F477145

General Info

Members Datasets Scaffolds Average Seq Length
718 267 1436 132

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100098525|Ga0070678_1000985252
Length 157
Sequence LTFQVPFYSMSRFGKVFTTMTMDGWLGVVIMTVFGVGFAGLMIGLSLLLGPKNPTPEKLAPYECGMPAVGNARERHSVKFYLVAMIFLLFDIEVAFLYPWAMAMRDLGWPGYVQIVTFFLVLLVGFVYVWRKGVLDWGPVARRRPGAQPAAKAQRAA

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
99 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
249 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
256 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100098525 3300005456 Bacteria 2260
2 JGI24743J22301_10158052 3300001991 Unclassified 510
3 JGI24749J21850_1035409 3300002076 Bacteria 724
4 JGI24034J26672_10061529 3300002239 Unclassified 660
5 Ga0065704_10139921 3300005289 Bacteria 1528
6 Ga0065712_10130134 3300005290 Bacteria 1560
7 Ga0065712_10145493 3300005290 Bacteria 1412
8 Ga0065715_10048398 3300005293 Bacteria 973
9 Ga0065715_10131029 3300005293 Bacteria 2015
10 Ga0065715_10137627 3300005293 Bacteria 1875
11 Ga0065715_10220262 3300005293 Bacteria 1275
12 Ga0065715_10273355 3300005293 Bacteria 1105
13 Ga0065715_10278787 3300005293 Bacteria 1069
14 Ga0065707_10005018 3300005295 Bacteria 3222
15 Ga0065707_10060912 3300005295 Bacteria 777
16 Ga0065707_10100879 3300005295 Bacteria 2898
17 Ga0065707_10672910 3300005295 Bacteria 649
18 Ga0070676_10007176 3300005328 Bacteria 5969
19 Ga0070676_10304435 3300005328 Bacteria 1082
20 Ga0070676_10443062 3300005328 Unclassified 912
21 Ga0070676_10587641 3300005328 Bacteria 801
22 Ga0070683_100081504 3300005329 Bacteria 3030
23 Ga0070683_101692995 3300005329 Unclassified 608
24 Ga0070690_100005505 3300005330 Bacteria 7120
25 Ga0070690_100009637 3300005330 Bacteria 5600
26 Ga0070690_101333721 3300005330 Bacteria 576
27 Ga0070670_100005530 3300005331 Bacteria 10657
28 Ga0070670_100696157 3300005331 Bacteria 914
29 Ga0070670_100917245 3300005331 Bacteria 794
30 Ga0070677_10000693 3300005333 Bacteria 11294
31 Ga0070677_10028699 3300005333 Bacteria 2104
32 Ga0068869_100003252 3300005334 Bacteria 9928
33 Ga0068869_100007617 3300005334 Bacteria 6931
34 Ga0068869_100017183 3300005334 Bacteria 4897
35 Ga0068869_100830814 3300005334 Bacteria 796
36 Ga0070666_10011823 3300005335 Bacteria 5488
37 Ga0070680_100422654 3300005336 Bacteria 1137
38 Ga0070680_100899618 3300005336 Bacteria 764
39 Ga0070682_100894482 3300005337 Bacteria 729
40 Ga0068868_100003775 3300005338 Bacteria 10573
41 Ga0068868_100704147 3300005338 Bacteria 904
42 Ga0070660_100877522 3300005339 Bacteria 756
43 Ga0070689_100040206 3300005340 Bacteria 3584
44 Ga0070689_100086154 3300005340 Bacteria 2470
45 Ga0070689_100104072 3300005340 Bacteria 2250
46 Ga0070689_100141940 3300005340 Bacteria 1932
47 Ga0070689_100525559 3300005340 Bacteria 1016
48 Ga0070691_10020843 3300005341 Bacteria 3031
49 Ga0070687_100003977 3300005343 Bacteria 5830
50 Ga0070687_100004263 3300005343 Bacteria 5686
51 Ga0070661_100022095 3300005344 Bacteria 4551
52 Ga0070661_100713606 3300005344 Bacteria 818
53 Ga0070692_10002464 3300005345 Bacteria 7196
54 Ga0070692_10052649 3300005345 Bacteria 2121
55 Ga0070692_10431517 3300005345 Bacteria 839
56 Ga0070668_100145300 3300005347 Bacteria 1914
57 Ga0070668_100625801 3300005347 Bacteria 944
58 Ga0070668_102224132 3300005347 Bacteria 507
59 Ga0070669_100000356 3300005353 Bacteria 35464
60 Ga0070669_100004311 3300005353 Bacteria 10281
61 Ga0070669_100012399 3300005353 Bacteria 6046
62 Ga0070669_100051717 3300005353 Bacteria 3004
63 Ga0070669_101526400 3300005353 Bacteria 581
64 Ga0070675_100000879 3300005354 Bacteria 21370
65 Ga0070675_100008779 3300005354 Bacteria 7850
66 Ga0070675_100038221 3300005354 Bacteria 3911
67 Ga0070675_100069797 3300005354 Bacteria 2911
68 Ga0070675_100071253 3300005354 Bacteria 2883
69 Ga0070675_100647165 3300005354 Bacteria 960
70 Ga0070675_100712165 3300005354 Bacteria 915
71 Ga0070675_100803638 3300005354 Bacteria 860
72 Ga0070671_100001545 3300005355 Bacteria 17310
73 Ga0070671_100106925 3300005355 Bacteria 2349
74 Ga0070671_100144156 3300005355 Bacteria 2010
75 Ga0070671_100321803 3300005355 Bacteria 1318
76 Ga0070671_100548166 3300005355 Bacteria 997
77 Ga0070674_100022481 3300005356 Bacteria 4067
78 Ga0070674_100038937 3300005356 Bacteria 3208
79 Ga0070674_100055316 3300005356 Bacteria 2747
80 Ga0070674_100408620 3300005356 Bacteria 1111
81 Ga0070674_100416722 3300005356 Unclassified 1101
82 Ga0070674_101270061 3300005356 Bacteria 656
83 Ga0070673_100016637 3300005364 Bacteria 5207
84 Ga0070673_100019347 3300005364 Bacteria 4886
85 Ga0070673_100040092 3300005364 Bacteria 3590
86 Ga0070673_100060945 3300005364 Unclassified 2992
87 Ga0070673_100119532 3300005364 Bacteria 2196
88 Ga0070673_100776551 3300005364 Bacteria 883
89 Ga0070673_100906111 3300005364 Bacteria 818
90 Ga0070673_101193438 3300005364 Bacteria 713
91 Ga0070688_100038799 3300005365 Bacteria 2911
92 Ga0070688_100075791 3300005365 Bacteria 2163
93 Ga0070688_100214338 3300005365 Bacteria 1354
94 Ga0070688_101649766 3300005365 Unclassified 524
95 Ga0070659_100802299 3300005366 Bacteria 819
96 Ga0070667_100008291 3300005367 Bacteria 8612
97 Ga0070667_100050813 3300005367 Bacteria 3494
98 Ga0070667_100174751 3300005367 Bacteria 1898
99 Ga0070667_100311214 3300005367 Bacteria 1419
100 Ga0070667_100668328 3300005367 Bacteria 960
101 Ga0070703_10070606 3300005406 Unclassified 1166
102 Ga0070703_10125218 3300005406 Bacteria 937
103 Ga0070713_100045901 3300005436 Bacteria 3583
104 Ga0070701_10002613 3300005438 Bacteria 6978
105 Ga0070701_10011675 3300005438 Bacteria 3939
106 Ga0070701_10242452 3300005438 Bacteria 1085
107 Ga0070701_10631747 3300005438 Bacteria 713
108 Ga0070711_100265715 3300005439 Bacteria 1352
109 Ga0070705_100000680 3300005440 Bacteria 19483
110 Ga0070705_100089958 3300005440 Bacteria 1910
111 Ga0070705_100329352 3300005440 Unclassified 1106
112 Ga0070705_100985715 3300005440 Unclassified 683
113 Ga0070700_100006482 3300005441 Bacteria 6266
114 Ga0070700_100010751 3300005441 Bacteria 5056
115 Ga0070700_100039805 3300005441 Bacteria 2874
116 Ga0070700_100152725 3300005441 Bacteria 1581
117 Ga0070700_100409641 3300005441 Bacteria 1022
118 Ga0070700_100624022 3300005441 Bacteria 848
119 Ga0070694_100012230 3300005444 Bacteria 5332
120 Ga0070694_100026712 3300005444 Bacteria 3743
121 Ga0070694_100452494 3300005444 Bacteria 1014
122 Ga0070694_101090487 3300005444 Bacteria 666
123 Ga0070708_100479211 3300005445 Bacteria 1174
124 Ga0070663_100041198 3300005455 Bacteria 3238
125 Ga0070663_100555977 3300005455 Bacteria 960
