070688_100065983
764 Ga0070688_100174912
765 Ga0070688_100317403
766 Ga0070659_100058345
767 Ga0070667_100015429
768 Ga0070667_100162617
769 Ga0070667_100280910
770 Ga0070714_100240437
771 Ga0070713_100232416
772 Ga0070713_100391914
773 Ga0070713_100743772
774 Ga0070701_10006562
775 Ga0070701_10261592
776 Ga0070705_100094405
777 Ga0070700_100062136
778 Ga0070663_100076740
779 Ga0070663_100123633
780 Ga0070663_100173931
781 Ga0070678_100019754
782 Ga0070678_100067401
783 Ga0070678_100164381
784 Ga0070662_100148845
785 Ga0070662_100216435
786 Ga0068867_100058761
787 Ga0068867_100203594
788 Ga0070685_10072406
789 Ga0070698_100115178
790 Ga0070679_100608630
791 Ga0070684_100035117
792 Ga0070684_100107553
793 Ga0070697_100396478
794 Ga0068853_100156895
795 Ga0068853_100309214
796 Ga0068853_100641073
797 Ga0070672_100003299
798 Ga0070696_100146186
799 Ga0070693_100111908
800 Ga0070693_100164847
801 Ga0070693_100275982
802 Ga0070665_100041916
803 Ga0070665_100153300
804 Ga0070665_100597368
805 Ga0070664_100036292
806 Ga0070664_100102739
807 Ga0068857_100500721
808 Ga0068854_100061089
809 Ga0068854_100175615
810 Ga0068856_100003347
811 Ga0068856_100312836
812 Ga0068856_100379643
813 Ga0068852_100046625
814 Ga0068852_100129085
815 Ga0068859_100021148
816 Ga0068859_100163980
817 Ga0068864_100006339
818 Ga0068864_100089179
819 Ga0068864_100423324
820 Ga0068866_10004065
821 Ga0068861_100043820
822 Ga0068861_100190918
823 Ga0068861_100226964
824 Ga0068861_100393163
825 Ga0068861_100472242
826 Ga0068870_10116407
827 Ga0068863_100005456
828 Ga0068860_100008760
829 Ga0068860_100081543
830 Ga0068860_100100065
831 Ga0068862_100061588
832 Ga0068862_100098063
833 Ga0068862_100268495
834 Ga0068862_100271003
835 Ga0081455_10001734
836 Ga0081455_10015026
837 Ga0081455_10017479
838 Ga0081455_10040027
839 Ga0081455_10343491
840 Ga0081540_1000007
841 Ga0081540_1000105
842 Ga0081540_1003965
843 Ga0081540_1026858
844 Ga0070717_10064461
845 Ga0070717_10663546
846 Ga0075365_10222696
847 Ga0075365_10263989
848 Ga0075365_10288284
849 Ga0075368_10031919
850 Ga0075368_10078818
851 Ga0075363_100033900
852 Ga0075363_100234600
853 Ga0070716_100170099
854 Ga0070712_100055550
855 Ga0070712_100080564
856 Ga0075362_10040333
857 Ga0075367_10068817
858 Ga0075367_10081807
859 Ga0075367_10162074
860 Ga0075367_10184526
861 Ga0075366_10062746
862 Ga0097621_100008674
863 Ga0097621_100100345
864 Ga0075370_10148644
865 Ga0068871_100026031
866 Ga0068871_100326895
867 Ga0068871_100610559
868 Ga0075428_100027523
869 Ga0075430_100084022
870 Ga0075431_100122877
871 Ga0075431_100183347
872 Ga0075433_10027057
873 Ga0075434_100012519
874 Ga0075434_100014111
875 Ga0075434_100225504
876 Ga0075429_100472408
877 Ga0068865_100095558
878 Ga0068865_100467611
879 Ga0097620_100021146
880 Ga0097620_100163987
881 Ga0099794_10066421
882 Ga0099794_10163626
883 Ga0099795_10031853
