F477162

General Info

Members Datasets Scaffolds Average Seq Length
718 506 530 270

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10449661|Ga0105237_104496611
Length 263
Sequence MSTEAAGDGPMMSSSADFSTVLNRILDTAADNLRIAKILVQMGLDPNNITYEAFALIGAVFFVATLLMQTMVPLRIANMAGCTFFVAFGALSGNVATFLLYLLLLPINAVRLRQMRNLIRKARLATESDTSMEWLRPFMTERRYRRGDTLCKKDDAANEMFLTITGRYLVTEIGVELPPGRIVGELGFLTPNKQRTATVECIEDGQVLTITYEKLLEIYFQNPQFGYYFLVLTSQRLLENISRLEGIVAQEKAARQGAGAADI

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355199
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
30 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
33 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
34 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
35 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
36 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
37 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
38 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
39 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
40 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
41 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
42 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
43 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
44 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
45 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
46 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
49 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
50 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
51 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
52 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
53 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
54 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
55 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
58 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
59 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
60 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
61 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
62 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
63 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
64 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
65 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
66 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
67 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
68 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
69 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
70 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
71 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
72 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
73 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
74 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
75 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
76 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
77 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
78 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
79 2904699407
80 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
81 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
82 2906610324
83 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
84 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
85 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
86 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
87 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
88 2922368715
89 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
90 2922425934
91 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
92 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
93 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
94 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
95 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
96 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
97 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
98 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
99 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
100 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
101 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
102 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
103 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
104 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
105 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
106 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
107 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
108 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
109 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
110 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
111 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
112 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
113 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
114 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
115 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
116 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
117 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
118 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
119 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
120 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
121 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
122 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
123 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
124 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
125 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
126 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
127 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
128 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
129 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
130 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
131 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
132 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
133 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
134 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
135 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
136 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
137 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
138 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
139 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
140 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
141 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
142 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
143 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
144 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
145 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
146 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
147 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
148 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
149 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
150 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
151 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
152 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
153 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
154 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
155 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
156 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
157 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
158 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
159 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
160 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
161 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
162 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
163 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
164 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
165 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
166 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
167 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
168 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
169 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
170 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
171 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
172 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
173 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
174 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
178 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
179 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
180 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
181 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
182 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
183 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
184 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
185 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
186 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
187 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
188 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
189 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
190 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
191 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
192 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
193 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
194 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
195 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
196 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
197 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
198 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
199 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
200 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
201 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
203 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
204 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
205 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
206 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
207 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
208 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
209 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
210 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
211 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
212 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
213 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
215 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
216 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
217 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
218 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
219 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
220 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
221 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
222 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
223 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
224 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
225 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
226 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
227 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
228 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
229 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
230 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
231 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
232 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
233 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
234 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
235 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
236 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