126 Ga0070678_100004798 3300005456 Bacteria 7715
127 Ga0070678_100274967 3300005456 Bacteria 1422
128 Ga0070678_100280986 3300005456 Bacteria 1408
129 Ga0070678_100321120 3300005456 Bacteria 1322
130 Ga0070662_100046164 3300005457 Bacteria 3130
131 Ga0070662_100160063 3300005457 Bacteria 1760
132 Ga0070662_101554902 3300005457 Unclassified 571
133 Ga0070681_10007600 3300005458 Bacteria 10595
134 Ga0070681_10175000 3300005458 Bacteria 2068
135 Ga0070681_11938539 3300005458 Bacteria 517
136 Ga0068867_100002261 3300005459 Bacteria 13543
137 Ga0068867_100037574 3300005459 Bacteria 3520
138 Ga0068867_100309710 3300005459 Bacteria 1304
139 Ga0068867_100624082 3300005459 Bacteria 943
140 Ga0070685_10009796 3300005466 Bacteria 4968
141 Ga0070685_10818591 3300005466 Unclassified 688
142 Ga0070706_100071749 3300005467 Bacteria 3204
143 Ga0070706_100326523 3300005467 Bacteria 1431
144 Ga0070707_100022254 3300005468 Bacteria 5992
145 Ga0070707_100162516 3300005468 Bacteria 2176
146 Ga0070707_100219840 3300005468 Bacteria 1850
147 Ga0070698_100005030 3300005471 Bacteria 14481
148 Ga0070698_100009236 3300005471 Bacteria 10578
149 Ga0070698_100333566 3300005471 Bacteria 1448
150 Ga0070699_100001266 3300005518 Bacteria 23295
151 Ga0070699_100003933 3300005518 Bacteria 13128
152 Ga0070699_100049632 3300005518 Bacteria 3632
153 Ga0070699_100899428 3300005518 Bacteria 811
154 Ga0070679_100812538 3300005530 Bacteria 878
155 Ga0070679_101554788 3300005530 Unclassified 609
156 Ga0070684_100046836 3300005535 Bacteria 3747
157 Ga0070697_100018269 3300005536 Bacteria 5527
158 Ga0070697_100067226 3300005536 Bacteria 2932
159 Ga0070697_100129943 3300005536 Bacteria 2112
160 Ga0070697_100221143 3300005536 Bacteria 1614
161 Ga0070697_101230239 3300005536 Bacteria 668
162 Ga0070697_101250108 3300005536 Bacteria 662
163 Ga0068853_101019645 3300005539 Bacteria 797
164 Ga0070672_100005810 3300005543 Bacteria 8230
165 Ga0070672_100047509 3300005543 Bacteria 3331
166 Ga0070672_100048422 3300005543 Bacteria 3303
167 Ga0070672_100259672 3300005543 Bacteria 1465
168 Ga0070672_100451382 3300005543 Bacteria 1107
169 Ga0070672_100465377 3300005543 Bacteria 1090
170 Ga0070672_100553811 3300005543 Bacteria 999
171 Ga0070672_100560474 3300005543 Bacteria 993
172 Ga0070672_100577106 3300005543 Bacteria 978
173 Ga0070686_100007227 3300005544 Bacteria 6185
174 Ga0070686_100111573 3300005544 Bacteria 1864
175 Ga0070686_100115046 3300005544 Bacteria 1838
176 Ga0070695_100000031 3300005545 Bacteria 53175
177 Ga0070695_100053963 3300005545 Bacteria 2585
178 Ga0070695_100107259 3300005545 Bacteria 1890
179 Ga0070695_100250944 3300005545 Bacteria 1288
180 Ga0070696_100015765 3300005546 Bacteria 5079
181 Ga0070696_100018897 3300005546 Bacteria 4666
182 Ga0070696_100092570 3300005546 Bacteria 2154
183 Ga0070696_100114688 3300005546 Bacteria 1943
184 Ga0070696_101687258 3300005546 Unclassified 546
185 Ga0070665_100062229 3300005548 Bacteria 3742
186 Ga0070704_100003975 3300005549 Bacteria 8524
187 Ga0070704_100011626 3300005549 Bacteria 5403
188 Ga0070704_100164316 3300005549 Bacteria 1759
189 Ga0070704_100239284 3300005549 Bacteria 1485
190 Ga0070704_100518591 3300005549 Bacteria 1037
191 Ga0070704_100740270 3300005549 Bacteria 875
192 Ga0070664_100005393 3300005564 Bacteria 10266
193 Ga0070664_100010548 3300005564 Bacteria 7489
194 Ga0070664_100437845 3300005564 Bacteria 1199
195 Ga0070664_100484437 3300005564 Bacteria 1138
196 Ga0068857_100024776 3300005577 Bacteria 5285
197 Ga0068857_100565953 3300005577 Bacteria 1072
198 Ga0068854_100073556 3300005578 Bacteria 2505
199 Ga0070702_100020565 3300005615 Bacteria 3460
200 Ga0070702_100069296 3300005615 Unclassified 2078
201 Ga0070702_100244633 3300005615 Bacteria 1212
202 Ga0068852_101559038 3300005616 Bacteria 683
203 Ga0068852_101745086 3300005616 Bacteria 645
204 Ga0068859_100002556 3300005617 Bacteria 18468
205 Ga0068859_100019393 3300005617 Bacteria 6833
206 Ga0068859_100431321 3300005617 Bacteria 1414
207 Ga0068859_100815134 3300005617 Bacteria 1020
208 Ga0068859_100899804 3300005617 Bacteria 970
209 Ga0068859_100918367 3300005617 Bacteria 960
210 Ga0068864_100059294 3300005618 Bacteria 3311
211 Ga0068864_100071975 3300005618 Bacteria 3012
212 Ga0068864_100354094 3300005618 Bacteria 1386
213 Ga0068861_100006224 3300005719 Bacteria 8117
214 Ga0068861_100007414 3300005719 Bacteria 7518
215 Ga0068861_100264956 3300005719 Bacteria 1473
216 Ga0068861_100914729 3300005719 Bacteria 832
217 Ga0068870_10001180 3300005840 Bacteria 10475
218 Ga0068870_10001479 3300005840 Bacteria 9507
219 Ga0068870_10247519 3300005840 Bacteria 1103
220 Ga0068870_10299519 3300005840 Bacteria 1015
221 Ga0068863_100010193 3300005841 Bacteria 9138
222 Ga0068863_100039502 3300005841 Bacteria 4488
223 Ga0068863_100085160 3300005841 Bacteria 2996
224 Ga0068858_100015917 3300005842 Bacteria 7066
225 Ga0068858_100021144 3300005842 Bacteria 6077
226 Ga0068858_100545970 3300005842 Bacteria 1122
227 Ga0068858_100913724 3300005842 Bacteria 859
228 Ga0068858_101120823 3300005842 Unclassified 773
229 Ga0068860_100008655 3300005843 Bacteria 10140
230 Ga0068860_100026716 3300005843 Bacteria 5563
231 Ga0068860_100115798 3300005843 Bacteria 2564
232 Ga0068860_100391810 3300005843 Bacteria 1373
233 Ga0068860_101085257 3300005843 Bacteria 820
234 Ga0068862_100000604 3300005844 Bacteria 37343
235 Ga0068862_100012991 3300005844 Bacteria 6887
236 Ga0068862_100131534 3300005844 Bacteria 2214
237 Ga0068862_101002876 3300005844 Bacteria 826
238 Ga0097621_100006671 3300006237 Bacteria 8203
239 Ga0097621_100108010 3300006237 Bacteria 2349
240 Ga0097621_100160959 3300006237 Bacteria 1929
241 Ga0097621_101718525 3300006237 Bacteria 598
242 Ga0068871_100023623 3300006358 Bacteria 4759
243 Ga0068871_100032547 3300006358 Bacteria 4121
244 Ga0075428_100200106 3300006844 Bacteria 2160
245 Ga0075428_101679590 3300006844 Unclassified 663
246 Ga0075431_100347243 3300006847 Bacteria 1492
247 Ga0075433_10016915 3300006852 Bacteria 6026
248 Ga0075433_10147105 3300006852 Bacteria 2094
249 Ga0075433_10328492 3300006852 Bacteria 1353
250 Ga0075433_10638870 3300006852 Bacteria 933
251 Ga0075434_100003551 3300006871 Bacteria 13921
252 Ga0075434_100016691 3300006871 Bacteria 7062
253 Ga0075434_100038864 3300006871 Bacteria 4715
254 Ga0075434_100125435 3300006871 Bacteria 2585
255 Ga0075429_100067142 3300006880 Bacteria 3121
256 Ga0075429_100331367 3300006880 Unclassified 1332
257 Ga0075429_101528262 3300006880 Bacteria 581
258 Ga0068865_100019232 3300006881 Bacteria 4419
259 Ga0068865_100036100 3300006881 Bacteria 3330