884 Ga0105240_10255829
885 Ga0111539_10076949
886 Ga0111539_10293057
887 Ga0111539_10567908
888 Ga0105245_10027586
889 Ga0105245_10063788
890 Ga0105245_10258761
891 Ga0105247_10012572
892 Ga0114129_10050640
893 Ga0114129_10619074
894 Ga0105243_10020756
895 Ga0105243_10107981
896 Ga0105243_10420351
897 Ga0105243_10442065
898 Ga0105241_10093808
899 Ga0105241_10418413
900 Ga0105242_10085438
901 Ga0105248_10090371
902 Ga0105248_10095524
903 Ga0105248_10234721
904 Ga0105248_10283841
905 Ga0105248_10454036
906 Ga0105237_10059660
907 Ga0105237_10134764
908 Ga0105237_10625038
909 Ga0105238_10049666
910 Ga0105238_10232933
911 Ga0105238_10763859
912 Ga0105249_10166479
913 Ga0105249_10218549
914 Ga0105249_10228388
915 Ga0099796_10026830
916 Ga0099796_10126705
917 Ga0105239_10083385
918 Ga0105239_10146039
919 Ga0105239_10338932
920 Ga0105239_10569234
921 Ga0105246_10015760
922 Ga0157370_10556305
923 Ga0157374_10003239
924 Ga0157374_10200703
925 Ga0157374_10508647
926 Ga0157378_10009041
927 Ga0157378_10066261
928 Ga0157378_10552613
929 Ga0163162_10212560
930 Ga0163162_10386812
931 Ga0163162_10659944
932 Ga0163162_11048056
933 Ga0157375_10047518
934 Ga0157375_10103459
935 Ga0157375_10156349
936 Ga0157375_10201898
937 Ga0157375_11166684
938 Ga0163163_10014945
939 Ga0163163_10015790
940 Ga0163163_10038493
941 Ga0163163_10092019
942 Ga0157380_10327978
943 Ga0157377_10044111
944 Ga0157379_10043542
945 Ga0157376_10025997
946 Ga0157376_10047907
947 Ga0157376_10240321
948 Ga0157376_10391642
949 Ga0157376_10414288
950 Ga0209758_1000125
951 Ga0207697_10062448
952 Ga0207682_10209306
953 Ga0207642_10003991
954 Ga0207642_10176595
955 Ga0207710_10005716
956 Ga0207710_10197622
957 Ga0207688_10004677
958 Ga0207688_10072244
959 Ga0207688_10144546
960 Ga0207680_10217828
961 Ga0207645_10007388
962 Ga0207645_10116104
963 Ga0207645_10339229
964 Ga0207643_10000794
965 Ga0207654_10115797
966 Ga0207671_10117360
967 Ga0207671_10214644
968 Ga0207693_10033602
969 Ga0207663_10037576
970 Ga0207660_10327421
971 Ga0207662_10000424
972 Ga0207662_10102114
973 Ga0207662_10220715
974 Ga0207657_10093633
975 Ga0207657_10111110
976 Ga0207649_10016093
977 Ga0207649_10330285
978 Ga0207649_10418610
979 Ga0207652_10011695
980 Ga0207652_10319609
981 Ga0207681_10113290
982 Ga0207694_10029408
983 Ga0207694_10422766
984 Ga0207650_10019548
985 Ga0207650_10472360
986 Ga0207659_10024969
987 Ga0207687_10020983
988 Ga0207687_10066178
989 Ga0207700_10157416
990 Ga0207700_10546522
991 Ga0207700_10576234
992 Ga0207664_10729915
993 Ga0207644_10015484
994 Ga0207644_10029172
995 Ga0207706_10018822
996 Ga0207686_10167007
997 Ga0207709_10017967
998 Ga0207709_10153042
999 Ga0207670_10053842
1000 Ga0207670_10087056
1001 Ga0207704_10071538
1002 Ga0207704_10206741
1003 Ga0207704_10614655
1004 Ga0207665_10113190
1005 Ga0207691_10002691
1006 Ga0207711_10022868
1007 Ga0207711_10087104