260 Ga0068865_100047508 3300006881 Bacteria 2950
261 Ga0068865_101155009 3300006881 Bacteria 684
262 Ga0075436_101003377 3300006914 Bacteria 626
263 Ga0097620_100002556 3300006931 Bacteria 18468
264 Ga0097620_100019393 3300006931 Bacteria 6833
265 Ga0097620_100431321 3300006931 Bacteria 1414
266 Ga0097620_100815102 3300006931 Bacteria 1020
267 Ga0097620_100899824 3300006931 Bacteria 970
268 Ga0097620_100918339 3300006931 Bacteria 960
269 Ga0097620_102795874 3300006931 Unclassified 536
270 Ga0075435_100027873 3300007076 Bacteria 4423
271 Ga0075435_100098889 3300007076 Bacteria 2415
272 Ga0075435_100489846 3300007076 Bacteria 1062
273 Ga0075435_100619835 3300007076 Bacteria 939
274 Ga0075435_100804119 3300007076 Bacteria 819
275 Ga0075435_101247578 3300007076 Bacteria 651
276 Ga0105244_10182237 3300009036 Bacteria 996
277 Ga0105240_10618991 3300009093 Bacteria 1190
278 Ga0111539_10001120 3300009094 Bacteria 35438
279 Ga0111539_10030049 3300009094 Bacteria 6609
280 Ga0111539_10304883 3300009094 Bacteria 1853
281 Ga0111539_10362603 3300009094 Bacteria 1687
282 Ga0111539_10939816 3300009094 Bacteria 1005
283 Ga0105245_10509925 3300009098 Bacteria 1220
284 Ga0105245_10644903 3300009098 Bacteria 1089
285 Ga0105247_10472503 3300009101 Bacteria 908
286 Ga0114129_10026738 3300009147 Bacteria 8173
287 Ga0114129_10030922 3300009147 Bacteria 7572
288 Ga0114129_10101495 3300009147 Bacteria 3980
289 Ga0114129_10274530 3300009147 Bacteria 2254
290 Ga0114129_10436732 3300009147 Bacteria 1719
291 Ga0114129_10797925 3300009147 Bacteria 1205
292 Ga0114129_13044173 3300009147 Bacteria 550
293 Ga0105243_10070773 3300009148 Unclassified 2818
294 Ga0105243_11971369 3300009148 Unclassified 618
295 Ga0105242_10300366 3300009176 Bacteria 1465
296 Ga0105242_10606551 3300009176 Bacteria 1058
297 Ga0105242_11153124 3300009176 Bacteria 792
298 Ga0105242_11267407 3300009176 Bacteria 759
299 Ga0105248_10014047 3300009177 Bacteria 8813
300 Ga0105248_10047569 3300009177 Bacteria 4811
301 Ga0105248_10157137 3300009177 Bacteria 2566
302 Ga0105248_10307609 3300009177 Bacteria 1785
303 Ga0105248_10780062 3300009177 Bacteria 1079
304 Ga0105248_11041472 3300009177 Bacteria 924
305 Ga0105248_11831986 3300009177 Unclassified 688
306 Ga0105238_12101745 3300009551 Unclassified 599
307 Ga0105249_10010818 3300009553 Bacteria 8021
308 Ga0105249_10048081 3300009553 Bacteria 3889
309 Ga0105249_10391126 3300009553 Bacteria 1419
310 Ga0105249_10614869 3300009553 Bacteria 1142
311 Ga0105249_11674166 3300009553 Bacteria 709
312 Ga0105249_12177632 3300009553 Bacteria 627
313 Ga0105239_11823883 3300010375 Unclassified 705
314 Ga0105246_10109668 3300011119 Bacteria 2025
315 Ga0105246_10143769 3300011119 Bacteria 1797
316 Ga0157335_1021168 3300012492 Bacteria 619
317 Ga0157339_1019048 3300012505 Bacteria 712
318 Ga0157371_10301528 3300013102 Bacteria 1160
319 Ga0157374_10052502 3300013296 Bacteria 3797
320 Ga0157374_10136318 3300013296 Bacteria 2380
321 Ga0157374_10519087 3300013296 Bacteria 1197
322 Ga0157378_10314414 3300013297 Bacteria 1520
323 Ga0157378_10468842 3300013297 Bacteria 1253
324 Ga0157378_10502094 3300013297 Bacteria 1212
325 Ga0157378_10763321 3300013297 Bacteria 991
326 Ga0163162_10004641 3300013306 Bacteria 13243
327 Ga0163162_10852429 3300013306 Unclassified 1026
328 Ga0163162_11545107 3300013306 Bacteria 756
329 Ga0157375_10023545 3300013308 Bacteria 5683
330 Ga0157375_10089205 3300013308 Bacteria 3139
331 Ga0157375_10138147 3300013308 Bacteria 2562
332 Ga0157375_10806273 3300013308 Bacteria 1087
333 Ga0157375_10870806 3300013308 Bacteria 1046
334 Ga0157375_11065390 3300013308 Bacteria 945
335 Ga0157375_12068795 3300013308 Bacteria 677
336 Ga0163163_10038267 3300014325 Bacteria 4674
337 Ga0163163_10216124 3300014325 Bacteria 1966
338 Ga0163163_10345721 3300014325 Bacteria 1543
339 Ga0163163_10595561 3300014325 Bacteria 1169
340 Ga0157380_10007007 3300014326 Bacteria 7978
341 Ga0157380_10008204 3300014326 Bacteria 7442
342 Ga0157380_10090396 3300014326 Bacteria 2525
343 Ga0157380_10175663 3300014326 Bacteria 1876
344 Ga0157380_10679796 3300014326 Bacteria 1031
345 Ga0157380_11072489 3300014326 Bacteria 843
346 Ga0157380_11638149 3300014326 Bacteria 700
347 Ga0157380_11841520 3300014326 Unclassified 665
348 Ga0157377_10001648 3300014745 Bacteria 9745
349 Ga0157377_10033344 3300014745 Bacteria 2810
350 Ga0157377_10254592 3300014745 Bacteria 1140
351 Ga0157377_10652102 3300014745 Bacteria 758
352 Ga0157379_10004249 3300014968 Bacteria 12230
353 Ga0157379_10413546 3300014968 Bacteria 1241
354 Ga0157379_10477598 3300014968 Bacteria 1153
355 Ga0157376_10021576 3300014969 Bacteria 5005
356 Ga0157376_10316329 3300014969 Bacteria 1483
357 Ga0157376_10390573 3300014969 Bacteria 1343
358 Ga0157376_11597415 3300014969 Archaea 686
359 Ga0157376_11794702 3300014969 Bacteria 649
360 Ga0163161_10229319 3300017792 Bacteria 1441
361 Ga0207697_10000732 3300025315 Bacteria 18618
362 Ga0207697_10159317 3300025315 Bacteria 984
363 Ga0207697_10253333 3300025315 Bacteria 779
364 Ga0207682_10000305 3300025893 Bacteria 22141
365 Ga0207682_10024064 3300025893 Bacteria 2409
366 Ga0207682_10046582 3300025893 Bacteria 1782
367 Ga0207688_10002404 3300025901 Bacteria 10085
368 Ga0207688_10165129 3300025901 Bacteria 1314
369 Ga0207688_10358693 3300025901 Archaea 899
370 Ga0207680_10008453 3300025903 Bacteria 5054
371 Ga0207647_10717924 3300025904 Unclassified 543
372 Ga0207645_10001706 3300025907 Bacteria 17831
373 Ga0207645_10060046 3300025907 Bacteria 2428
374 Ga0207645_10106380 3300025907 Bacteria 1814
375 Ga0207645_10447423 3300025907 Bacteria 872
376 Ga0207643_10002284 3300025908 Bacteria 10431
377 Ga0207643_10244370 3300025908 Bacteria 1104
378 Ga0207684_10085498 3300025910 Bacteria 2687
379 Ga0207663_10209100 3300025916 Bacteria 1413
380 Ga0207660_10397562 3300025917 Bacteria 1109
381 Ga0207660_11065359 3300025917 Unclassified 659
382 Ga0207660_11151558 3300025917 Bacteria 632
383 Ga0207662_10002832 3300025918 Bacteria 8767
384 Ga0207662_10018021 3300025918 Bacteria 4000
385 Ga0207662_10810710 3300025918 Unclassified 660
386 Ga0207657_10288400 3300025919 Bacteria 1302
387 Ga0207649_10015294 3300025920 Bacteria 4312
388 Ga0207652_10754926 3300025921 Unclassified 866
389 Ga0207646_10037517 3300025922 Bacteria 4368
390 Ga0207646_10242916 3300025922 Bacteria 1627
391 Ga0207646_10373526 3300025922 Bacteria 1288
392 Ga0207681_10001518 3300025923 Bacteria 14965
393 Ga0207681_10020191 3300025923 Bacteria 4218
394 Ga0207681_10099690 3300025923 Bacteria 2092
395 Ga0207681_10176027 3300025923 Bacteria 1626