1008 Ga0207689_10088660
1009 Ga0207689_10126834
1010 Ga0207689_10278928
1011 Ga0207661_10014563
1012 Ga0207679_10028966
1013 Ga0207679_10176092
1014 Ga0207667_10228090
1015 Ga0207651_10250583
1016 Ga0207712_10021041
1017 Ga0207712_10189533
1018 Ga0207712_10231411
1019 Ga0207668_10154049
1020 Ga0207640_10234715
1021 Ga0207677_10011070
1022 Ga0207677_10218335
1023 Ga0207677_10242156
1024 Ga0207677_10539596
1025 Ga0207703_10517122
1026 Ga0207639_10054996
1027 Ga0207639_10101798
1028 Ga0207639_10207058
1029 Ga0207678_10003923
1030 Ga0207678_10060137
1031 Ga0207678_10246715
1032 Ga0207678_10321441
1033 Ga0207708_10000784
1034 Ga0207708_10028255
1035 Ga0207708_10115077
1036 Ga0207708_10189790
1037 Ga0207702_10000548
1038 Ga0207702_10033740
1039 Ga0207702_10251491
1040 Ga0207641_10006530
1041 Ga0207648_10002310
1042 Ga0207648_10229800
1043 Ga0207676_10002295
1044 Ga0207676_10108437
1045 Ga0207676_10218661
1046 Ga0207674_10135379
1047 Ga0207675_100002371
1048 Ga0207675_100112829
1049 Ga0207675_100130814
1050 Ga0207683_10019832
1051 Ga0207683_10021694
1052 Ga0207683_10040045
1053 Ga0207683_10124367
1054 Ga0207683_10184101
1055 Ga0207698_10034409
1056 Ga0207698_10457529
1057 Ga0209179_1015555
1058 Ga0209588_1009865
1059 Ga0209813_10065818
1060 Ga0268266_10165814
1061 Ga0268266_10275628
1062 Ga0268266_10594340
1063 Ga0268265_10013453
1064 Ga0268265_10063828
1065 Ga0268265_10070998
1066 Ga0268265_10516126
1067 Ga0268264_10042233
1068 Ga0268264_10296560
1069 Ga0265334_10008302
1070 Ga0307517_10039620
1071 Ga0307515_10006012
1072 Ga0265330_10070693
1073 Ga0265332_10001513
1074 Ga0265332_10005019
1075 Ga0265332_10032406
1076 Ga0265325_10088971
1077 Ga0265329_10010128
1078 Ga0265329_10014396
1079 Ga0265340_10005971
1080 Ga0265339_10004623
1081 Ga0265339_10005449
1082 Ga0265331_10029831
1083 Ga0265331_10031762
1084 Ga0265331_10101952
1085 Ga0265331_10249441
1086 Ga0265316_10046003
1087 Ga0307509_10135476
1088 Ga0307508_10000032
1089 Ga0265314_10004484
1090 Ga0265314_10042579
1091 Ga0265342_10002428
1092 Ga0265342_10005254
1093 Ga0265342_10160721
1094 Ga0307516_10126244
1095 Ga0307510_10016157
1096 Ga0373948_0033716
1097 Ga0373934_0123469
1098 Ga0373923_0001173
1099 Ga0373936_0242128
1100 Ga0373945_0001390
1101 Ga0373945_0036020
1102 Ga0373953_0003727
1103 Ga0373954_0299384
1104 Ga0373943_0008899
1105 Ga0373946_0012725
1106 Ga0373955_0002349
1107 Ga0373955_0088500
1108 Ga0373961_0021624
1109 Ga0373924_0002221
1110 Ga0373924_0017333
1111 Ga0373931_0057519
1112 Ga0373935_0000291
1113 Ga0373935_0027445
1114 Ga0373935_0428586
1115 Ga0373927_0002882
1116 Ga0373927_0010828
1117 Ga0373927_0013220
1118 Ga0373927_0017091
1119 Ga0373927_0025259
1120 Ga0373927_0173228
1121 Ga0373927_0330621
1122 Ga0373933_0191541
1123 Ga0373947_0005730
1124 Ga0373947_0010154
1125 Ga0373947_0024192
1126 Ga0373947_0025283
1127 Ga0373947_0028707
1128 Ga0373947_0036395
1129 Ga0373947_0205031
1130 Ga0373937_0000004
1131 Ga0373937_0007886
1132 Ga0373937_0033145
1133 Ga0373937_0325797
1134 Ga0373937_0612864
1135 Ga0373925_0000460
1136 Ga0373925_0012254
1137 Ga0373925_0023291
1138 Ga0373925_0090021
1139 Ga0373925_0096835
1140 Ga0373925_0108321
1141 Ga0373925_0118203
1142 Ga0373925_0210499
1143 Ga0373925_0505692
1144 Ga0373925_0507438
1145 Ga0436363_0335374
1146 Ga0451798_0887340
1147 Ga0451843_0872454
1148 Ga0466963_0427385
1149 Ga0466967_0067366
1150 Ga0495617_021764
1151 Ga0495627_093152
1152 Ga0495592_0000029
1153 Ga0495603_0000217
1154 Ga0495603_0039310
1155 Ga0495603_0050966
1156 Ga0495603_0052598
1157 Ga0495603_0062923
1158 Ga0495629_0000862
1159 Ga0495629_0257994
1160 Ga0495638_0103778
1161 Ga0495638_0189245
1162 Ga0495641_0003672
1163 Ga0495641_0017426
1164 Ga0495641_0019640
1165 Ga0495641_0158565
1166 Ga0495651_0001409
1167 Ga0495653_0000012
1168 Ga0495650_0060149
1169 Ga0495580_0005364
1170 Ga0495580_0047602
1171 Ga0495580_0293655
1172 Ga0495582_0000990
1173 Ga0495582_0025773
1174 Ga0495582_0226321
1175 Ga0495605_0026778
1176 Ga0495605_0176373
1177 Ga0495639_0000544
1178 Ga0495639_0021776
1179 Ga0495639_0056218
1180 Ga0495662_0010406
1181 Ga0495664_0000004
1182 Ga0495664_0001505
1183 Ga0495664_0082445
1184 Ga0495664_0157547
1185 Ga0495664_0319671
1186 Ga0495584_0017649
1187 Ga0495584_0062283
1188 Ga0495584_0243886
1189 Ga0495585_0113784
1190 Ga0495594_0000128
1191 Ga0495608_0000017
1192 Ga0495608_0147239
1193 Ga0495616_0049664
1194 Ga0495618_0000006
1195 Ga0495618_0066500
1196 Ga0495618_0277958
1197 Ga0495620_0078562
1198 Ga0495628_0000001
1199 Ga0495630_0120545
1200 Ga0495630_0453158
1201 Ga0495631_0205868
1202 Ga0495632_0090785
1203 Ga0495644_0069798
1204 Ga0495663_0123259
1205 Ga0495666_0070401
1206 Ga0495652_0000002
1207 Ga0495665_0006186
1208 Ga0495665_0094072
1209 Ga0495665_0211751
1210 Ga0495640_0000001
1211 Ga0495640_0002595
1212 Ga0495640_0119257
1213 Ga0495586_0142836
1214 Ga0495587_0000008
1215 Ga0495598_0001556
1216 Ga0495645_0000002
1217 Ga0495622_0037475
1218 Ga0495622_0071643
1219 Ga0495667_0000029
1220 Ga0495656_0020279
1221 Ga0495668_0055390
1222 Ga0495634_0001583
1223 Ga0495611_0208317
1224 Ga0495625_0068851
1225 Ga0495635_0000002
1226 Ga0495635_0000436
1227 Ga0495661_0100548
1228 Ga0495588_0076469
1229 Ga0495588_0198910
1230 Ga0495657_0000459
1231 Ga0495599_0000104
1232 Ga0495623_0000691
1233 Ga0495646_0000064
1234 Ga0495647_0000394
1235 Ga0495658_0003203
1236 Ga0495658_0080898
1237 Ga0495658_0086047
1238 Ga0495658_0226303
1239 Ga0495669_0000650
1240 Ga0495669_0041655
1241 Ga0495613_0027954
1242 Ga0495613_0102792
1243 Ga0495613_0367519
1244 Ga0495624_0023168
1245 Ga0495671_0093497
1246 Ga0495589_0035287
1247 Ga0495589_0042333
1248 Ga0495589_0164450
1249 Ga0495600_0000010
1250 Ga0495600_0125125
1251 Ga0495581_0003127
1252 Ga0495581_0027892