396 Ga0207681_10573124 3300025923 Bacteria 931
397 Ga0207650_10002734 3300025925 Bacteria 12176
398 Ga0207659_10000586 3300025926 Bacteria 21812
399 Ga0207659_10001767 3300025926 Bacteria 12787
400 Ga0207659_10009043 3300025926 Bacteria 6212
401 Ga0207659_10017736 3300025926 Bacteria 4654
402 Ga0207659_10046778 3300025926 Bacteria 3057
403 Ga0207659_10527931 3300025926 Bacteria 1001
404 Ga0207659_11158771 3300025926 Bacteria 665
405 Ga0207659_11238145 3300025926 Bacteria 641
406 Ga0207687_10517760 3300025927 Bacteria 997
407 Ga0207687_11107990 3300025927 Unclassified 680
408 Ga0207700_10020268 3300025928 Bacteria 4512
409 Ga0207644_10007306 3300025931 Bacteria 7189
410 Ga0207644_10176344 3300025931 Bacteria 1672
411 Ga0207644_10195072 3300025931 Bacteria 1594
412 Ga0207644_10280233 3300025931 Bacteria 1338
413 Ga0207644_10323153 3300025931 Bacteria 1248
414 Ga0207690_10514673 3300025932 Bacteria 969
415 Ga0207690_11146557 3300025932 Bacteria 648
416 Ga0207706_10002692 3300025933 Bacteria 17322
417 Ga0207706_10111097 3300025933 Bacteria 2411
418 Ga0207706_10229691 3300025933 Bacteria 1624
419 Ga0207706_10269164 3300025933 Bacteria 1487
420 Ga0207706_10851211 3300025933 Bacteria 772
421 Ga0207686_10004419 3300025934 Bacteria 7542
422 Ga0207686_10307540 3300025934 Bacteria 1179
423 Ga0207709_10056237 3300025935 Bacteria 2434
424 Ga0207709_10066670 3300025935 Bacteria 2268
425 Ga0207709_10126734 3300025935 Bacteria 1733
426 Ga0207670_10004469 3300025936 Bacteria 7533
427 Ga0207670_10017490 3300025936 Bacteria 4333
428 Ga0207670_10050582 3300025936 Bacteria 2786
429 Ga0207670_10147297 3300025936 Bacteria 1743
430 Ga0207670_10972077 3300025936 Bacteria 713
431 Ga0207669_10025772 3300025937 Bacteria 3185
432 Ga0207669_10025983 3300025937 Bacteria 3176
433 Ga0207669_10246141 3300025937 Bacteria 1328
434 Ga0207669_11144788 3300025937 Unclassified 658
435 Ga0207669_11181838 3300025937 Bacteria 648
436 Ga0207669_11269868 3300025937 Unclassified 625
437 Ga0207704_10009549 3300025938 Bacteria 4686
438 Ga0207704_10040316 3300025938 Bacteria 2728
439 Ga0207704_10078749 3300025938 Bacteria 2121
440 Ga0207691_10000676 3300025940 Bacteria 33706
441 Ga0207691_10043214 3300025940 Bacteria 4154
442 Ga0207691_10062565 3300025940 Bacteria 3376
443 Ga0207691_10090522 3300025940 Bacteria 2742
444 Ga0207691_10182818 3300025940 Bacteria 1831
445 Ga0207691_10866058 3300025940 Bacteria 757
446 Ga0207691_11022358 3300025940 Bacteria 689
447 Ga0207691_11276089 3300025940 Bacteria 607
448 Ga0207711_10035205 3300025941 Bacteria 4243
449 Ga0207711_10091152 3300025941 Bacteria 2681
450 Ga0207711_10169812 3300025941 Bacteria 1979
451 Ga0207711_10194757 3300025941 Bacteria 1848
452 Ga0207711_10244538 3300025941 Bacteria 1646
453 Ga0207689_10002745 3300025942 Bacteria 16279
454 Ga0207689_11273714 3300025942 Bacteria 618
455 Ga0207661_10337598 3300025944 Bacteria 1357
456 Ga0207661_10760677 3300025944 Bacteria 892
457 Ga0207679_10003263 3300025945 Bacteria 10021
458 Ga0207679_10120511 3300025945 Bacteria 2087
459 Ga0207679_10332014 3300025945 Bacteria 1320
460 Ga0207679_10826066 3300025945 Bacteria 846
461 Ga0207651_10020592 3300025960 Bacteria 3985
462 Ga0207651_10078998 3300025960 Bacteria 2362
463 Ga0207651_10126323 3300025960 Bacteria 1949
464 Ga0207651_10147177 3300025960 Bacteria 1828
465 Ga0207651_10188890 3300025960 Bacteria 1641
466 Ga0207651_10251477 3300025960 Unclassified 1446
467 Ga0207651_10297343 3300025960 Bacteria 1341
468 Ga0207651_10548998 3300025960 Bacteria 1004
469 Ga0207712_10001123 3300025961 Bacteria 18659
470 Ga0207712_10005078 3300025961 Bacteria 8323
471 Ga0207712_10353000 3300025961 Bacteria 1223
472 Ga0207712_10549690 3300025961 Bacteria 993
473 Ga0207668_10038746 3300025972 Bacteria 3202
474 Ga0207640_10148172 3300025981 Bacteria 1721
475 Ga0207640_10228507 3300025981 Bacteria 1430
476 Ga0207640_10375374 3300025981 Unclassified 1150
477 Ga0207658_10205690 3300025986 Bacteria 1646
478 Ga0207658_10572771 3300025986 Bacteria 1012
479 Ga0207658_10709829 3300025986 Bacteria 909
480 Ga0207677_10040855 3300026023 Bacteria 3062
481 Ga0207677_10086884 3300026023 Bacteria 2262
482 Ga0207677_10368842 3300026023 Bacteria 1208
483 Ga0207677_10546495 3300026023 Bacteria 1009
484 Ga0207703_10065432 3300026035 Bacteria 2988
485 Ga0207703_10331958 3300026035 Bacteria 1395
486 Ga0207703_10757902 3300026035 Bacteria 925
487 Ga0207703_11134182 3300026035 Bacteria 751
488 Ga0207639_10920423 3300026041 Bacteria 818
489 Ga0207678_10551595 3300026067 Bacteria 1008
490 Ga0207708_10003593 3300026075 Bacteria 11431
491 Ga0207708_10022886 3300026075 Bacteria 4720
492 Ga0207708_10056937 3300026075 Bacteria 2982
493 Ga0207708_10061109 3300026075 Bacteria 2876
494 Ga0207708_10311758 3300026075 Bacteria 1282
495 Ga0207708_10593032 3300026075 Bacteria 938
496 Ga0207708_11498094 3300026075 Bacteria 593
497 Ga0207641_10010305 3300026088 Bacteria 7682
498 Ga0207641_10067268 3300026088 Bacteria 3069
499 Ga0207641_10280453 3300026088 Bacteria 1567
500 Ga0207648_10001001 3300026089 Bacteria 31868
501 Ga0207648_10041761 3300026089 Bacteria 4028
502 Ga0207648_10150375 3300026089 Bacteria 2054
503 Ga0207648_10194119 3300026089 Bacteria 1800
504 Ga0207648_10733493 3300026089 Bacteria 917
505 Ga0207648_10959559 3300026089 Bacteria 800
506 Ga0207648_11046773 3300026089 Bacteria 765
507 Ga0207676_10067023 3300026095 Bacteria 2866
508 Ga0207676_10335693 3300026095 Bacteria 1392
509 Ga0207676_10478998 3300026095 Bacteria 1178
510 Ga0207676_10536611 3300026095 Bacteria 1116
511 Ga0207674_10004709 3300026116 Bacteria 16358
512 Ga0207674_10806394 3300026116 Bacteria 906
513 Ga0207675_100009909 3300026118 Bacteria 8917
514 Ga0207675_100041932 3300026118 Bacteria 4273
515 Ga0207675_100691300 3300026118 Bacteria 1028
516 Ga0207675_100801103 3300026118 Bacteria 955
517 Ga0207675_101009036 3300026118 Bacteria 851
518 Ga0207683_10005691 3300026121 Bacteria 10691
519 Ga0207683_10042655 3300026121 Bacteria 3963
520 Ga0207683_10248461 3300026121 Bacteria 1623
521 Ga0207683_10257595 3300026121 Bacteria 1593
522 Ga0207683_11076009 3300026121 Bacteria 746
523 Ga0207683_11629490 3300026121 Bacteria 595
524 Ga0207698_10447316 3300026142 Bacteria 1246
525 Ga0210000_1035923 3300027462 Bacteria 781
526 Ga0209968_1013515 3300027526 Bacteria 1282
527 Ga0209968_1022567 3300027526 Bacteria 1027
528 Ga0209999_1018745 3300027543 Bacteria 1267
529 Ga0207428_10000482 3300027907 Bacteria 48138
530 Ga0207428_10003191 3300027907 Bacteria 16045
531 Ga0207428_10011509 3300027907 Bacteria 7815