1253 Ga0495581_0078625
1254 Ga0495581_0082644
1255 Ga0495581_0089977
1256 Ga0495604_0000009
1257 Ga0495636_0160807
1258 Ga0495674_0000002
1259 Ga0495674_0008459
1260 Ga0495674_0182507
1261 Ga0495672_0060865
1262 Ga0495676_0056443
1263 Ga0495676_0082609
1264 Ga0495676_0094806
1265 Ga0495680_0000752
1266 Ga0495675_0000517
1267 Ga0495679_033846
1268 Ga0495684_0000006
1269 Ga0495593_0000439
1270 Ga0495593_0015688
1271 Ga0495593_0254338
1272 Ga0495602_0000005
1273 Ga0495602_0097375
1274 Ga0495614_0072055
1275 Ga0496100_0008677
1276 Ga0496100_0010419
1277 Ga0496101_0002062
1278 Ga0496101_0040893
1279 Ga0496101_0144084
1280 Ga0496101_0148820
1281 Ga0496101_0311046
1282 Ga0496102_0001771
1283 Ga0496102_0009880
1284 Ga0496102_0017733
1285 Ga0496102_0300737
1286 Ga0496102_0525027
1287 Ga0496103_0005658
1288 Ga0496103_0017084
1289 Ga0496103_0049281
1290 Ga0496103_0098855
1291 Ga0496103_0148171
1292 Ga0496103_0153370
1293 Ga0496104_0001864
1294 Ga0496104_0009785
1295 Ga0496104_0013405
1296 Ga0496104_0039870
1297 Ga0496104_0082659
1298 Ga0496104_0136187
1299 Ga0496104_0360244
1300 Ga0496105_0001436
1301 Ga0496105_0002420
1302 Ga0496105_0006858
1303 Ga0496105_0012967
1304 Ga0496105_0050186
1305 Ga0496106_0020513
1306 Ga0496106_0026257
1307 Ga0496106_0080447
1308 Ga0496106_0165987
1309 Ga0496106_0175635
1310 Ga0496107_0003490
1311 Ga0496107_0012097
1312 Ga0496107_0036192
1313 Ga0496107_0081293
1314 Ga0496107_0186014
1315 Ga0496107_0192376
1316 Ga0496108_0000386
1317 Ga0496108_0002833
1318 Ga0496108_0011203
1319 Ga0496108_0019931
1320 Ga0496108_0079232
1321 Ga0496108_0308332
1322 Ga0496109_0001313
1323 Ga0496109_0004171
1324 Ga0496109_0016420
1325 Ga0496109_0128912
1326 Ga0496109_0290514
1327 Ga0496109_0640984
1328 Ga0496110_0055465
1329 Ga0496110_0068174
1330 Ga0496110_0087144
1331 Ga0496110_0102662
1332 Ga0496110_0179418
1333 Ga0496111_0000388
1334 Ga0496111_0012071
1335 Ga0496111_0019842
1336 Ga0496112_0000017
1337 Ga0496112_0000426
1338 Ga0496112_0013582
1339 Ga0496112_0201840
1340 Ga0496112_0206504
1341 Ga0496112_0310408
1342 Ga0496112_0351790
1343 Ga0496112_0674532
1344 Ga0496113_0000395
1345 Ga0496113_0039315
1346 Ga0496113_0105066
1347 Ga0496113_0111346
1348 Ga0496113_0771676
1349 Ga0496114_0005094
1350 Ga0496114_0028261
1351 Ga0496114_0098347
1352 Ga0496114_0155661
1353 Ga0496115_0000535
1354 Ga0496115_0009860
1355 Ga0496115_0020774
1356 Ga0496115_0024331
1357 Ga0496115_0027378
1358 Ga0496115_0030874
1359 Ga0496115_0061373
1360 Ga0496115_0278933
1361 Ga0496115_0378115
1362 Ga0496117_0030138
1363 Ga0496119_0177624
1364 Ga0496121_0024355
1365 Ga0496121_0043531
1366 Ga0496121_0124416
1367 Ga0496124_0167459
1368 Ga0496126_0019903
1369 Ga0496126_0135596
1370 Ga0496126_0289113
1371 Ga0496126_0368417
1372 Ga0495682_0052594
1373 nmdc:mga03n38_160505_c1
1374 nmdc:mga03n38_28157_c1
1375 nmdc:mga03n38_58595_c1
1376 nmdc:mga00v17_69404_c1
1377 nmdc:mga0yw44_10144_c1
1378 nmdc:mga0yw44_156426_c1
1379 nmdc:mga06z11_155813_c1
1380 nmdc:mga06z11_207641_c1
1381 nmdc:mga06z11_215508_c1
1382 nmdc:mga06z11_222403_c1
1383 nmdc:mga06z11_5286_c1
1384 nmdc:mga04h51_105806_c1
1385 nmdc:mga07m45_137503_c1
1386 nmdc:mga07m45_38017_c1
1387 nmdc:mga05p37_6242_c1
1388 nmdc:mga05p37_682404_c1
1389 nmdc:mga09592_154205_c1
1390 nmdc:mga0qj67_95982_c1
1391 nmdc:mga06r32_127007_c1
1392 nmdc:mga06r32_169452_c1
1393 nmdc:mga06r32_54843_c1
1394 nmdc:mga08y16_110342_c1
1395 nmdc:mga0n895_18346_c1
1396 nmdc:mga0n895_411548_c1
1397 nmdc:mga0n895_56218_c1
1398 nmdc:mga0rr50_236733_c1
1399 nmdc:mga0a205_99385_c1
1400 Ga0495601_0000002
1401 Ga0495601_0021177
1402 Ga0495601_0042386
1403 Ga0495612_0000010
1404 Ga0495655_0006829
1405 Ga0495655_0028988
1406 Ga0495655_0036411
1407 Ga0495595_0000777
1408 Ga0495619_0000019
1409 Ga0495619_0020844
1410 Ga0495619_0033342
1411 Ga0495619_0175356
1412 Ga0495619_0221361
1413 Ga0500643_008988
1414 Ga0500644_0001293
1415 Ga0500651_0006213
1416 Ga0500651_0069381
1417 Ga0500566_0006011
1418 Ga0500566_0031929
1419 Ga0500641_0017678
1420 Ga0500562_068420
1421 Ga0500595_000002
1422 Ga0500595_000537
1423 Ga0500595_003301
1424 Ga0500595_024557
1425 Ga0500642_0081958
1426 Ga0500568_0046742
1427 Ga0500590_065714
1428 Ga0500616_0000002
1429 Ga0500616_0046128
1430 Ga0500616_0095147
1431 Ga0500638_047821
1432 Ga0500636_0010368
1433 Ga0500637_0000042
1434 Ga0500645_000099
1435 Ga0500645_071614
1436 Ga0500661_000056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

42

264

0.92

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

47

256

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3axf-assembly3.cif.gz_C perrhenate binding to a11c/r153c moda mutant 0.8953 31 257
4xxu-assembly1.cif.gz_B moda - chromate bound 0.8901 31 257
7tav-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8796 31 256
7tav-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8787 31 257
3axf-assembly3.cif.gz_C perrhenate binding to a11c/r153c moda mutant 0.8772 31 257
ID Description Score Start End Superfamily
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9067 31 257 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9 33 257 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8994 33 108 3.40.190.10
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8857 31 257 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8827 30 257 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4V1R146-F1-model_v4 deleted 0.9659 81 257
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9639 63 257 GO:0015689
GO:0030973
AF-A0A4V1R146-F1-model_v4 deleted 0.9606 81 257
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9591 63 257 GO:0015689
GO:0030973
AF-A0A127EYM7-F1-model_v4 Molybdate ABC transporter periplasmic-binding protein 0.959 31 257 GO:0015689
GO:0030973

Map