532 Ga0268265_10000160 3300028380 Bacteria 81960
533 Ga0268265_10066190 3300028380 Bacteria 2792
534 Ga0268265_10604511 3300028380 Bacteria 1048
535 Ga0268264_10010702 3300028381 Bacteria 7576
536 Ga0268264_10128658 3300028381 Bacteria 2242
537 Ga0268264_10174932 3300028381 Bacteria 1945
538 Ga0268264_10414780 3300028381 Bacteria 1297
539 Ga0307413_10004875 3300031824 Bacteria 5900
540 Ga0307413_11014411 3300031824 Bacteria 712
541 Ga0307410_10003273 3300031852 Bacteria 8088
542 Ga0307410_10200183 3300031852 Bacteria 1524
543 Ga0307406_10129637 3300031901 Bacteria 1768
544 Ga0307406_10679283 3300031901 Bacteria 858
545 Ga0307407_10026570 3300031903 Bacteria 3068
546 Ga0307407_10029548 3300031903 Bacteria 2946
547 Ga0307412_11000361 3300031911 Bacteria 739
548 Ga0307409_100220877 3300031995 Bacteria 1710
549 Ga0307416_100306166 3300032002 Bacteria 1582
550 Ga0307414_10034144 3300032004 Bacteria 3369
551 Ga0307414_10081441 3300032004 Bacteria 2370
552 Ga0307414_11884913 3300032004 Bacteria 558
553 Ga0307411_10005825 3300032005 Bacteria 6105
554 Ga0307411_10095330 3300032005 Bacteria 2089
555 Ga0307411_10582004 3300032005 Bacteria 960
556 Ga0307415_100009851 3300032126 Bacteria 5384
557 Ga0373948_0017510 3300034817 Bacteria 1335
558 Ga0373948_0116513 3300034817 Bacteria 642
559 Ga0373938_0019019 3300034957 Bacteria 1370
560 Ga0373928_0118681 3300035084 Bacteria 707
561 Ga0373929_0104243 3300035085 Bacteria 718
562 Ga0373949_0025491 3300035090 Bacteria 1380
563 Ga0373949_0039267 3300035090 Bacteria 1158
564 Ga0373939_0003786 3300035114 Bacteria 3568
565 Ga0373945_0499826 3300035116 Unclassified 542
566 Ga0373945_0516312 3300035116 Unclassified 533
567 Ga0373946_0041185 3300035171 Bacteria 1894
568 Ga0373955_0720840 3300035172 Bacteria 612
569 Ga0373942_0094373 3300035207 Bacteria 906
570 Ga0373962_0012488 3300035242 Bacteria 2142
571 Ga0373962_0026252 3300035242 Bacteria 1569
572 Ga0373931_0066928 3300035691 Bacteria 1951
573 Ga0373931_0133762 3300035691 Bacteria 1430
574 Ga0373931_0649920 3300035691 Bacteria 693
575 Ga0373933_0392800 3300035724 Bacteria 904
576 Ga0373937_0073071 3300036401 Bacteria 3163
577 Ga0373925_0612553 3300037068 Bacteria 897
578 Ga0436363_1151335 3300039450 Bacteria 869
579 Ga0439453_0002405 3300041408 Bacteria 2581
580 Ga0451807_1676276 3300041486 Bacteria 1410
581 Ga0451853_0141730 3300041512 Bacteria 1067
582 Ga0439441_042840 3300042001 Bacteria 912
583 Ga0439449_0246276 3300042007 Bacteria 672
584 Ga0439435_0060184 3300042436 Bacteria 1105
585 Ga0439464_0127493 3300042439 Bacteria 787
586 Ga0451577_0571414 3300042876 Bacteria 1026
587 Ga0439440_0161196 3300042993 Bacteria 647
588 Ga0453683_0248275 3300044673 Bacteria 1134
589 Ga0453684_1123335 3300044712 Unclassified 829
590 Ga0451576_0006002 3300045051 Bacteria 15020
591 Ga0451576_0020013 3300045051 Bacteria 7294
592 Ga0451576_0051465 3300045051 Bacteria 4318
593 Ga0451576_0081830 3300045051 Bacteria 3358
594 Ga0451576_0535131 3300045051 Bacteria 1231
595 Ga0495603_0041313 3300046455 Bacteria 2758
596 Ga0495603_0091251 3300046455 Bacteria 1781
597 Ga0495603_0299279 3300046455 Bacteria 924
598 Ga0495584_0072450 3300046491 Bacteria 1731
599 Ga0495584_0294184 3300046491 Bacteria 825
600 Ga0495584_0608669 3300046491 Unclassified 557
601 Ga0495585_0611895 3300046492 Bacteria 512
602 Ga0495594_0007287 3300046499 Bacteria 5688
603 Ga0495637_0331650 3300046520 Bacteria 536
604 Ga0495644_0112620 3300046523 Bacteria 1033
605 Ga0495644_0177850 3300046523 Bacteria 818
606 Ga0495663_0002301 3300046525 Bacteria 5779
607 Ga0495663_0025145 3300046525 Bacteria 1735
608 Ga0495642_0013546 3300046528 Bacteria 3156
609 Ga0495642_0145704 3300046528 Bacteria 1023
610 Ga0495642_0276927 3300046528 Bacteria 734
611 Ga0495598_0085002 3300046537 Bacteria 1022
612 Ga0495598_0112300 3300046537 Bacteria 915
613 Ga0495598_0135740 3300046537 Bacteria 847
614 Ga0495609_0032312 3300046538 Bacteria 2378
615 Ga0495609_0082323 3300046538 Bacteria 1406
616 Ga0495621_0006696 3300046539 Bacteria 3376
617 Ga0495621_0010585 3300046539 Bacteria 2827
618 Ga0495621_0029131 3300046539 Bacteria 1881
619 Ga0495621_0050898 3300046539 Bacteria 1481
620 Ga0495621_0053768 3300046539 Bacteria 1446
621 Ga0495597_0249383 3300046542 Bacteria 698
622 Ga0495645_0084833 3300046543 Bacteria 2268
623 Ga0495633_0152790 3300046558 Bacteria 1066
624 Ga0495656_0109801 3300046615 Bacteria 1288
625 Ga0495656_0147093 3300046615 Bacteria 1135
626 Ga0495656_0237097 3300046615 Bacteria 917
627 Ga0495659_0003836 3300046664 Bacteria 4778
628 Ga0495659_0003971 3300046664 Bacteria 4684
629 Ga0495659_0007814 3300046664 Bacteria 3391
630 Ga0495659_0008682 3300046664 Bacteria 3237
631 Ga0495659_0040694 3300046664 Bacteria 1658
632 Ga0495659_0045790 3300046664 Bacteria 1578
633 Ga0495659_0175355 3300046664 Bacteria 871
634 Ga0495588_0306871 3300046674 Bacteria 835
635 Ga0495588_0343461 3300046674 Bacteria 785
636 Ga0495623_0373056 3300046679 Bacteria 773
637 Ga0495647_0432036 3300046681 Bacteria 608
638 Ga0495658_0119076 3300046683 Bacteria 1595
639 Ga0495658_0279330 3300046683 Bacteria 1054
640 Ga0495658_0365824 3300046683 Bacteria 917
641 Ga0495658_0577160 3300046683 Bacteria 720
642 Ga0495669_0140938 3300046684 Bacteria 1138
643 Ga0495669_0168348 3300046684 Bacteria 1042
644 Ga0495669_0287592 3300046684 Bacteria 791
645 Ga0495670_0169519 3300046691 Bacteria 1149
646 Ga0495636_0013486 3300047318 Bacteria 3244
647 Ga0495636_0038300 3300047318 Bacteria 1983
648 Ga0495636_0120150 3300047318 Bacteria 1162
649 Ga0495674_0409814 3300047319 Bacteria 1093
650 Ga0495677_0075993 3300047445 Bacteria 1255
651 Ga0495685_018798 3300047447 Bacteria 2373
652 Ga0495685_074109 3300047447 Bacteria 1138
653 Ga0495593_0200180 3300047673 Bacteria 1004
654 Ga0496102_0530418 3300048905 Bacteria 1100
655 Ga0496102_1269947 3300048905 Bacteria 656
656 Ga0496104_0377731 3300048907 Bacteria 1330
657 Ga0496106_1519420 3300048909 Unclassified 515
658 Ga0496108_0074788 3300048911 Bacteria 2861
659 Ga0496109_0677824 3300048912 Bacteria 968
660 Ga0496110_0615137 3300048913 Bacteria 985
661 Ga0496115_0686737 3300048918 Bacteria 806
662 Ga0501039_0711628 3300049575 Bacteria 785
663 Ga0501040_1413391 3300049576 Bacteria 505
664 Ga0501041_0453773 3300049577 Bacteria 814
665 Ga0501042_0597821 3300049578 Bacteria 802
666 Ga0501067_0029781 3300049583 Bacteria 3026
667 Ga0501069_0234648 3300049585 Bacteria 1068
668 Ga0501071_0266183 3300049587 Bacteria 1295
669 Ga0501072_0422667 3300049588 Bacteria 1056
670 Ga0501076_0416590 3300049592 Bacteria 1105
671 Ga0501198_066224 3300049649 Bacteria 673
672 Ga0501201_035438 3300049651 Bacteria 583
673 Ga0501202_154036 3300049652 Bacteria 603
674 Ga0501235_073862 3300049669 Bacteria 809
675 Ga0501247_026580 3300049677 Bacteria 773
676 Ga0501249_033761 3300049679 Bacteria 1147
677 Ga0501249_129024 3300049679 Bacteria 622
678 Ga0501079_0680176 3300049741 Bacteria 810
679 Ga0501262_039599 3300049759 Bacteria 701
680 Ga0501268_025160 3300049765 Bacteria 1044
681 Ga0501045_0616503 3300049824 Unclassified 803
682 nmdc:mga05p37_1093939_c1 3300050507 Bacteria 835
683 nmdc:mga05p37_167010_c1 3300050507 Bacteria 2685
684 nmdc:mga05p37_215482_c1 3300050507 Bacteria 2319
685 nmdc:mga05p37_232420_c1 3300050507 Bacteria 2221
686 nmdc:mga05p37_237287_c1 3300050507 Bacteria 2194
687 nmdc:mga05p37_492134_c1 3300050507 Bacteria 1410
688 nmdc:mga05p37_538763_c1 3300050507 Bacteria 1331
689 nmdc:mga05p37_577555_c1 3300050507 Bacteria 1274
690 nmdc:mga09592_122777_c1 3300050508 Bacteria 2232
691 nmdc:mga09592_137345_c1 3300050508 Bacteria 2106
692 nmdc:mga0qj67_294265_c1 3300050509 Bacteria 1316
693 nmdc:mga0qj67_507695_c1 3300050509 Bacteria 969
694 nmdc:mga06r32_141465_c1 3300050510 Bacteria 2383
695 nmdc:mga08y16_2250_c1 3300050511 Bacteria 19792
696 nmdc:mga08y16_4786_c1 3300050511 Bacteria 14122
697 nmdc:mga08y16_634521_c1 3300050511 Bacteria 1074
698 nmdc:mga08y16_78380_c1 3300050511 Bacteria 3445
699 nmdc:mga08y16_863672_c1 3300050511 Bacteria 893
700 nmdc:mga0n895_217349_c1 3300050512 Bacteria 1941
701 nmdc:mga0n895_246055_c1 3300050512 Bacteria 1815
702 nmdc:mga0n895_32497_c1 3300050512 Bacteria 5009
703 nmdc:mga0n895_39321_c1 3300050512 Bacteria 4590
704 nmdc:mga0rr50_107014_c1 3300050513 Bacteria 2207
705 nmdc:mga0rr50_1149486_c1 3300050513 Bacteria 660
706 nmdc:mga0rr50_134100_c1 3300050513 Bacteria 1986
707 nmdc:mga0rr50_20789_c1 3300050513 Bacteria 4466
708 nmdc:mga0rr50_42282_c1 3300050513 Bacteria 3327
709 nmdc:mga0rr50_897742_c1 3300050513 Bacteria 756
710 nmdc:mga0a205_1464652_c1 3300050515 Unclassified 531
711 nmdc:mga0a205_15119_c1 3300050515 Bacteria 7210
712 nmdc:mga0a205_27834_c1 3300050515 Bacteria 5400
713 nmdc:mga0a205_418486_c1 3300050515 Bacteria 1202
714 nmdc:mga0a205_56838_c1 3300050515 Bacteria 3778
715 nmdc:mga0a205_642_c2 3300050515 Bacteria 15441
716 nmdc:mga0a205_74893_c1 3300050515 Bacteria 3271
717 Ga0590071_019103 3300059421 Bacteria 1613
718 Ga0530510_0006724 3300061734 Bacteria 8015
719 Ga0070678_100098525
720 JGI24743J22301_10158052
721 JGI24749J21850_1035409
722 JGI24034J26672_10061529
723 Ga0065704_10139921
724 Ga0065712_10130134
725 Ga0065712_10145493
726 Ga0065715_10048398
727 Ga0065715_10131029
728 Ga0065715_10137627
729 Ga0065715_10220262
730 Ga0065715_10273355
731 Ga0065715_10278787
732 Ga0065707_10005018
733 Ga0065707_10060912
734 Ga0065707_10100879
735 Ga0065707_10672910
736 Ga0070676_10007176
737 Ga0070676_10304435
738 Ga0070676_10443062
739 Ga0070676_10587641
740 Ga0070683_100081504
741 Ga0070683_101692995
742 Ga0070690_100005505
743 Ga0070690_100009637
744 Ga0070690_101333721
745 Ga0070670_100005530
746 Ga0070670_100696157
747 Ga0070670_100917245
748 Ga0070677_10000693
749 Ga0070677_10028699
750 Ga0068869_100003252
751 Ga0068869_100007617
752 Ga0068869_100017183
753 Ga0068869_100830814
754 Ga0070666_10011823
755 Ga0070680_100422654
756 Ga0070680_100899618
757 Ga0070682_100894482
758 Ga0068868_100003775
759 Ga0068868_100704147
760 Ga0070660_100877522
761 Ga0070689_100040206
762 Ga0070689_100086154
763 Ga0070689_100104072
764 Ga0070689_100141940
765 Ga0070689_100525559
766 Ga0070691_10020843
767 Ga0070687_100003977
768 Ga0070687_100004263
769 Ga0070661_100022095
770 Ga0070661_100713606
771 Ga0070692_10002464
772 Ga0070692_10052649
773 Ga0070692_10431517
774 Ga0070668_100145300
775 Ga0070668_100625801
776 Ga0070668_102224132
777 Ga0070669_100000356
778 Ga0070669_100004311
779 Ga0070669_100012399
780 Ga0070669_100051717
781 Ga0070669_101526400
782 Ga0070675_100000879
783 Ga0070675_100008779
784 Ga0070675_100038221
785 Ga0070675_100069797
786 Ga0070675_100071253
787 Ga0070675_100647165
788 Ga0070675_100712165
789 Ga0070675_100803638
790 Ga0070671_100001545
791 Ga0070671_100106925
792 Ga0070671_100144156
793 Ga0070671_100321803
794 Ga0070671_100548166
795 Ga0070674_100022481
796 Ga0070674_100038937
797 Ga0070674_100055316
798 Ga0070674_100408620
799 Ga0070674_100416722
800 Ga0070674_101270061
801 Ga0070673_100016637
802 Ga0070673_100019347
803 Ga0070673_100040092
804 Ga0070673_100060945
805 Ga0070673_100119532
806 Ga0070673_100776551
807 Ga0070673_100906111
808 Ga0070673_101193438
809 Ga0070688_100038799
810 Ga0070688_100075791
811 Ga0070688_100214338
812 Ga0070688_101649766
813 Ga0070659_100802299
814 Ga0070667_100008291
815 Ga0070667_100050813
816 Ga0070667_100174751
817 Ga0070667_100311214
818 Ga0070667_100668328
819 Ga0070703_10070606
820 Ga0070703_10125218
821 Ga0070713_100045901
822 Ga0070701_10002613
823 Ga0070701_10011675
824 Ga0070701_10242452
825 Ga0070701_10631747
826 Ga0070711_100265715
827 Ga0070705_100000680
828 Ga0070705_100089958
829 Ga0070705_100329352
830 Ga0070705_100985715
831 Ga0070700_100006482
832 Ga0070700_100010751
833 Ga0070700_100039805
834 Ga0070700_100152725
835 Ga0070700_100409641
836 Ga0070700_100624022
837 Ga0070694_100012230
838 Ga0070694_100026712
839 Ga0070694_100452494
840 Ga0070694_101090487
841 Ga0070708_100479211
842 Ga0070663_100041198
843 Ga0070663_100555977
844 Ga0070678_100004798
845 Ga0070678_100274967
846 Ga0070678_100280986
847 Ga0070678_100321120
848 Ga0070662_100046164
849 Ga0070662_100160063
850 Ga0070662_101554902
851 Ga0070681_10007600
852 Ga0070681_10175000
853 Ga0070681_11938539
854 Ga0068867_100002261
855 Ga0068867_100037574
856 Ga0068867_100309710
857 Ga0068867_100624082
858 Ga0070685_10009796
859 Ga0070685_10818591
860 Ga0070706_100071749
861 Ga0070706_100326523
862 Ga0070707_100022254
863 Ga0070707_100162516
864 Ga0070707_100219840
865 Ga0070698_100005030
866 Ga0070698_100009236
867 Ga0070698_100333566
868 Ga0070699_100001266
869 Ga0070699_100003933
870 Ga0070699_100049632
871 Ga0070699_100899428
872 Ga0070679_100812538
873 Ga0070679_101554788
874 Ga0070684_100046836
875 Ga0070697_100018269
876 Ga0070697_100067226
877 Ga0070697_100129943
878 Ga0070697_100221143
879 Ga0070697_101230239
880 Ga0070697_101250108
881 Ga0068853_101019645
882 Ga0070672_100005810
883 Ga0070672_100047509
884 Ga0070672_100048422
885 Ga0070672_100259672
886 Ga0070672_100451382
887 Ga0070672_100465377
888 Ga0070672_100553811
889 Ga0070672_100560474
890 Ga0070672_100577106
891 Ga0070686_100007227
892 Ga0070686_100111573
893 Ga0070686_100115046
894 Ga0070695_100000031
895 Ga0070695_100053963
896 Ga0070695_100107259
897 Ga0070695_100250944
898 Ga0070696_100015765
899 Ga0070696_100018897
900 Ga0070696_100092570
901 Ga0070696_100114688
902 Ga0070696_101687258
903 Ga0070665_100062229
904 Ga0070704_100003975
905 Ga0070704_100011626
906 Ga0070704_100164316
907 Ga0070704_100239284
908 Ga0070704_100518591
909 Ga0070704_100740270
910 Ga0070664_100005393
911 Ga0070664_100010548
912 Ga0070664_100437845
913 Ga0070664_100484437
914 Ga0068857_100024776
915 Ga0068857_100565953
916 Ga0068854_100073556
917 Ga0070702_100020565
918 Ga0070702_100069296
919 Ga0070702_100244633
920 Ga0068852_101559038
921 Ga0068852_101745086
922 Ga0068859_100002556
923 Ga0068859_100019393
924 Ga0068859_100431321
925 Ga0068859_100815134
926 Ga0068859_100899804
927 Ga0068859_100918367
928 Ga0068864_100059294
929 Ga0068864_100071975
930 Ga0068864_100354094
931 Ga0068861_100006224
932 Ga0068861_100007414
933 Ga0068861_100264956
934 Ga0068861_100914729
935 Ga0068870_10001180
936 Ga0068870_10001479
937 Ga0068870_10247519
938 Ga0068870_10299519
939 Ga0068863_100010193
940 Ga0068863_100039502
941 Ga0068863_100085160
942 Ga0068858_100015917
943 Ga0068858_100021144
944 Ga0068858_100545970
945 Ga0068858_100913724
946 Ga0068858_101120823
947 Ga0068860_100008655
948 Ga0068860_100026716
949 Ga0068860_100115798
950 Ga0068860_100391810
951 Ga0068860_101085257
952 Ga0068862_100000604
953 Ga0068862_100012991
954 Ga0068862_100131534
955 Ga0068862_101002876
956 Ga0097621_100006671
957 Ga0097621_100108010
958 Ga0097621_100160959
959 Ga0097621_101718525
960 Ga0068871_100023623
961 Ga0068871_100032547
962 Ga0075428_100200106
963 Ga0075428_101679590
964 Ga0075431_100347243
965 Ga0075433_10016915
966 Ga0075433_10147105
967 Ga0075433_10328492
968 Ga0075433_10638870
969 Ga0075434_100003551
970 Ga0075434_100016691
971 Ga0075434_100038864
972 Ga0075434_100125435
973 Ga0075429_100067142
974 Ga0075429_100331367
975 Ga0075429_101528262
976 Ga0068865_100019232
977 Ga0068865_100036100
978 Ga0068865_100047508
979 Ga0068865_101155009
980 Ga0075436_101003377
981 Ga0097620_100002556
982 Ga0097620_100019393
983 Ga0097620_100431321
984 Ga0097620_100815102
985 Ga0097620_100899824
986 Ga0097620_100918339
987 Ga0097620_102795874
988 Ga0075435_100027873
989 Ga0075435_100098889
990 Ga0075435_100489846
991 Ga0075435_100619835
992 Ga0075435_100804119
993 Ga0075435_101247578
994 Ga0105244_10182237
995 Ga0105240_10618991
996 Ga0111539_10001120
997 Ga0111539_10030049
998 Ga0111539_10304883
999 Ga0111539_10362603
1000 Ga0111539_10939816
1001 Ga0105245_10509925
1002 Ga0105245_10644903
1003 Ga0105247_10472503
1004 Ga0114129_10026738
1005 Ga0114129_10030922
1006 Ga0114129_10101495
1007 Ga0114129_10274530
1008 Ga0114129_10436732
1009 Ga0114129_10797925
1010 Ga0114129_13044173
1011 Ga0105243_10070773
1012 Ga0105243_11971369
1013 Ga0105242_10300366
1014 Ga0105242_10606551
1015 Ga0105242_11153124
1016 Ga0105242_11267407
1017 Ga0105248_10014047
1018 Ga0105248_10047569
1019 Ga0105248_10157137
1020 Ga0105248_10307609
1021 Ga0105248_10780062
1022 Ga0105248_11041472
1023 Ga0105248_11831986
1024 Ga0105238_12101745
1025 Ga0105249_10010818
1026 Ga0105249_10048081
1027 Ga0105249_10391126
1028 Ga0105249_10614869
1029 Ga0105249_11674166
1030 Ga0105249_12177632
1031 Ga0105239_11823883
1032 Ga0105246_10109668
1033 Ga0105246_10143769
1034 Ga0157335_1021168
1035 Ga0157339_1019048
1036 Ga0157371_10301528
1037 Ga0157374_10052502
1038 Ga0157374_10136318
1039 Ga0157374_10519087
1040 Ga0157378_10314414
1041 Ga0157378_10468842
1042 Ga0157378_10502094
1043 Ga0157378_10763321
1044 Ga0163162_10004641
1045 Ga0163162_10852429
1046 Ga0163162_11545107
1047 Ga0157375_10023545
1048 Ga0157375_10089205
1049 Ga0157375_10138147
1050 Ga0157375_10806273
1051 Ga0157375_10870806
1052 Ga0157375_11065390
1053 Ga0157375_12068795
1054 Ga0163163_10038267
1055 Ga0163163_10216124
1056 Ga0163163_10345721
1057 Ga0163163_10595561
1058 Ga0157380_10007007
1059 Ga0157380_10008204
1060 Ga0157380_10090396
1061 Ga0157380_10175663
1062 Ga0157380_10679796
1063 Ga0157380_11072489
1064 Ga0157380_11638149
1065 Ga0157380_11841520
1066 Ga0157377_10001648
1067 Ga0157377_10033344
1068 Ga0157377_10254592
1069 Ga0157377_10652102
1070 Ga0157379_10004249
1071 Ga0157379_10413546
1072 Ga0157379_10477598
1073 Ga0157376_10021576
1074 Ga0157376_10316329
1075 Ga0157376_10390573
1076 Ga0157376_11597415
1077 Ga0157376_11794702
1078 Ga0163161_10229319
1079 Ga0207697_10000732
1080 Ga0207697_10159317
1081 Ga0207697_10253333
1082 Ga0207682_10000305
1083 Ga0207682_10024064
1084 Ga0207682_10046582
1085 Ga0207688_10002404
1086 Ga0207688_10165129
1087 Ga0207688_10358693
1088 Ga0207680_10008453
1089 Ga0207647_10717924
1090 Ga0207645_10001706
1091 Ga0207645_10060046
1092 Ga0207645_10106380
1093 Ga0207645_10447423
1094 Ga0207643_10002284
1095 Ga0207643_10244370
1096 Ga0207684_10085498
1097 Ga0207663_10209100
1098 Ga0207660_10397562
1099 Ga0207660_11065359
1100 Ga0207660_11151558
1101 Ga0207662_10002832
1102 Ga0207662_10018021
1103 Ga0207662_10810710
1104 Ga0207657_10288400
1105 Ga0207649_10015294
1106 Ga0207652_10754926
1107 Ga0207646_10037517
1108 Ga0207646_10242916
1109 Ga0207646_10373526
1110 Ga0207681_10001518
1111 Ga0207681_10020191
1112 Ga0207681_10099690
1113 Ga0207681_10176027
1114 Ga0207681_10573124
1115 Ga0207650_10002734
1116 Ga0207659_10000586
1117 Ga0207659_10001767
1118 Ga0207659_10009043
1119 Ga0207659_10017736
1120 Ga0207659_10046778
1121 Ga0207659_10527931
1122 Ga0207659_11158771
1123 Ga0207659_11238145
1124 Ga0207687_10517760
1125 Ga0207687_11107990
1126 Ga0207700_10020268
1127 Ga0207644_10007306
1128 Ga0207644_10176344
1129 Ga0207644_10195072
1130 Ga0207644_10280233
1131 Ga0207644_10323153
1132 Ga0207690_10514673
1133 Ga0207690_11146557
1134 Ga0207706_10002692
1135 Ga0207706_10111097
1136 Ga0207706_10229691
1137 Ga0207706_10269164
1138 Ga0207706_10851211
1139 Ga0207686_10004419
1140 Ga0207686_10307540
1141 Ga0207709_10056237
1142 Ga0207709_10066670
1143 Ga0207709_10126734
1144 Ga0207670_10004469
1145 Ga0207670_10017490
1146 Ga0207670_10050582
1147 Ga0207670_10147297
1148 Ga0207670_10972077
1149 Ga0207669_10025772
1150 Ga0207669_10025983
1151 Ga0207669_10246141
1152 Ga0207669_11144788
1153 Ga0207669_11181838
1154 Ga0207669_11269868
1155 Ga0207704_10009549
1156 Ga0207704_10040316
1157 Ga0207704_10078749
1158 Ga0207691_10000676
1159 Ga0207691_10043214
1160 Ga0207691_10062565
1161 Ga0207691_10090522
1162 Ga0207691_10182818
1163 Ga0207691_10866058
1164 Ga0207691_11022358
1165 Ga0207691_11276089
1166 Ga0207711_10035205
1167 Ga0207711_10091152
1168 Ga0207711_10169812
1169 Ga0207711_10194757
1170 Ga0207711_10244538
1171 Ga0207689_10002745
1172 Ga0207689_11273714
1173 Ga0207661_10337598
1174 Ga0207661_10760677
1175 Ga0207679_10003263
1176 Ga0207679_10120511
1177 Ga0207679_10332014
1178 Ga0207679_10826066
1179 Ga0207651_10020592
1180 Ga0207651_10078998
1181 Ga0207651_10126323
1182 Ga0207651_10147177
1183 Ga0207651_10188890
1184 Ga0207651_10251477
1185 Ga0207651_10297343
1186 Ga0207651_10548998
1187 Ga0207712_10001123
1188 Ga0207712_10005078
1189 Ga0207712_10353000
1190 Ga0207712_10549690
1191 Ga0207668_10038746
1192 Ga0207640_10148172
1193 Ga0207640_10228507
1194 Ga0207640_10375374
1195 Ga0207658_10205690
1196 Ga0207658_10572771
1197 Ga0207658_10709829
1198 Ga0207677_10040855
1199 Ga0207677_10086884
1200 Ga0207677_10368842
1201 Ga0207677_10546495
1202 Ga0207703_10065432
1203 Ga0207703_10331958
1204 Ga0207703_10757902
1205 Ga0207703_11134182
1206 Ga0207639_10920423
1207 Ga0207678_10551595
1208 Ga0207708_10003593
1209 Ga0207708_10022886
1210 Ga0207708_10056937
1211 Ga0207708_10061109
1212 Ga0207708_10311758
1213 Ga0207708_10593032
1214 Ga0207708_11498094
1215 Ga0207641_10010305
1216 Ga0207641_10067268
1217 Ga0207641_10280453
1218 Ga0207648_10001001
1219 Ga0207648_10041761
1220 Ga0207648_10150375
1221 Ga0207648_10194119
1222 Ga0207648_10733493
1223 Ga0207648_10959559
1224 Ga0207648_11046773
1225 Ga0207676_10067023
1226 Ga0207676_10335693
1227 Ga0207676_10478998
1228 Ga0207676_10536611
1229 Ga0207674_10004709
1230 Ga0207674_10806394
1231 Ga0207675_100009909
1232 Ga0207675_100041932
1233 Ga0207675_100691300
1234 Ga0207675_100801103
1235 Ga0207675_101009036
1236 Ga0207683_10005691
1237 Ga0207683_10042655
1238 Ga0207683_10248461
1239 Ga0207683_10257595
1240 Ga0207683_11076009
1241 Ga0207683_11629490
1242 Ga0207698_10447316
1243 Ga0210000_1035923
1244 Ga0209968_1013515
1245 Ga0209968_1022567
1246 Ga0209999_1018745
1247 Ga0207428_10000482
1248 Ga0207428_10003191
1249 Ga0207428_10011509
1250 Ga0268265_10000160
1251 Ga0268265_10066190
1252 Ga0268265_10604511
1253 Ga0268264_10010702
1254 Ga0268264_10128658
1255 Ga0268264_10174932
1256 Ga0268264_10414780
1257 Ga0307413_10004875
1258 Ga0307413_11014411
1259 Ga0307410_10003273
1260 Ga0307410_10200183
1261 Ga0307406_10129637
1262 Ga0307406_10679283
1263 Ga0307407_10026570
1264 Ga0307407_10029548
1265 Ga0307412_11000361
1266 Ga0307409_100220877
1267 Ga0307416_100306166
1268 Ga0307414_10034144
1269 Ga0307414_10081441
1270 Ga0307414_11884913
1271 Ga0307411_10005825
1272 Ga0307411_10095330
1273 Ga0307411_10582004
1274 Ga0307415_100009851
1275 Ga0373948_0017510
1276 Ga0373948_0116513
1277 Ga0373938_0019019
1278 Ga0373928_0118681
1279 Ga0373929_0104243
1280 Ga0373949_0025491
1281 Ga0373949_0039267
1282 Ga0373939_0003786
1283 Ga0373945_0499826
1284 Ga0373945_0516312
1285 Ga0373946_0041185
1286 Ga0373955_0720840
1287 Ga0373942_0094373
1288 Ga0373962_0012488
1289 Ga0373962_0026252
1290 Ga0373931_0066928
1291 Ga0373931_0133762
1292 Ga0373931_0649920
1293 Ga0373933_0392800
1294 Ga0373937_0073071
1295 Ga0373925_0612553
1296 Ga0436363_1151335
1297 Ga0439453_0002405
1298 Ga0451807_1676276
1299 Ga0451853_0141730
1300 Ga0439441_042840
1301 Ga0439449_0246276
1302 Ga0439435_0060184
1303 Ga0439464_0127493
1304 Ga0451577_0571414
1305 Ga0439440_0161196
1306 Ga0453683_0248275
1307 Ga0453684_1123335
1308 Ga0451576_0006002
1309 Ga0451576_0020013
1310 Ga0451576_0051465
1311 Ga0451576_0081830
1312 Ga0451576_0535131
1313 Ga0495603_0041313
1314 Ga0495603_0091251
1315 Ga0495603_0299279
1316 Ga0495584_0072450
1317 Ga0495584_0294184
1318 Ga0495584_0608669
1319 Ga0495585_0611895
1320 Ga0495594_0007287
1321 Ga0495637_0331650
1322 Ga0495644_0112620
1323 Ga0495644_0177850
1324 Ga0495663_0002301
1325 Ga0495663_0025145
1326 Ga0495642_0013546
1327 Ga0495642_0145704
1328 Ga0495642_0276927
1329 Ga0495598_0085002
1330 Ga0495598_0112300
1331 Ga0495598_0135740
1332 Ga0495609_0032312
1333 Ga0495609_0082323
1334 Ga0495621_0006696
1335 Ga0495621_0010585
1336 Ga0495621_0029131
1337 Ga0495621_0050898
1338 Ga0495621_0053768
1339 Ga0495597_0249383
1340 Ga0495645_0084833
1341 Ga0495633_0152790
1342 Ga0495656_0109801
1343 Ga0495656_0147093
1344 Ga0495656_0237097
1345 Ga0495659_0003836
1346 Ga0495659_0003971
1347 Ga0495659_0007814
1348 Ga0495659_0008682
1349 Ga0495659_0040694
1350 Ga0495659_0045790
1351 Ga0495659_0175355
1352 Ga0495588_0306871
1353 Ga0495588_0343461
1354 Ga0495623_0373056
1355 Ga0495647_0432036
1356 Ga0495658_0119076
1357 Ga0495658_0279330
1358 Ga0495658_0365824
1359 Ga0495658_0577160
1360 Ga0495669_0140938
1361 Ga0495669_0168348
1362 Ga0495669_0287592
1363 Ga0495670_0169519
1364 Ga0495636_0013486
1365 Ga0495636_0038300
1366 Ga0495636_0120150
1367 Ga0495674_0409814
1368 Ga0495677_0075993
1369 Ga0495685_018798
1370 Ga0495685_074109
1371 Ga0495593_0200180
1372 Ga0496102_0530418
1373 Ga0496102_1269947
1374 Ga0496104_0377731
1375 Ga0496106_1519420
1376 Ga0496108_0074788
1377 Ga0496109_0677824
1378 Ga0496110_0615137
1379 Ga0496115_0686737
1380 Ga0501039_0711628
1381 Ga0501040_1413391
1382 Ga0501041_0453773
1383 Ga0501042_0597821
1384 Ga0501067_0029781
1385 Ga0501069_0234648
1386 Ga0501071_0266183
1387 Ga0501072_0422667
1388 Ga0501076_0416590
1389 Ga0501198_066224
1390 Ga0501201_035438
1391 Ga0501202_154036
1392 Ga0501235_073862
1393 Ga0501247_026580
1394 Ga0501249_033761
1395 Ga0501249_129024
1396 Ga0501079_0680176
1397 Ga0501262_039599
1398 Ga0501268_025160
1399 Ga0501045_0616503
1400 nmdc:mga05p37_1093939_c1
1401 nmdc:mga05p37_167010_c1
1402 nmdc:mga05p37_215482_c1
1403 nmdc:mga05p37_232420_c1
1404 nmdc:mga05p37_237287_c1
1405 nmdc:mga05p37_492134_c1
1406 nmdc:mga05p37_538763_c1
1407 nmdc:mga05p37_577555_c1
1408 nmdc:mga09592_122777_c1
1409 nmdc:mga09592_137345_c1
1410 nmdc:mga0qj67_294265_c1
1411 nmdc:mga0qj67_507695_c1
1412 nmdc:mga06r32_141465_c1
1413 nmdc:mga08y16_2250_c1
1414 nmdc:mga08y16_4786_c1
1415 nmdc:mga08y16_634521_c1
1416 nmdc:mga08y16_78380_c1
1417 nmdc:mga08y16_863672_c1
1418 nmdc:mga0n895_217349_c1
1419 nmdc:mga0n895_246055_c1
1420 nmdc:mga0n895_32497_c1
1421 nmdc:mga0n895_39321_c1
1422 nmdc:mga0rr50_107014_c1
1423 nmdc:mga0rr50_1149486_c1
1424 nmdc:mga0rr50_134100_c1
1425 nmdc:mga0rr50_20789_c1
1426 nmdc:mga0rr50_42282_c1
1427 nmdc:mga0rr50_897742_c1
1428 nmdc:mga0a205_1464652_c1
1429 nmdc:mga0a205_15119_c1
1430 nmdc:mga0a205_27834_c1
1431 nmdc:mga0a205_418486_c1
1432 nmdc:mga0a205_56838_c1
1433 nmdc:mga0a205_642_c2
1434 nmdc:mga0a205_74893_c1
1435 Ga0590071_019103
1436 Ga0530510_0006724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

39

137

0.98

Map