237 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
238 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
239 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
240 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
242 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
245 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
248 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
250 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
296 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
297 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
298 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
299 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
304 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
307 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
308 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
309 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
311 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
312 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
313 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
314 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
315 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
316 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
324 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
325 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
326 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
327 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
328 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
329 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
330 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
331 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
332 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
333 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
334 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
351 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
352 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
353 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
354 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
417 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
422 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
423 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
424 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
425 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
426 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
427 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
431 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
434 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
435 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
436 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
437 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
438 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
439 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
440 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
441 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
442 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
443 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
444 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
445 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
446 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
447 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
448 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
449 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
450 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
451 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
452 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
453 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
454 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
455 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
456 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
457 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
458 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
459 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
460 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
461 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
462 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
463 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
464 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
465 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
466 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
467 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
468 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
469 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
470 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
471 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
472 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
473 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
474 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
475 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
476 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
477 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
478 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
479 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
480 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
481 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
482 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
483 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
484 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
485 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
486 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
487 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
488 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
489 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
490 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
491 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
492 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
493 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
494 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
495 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
496 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
497 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
498 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
499 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
500 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
501 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
502 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
503 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
504 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
505 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
506 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.19
Metatranscriptomes 0.14
Isolates 25.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.43
Nodule 19.64
Rhizoplane 3.48
Rhizosphere 50.42
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001591 3300003203 Bacteria 10726
2 JGI25406J46586_10003138 3300003203 Bacteria 7765
3 JGI25153J46596_10001822 3300003215 Bacteria 12629
4 JGI25153J46596_10003459 3300003215 Bacteria 8844
5 JGI25153J46596_10004454 3300003215 Bacteria 7551
6 JGI25153J46596_10030199 3300003215 Bacteria 1848
7 JGI25160J50197_1000729 3300003354 Bacteria 17998
8 JGI25160J50197_1002598 3300003354 Bacteria 8344
9 JGI25404J52841_10009491 3300003659 Bacteria 2080
10 Ga0055542_1005244 3300003762 Bacteria 2964
11 Ga0055526_1051644 3300003771 Bacteria 933
12 Ga0055531_10004381 3300003794 Bacteria 8620
13 JGI25405J52794_10035098 3300003911 Bacteria 1050
14 Ga0055543_1001967 3300004625 Bacteria 7323
15 Ga0065165_1000278 3300005262 Bacteria 87353
16 Ga0065165_1005698 3300005262 Bacteria 6856
17 Ga0065165_1010190 3300005262 Bacteria 4099
18 Ga0070683_100015396 3300005329 Bacteria 6717
19 Ga0070670_100061597 3300005331 Bacteria 3221
20 Ga0068869_100067311 3300005334 Bacteria 2642
21 Ga0070680_100007902 3300005336 Bacteria 8111
22 Ga0070680_100011830 3300005336 Bacteria 6768
23 Ga0068868_100004886 3300005338 Bacteria 9409
24 Ga0068868_100152190 3300005338 Bacteria 1906
25 Ga0070660_100099635 3300005339 Bacteria 2301
26 Ga0070660_100388847 3300005339 Bacteria 1152
27 Ga0070661_100282180 3300005344 Bacteria 1289
28 Ga0070668_100148632 3300005347 Bacteria 1893
29 Ga0070669_100265305 3300005353 Bacteria 1371
30 Ga0070675_100220742 3300005354 Bacteria 1651
31 Ga0070671_100012665 3300005355 Bacteria 6799
32 Ga0070673_100117541 3300005364 Bacteria 2213
33 Ga0070673_100147632 3300005364 Bacteria 1989
34 Ga0070709_10043295 3300005434 Bacteria 2783
35 Ga0070709_10066265 3300005434 Bacteria 2315
36 Ga0070709_10336632 3300005434 Bacteria 1112
37 Ga0070713_100003997 3300005436 Bacteria 9815
38 Ga0070710_10003009 3300005437 Bacteria 8016
39 Ga0070710_10128048 3300005437 Bacteria 1544
40 Ga0070711_100043044 3300005439 Bacteria 3056
41 Ga0070663_100033372 3300005455 Bacteria 3556
42 Ga0070663_100067025 3300005455 Bacteria 2603
43 Ga0070663_100301617 3300005455 Bacteria 1282
44 Ga0070662_100097867 3300005457 Bacteria 2215
45 Ga0070681_10018303 3300005458 Bacteria 7001
46 Ga0070681_10039237 3300005458 Bacteria 4747
47 Ga0070681_10221653 3300005458 Bacteria 1806
48 Ga0070698_100013516 3300005471 Bacteria 8642
49 Ga0070684_100014665 3300005535 Bacteria 6356
50 Ga0070684_100191857 3300005535 Bacteria 1859
51 Ga0070697_100468120 3300005536 Bacteria 1099
52 Ga0068853_100047034 3300005539 Bacteria 3702
53 Ga0068853_100132298 3300005539 Bacteria 2234
54 Ga0068853_100262303 3300005539 Bacteria 1589
55 Ga0068853_100404795 3300005539 Bacteria 1278
56 Ga0068855_100017763 3300005563 Bacteria 8551
57 Ga0068855_100031717 3300005563 Bacteria 6309
58 Ga0070664_100063775 3300005564 Bacteria 3142
59 Ga0068857_100142520 3300005577 Bacteria 2167
60 Ga0068857_100176731 3300005577 Bacteria 1942
61 Ga0068857_100358954 3300005577 Bacteria 1350
62 Ga0068857_100404836 3300005577 Bacteria 1270
63 Ga0068856_100219740 3300005614 Bacteria 1915
64 Ga0070702_100094805 3300005615 Bacteria 1818
65 Ga0068852_100010094 3300005616 Bacteria 7030
66 Ga0068852_100524486 3300005616 Bacteria 1182
67 Ga0068864_100141029 3300005618 Bacteria 2174
68 Ga0068864_100231811 3300005618 Bacteria 1708
69 Ga0068861_100109478 3300005719 Bacteria 2211
70 Ga0068863_100628002 3300005841 Bacteria 1064
71 Ga0068862_100052050 3300005844 Bacteria 3502
72 Ga0068862_100099684 3300005844 Bacteria 2540
73 Ga0081455_10042189 3300005937 Bacteria 4005
74 Ga0081455_10042301 3300005937 Bacteria 3999
75 Ga0081540_1001897 3300005983 Bacteria 17504
76 Ga0081540_1003613 3300005983 Bacteria 12137
77 Ga0081539_10000945 3300005985 Bacteria 54444
78 Ga0070717_10007297 3300006028 Bacteria 8199
79 Ga0070717_10019413 3300006028 Bacteria 5329
80 Ga0070717_10142595 3300006028 Bacteria 2067
81 Ga0075365_10008873 3300006038 Bacteria 5740
82 Ga0075365_10161387 3300006038 Unclassified 1562
83 Ga0075368_10006951 3300006042 Bacteria 3979
84 Ga0075363_100043257 3300006048 Bacteria 2382
85 Ga0075364_10007096 3300006051 Bacteria 6624
86 Ga0075364_10008417 3300006051 Bacteria 6165
87 Ga0070715_10000729 3300006163 Bacteria 8879
88 Ga0070712_100027427 3300006175 Bacteria 3803
89 Ga0070712_100040008 3300006175 Bacteria 3211
90 Ga0075362_10014038 3300006177 Bacteria 3224
91 Ga0075367_10008803 3300006178 Bacteria 5249
92 Ga0075367_10049439 3300006178 Bacteria 2478
93 Ga0075367_10077069 3300006178 Bacteria 2012
94 Ga0075369_10030768 3300006186 Bacteria 2262
95 Ga0075369_10087434 3300006186 Bacteria 1388
96 Ga0075366_10004318 3300006195 Bacteria 7627
97 Ga0075366_10063342 3300006195 Bacteria 2198
98 Ga0075366_10067000 3300006195 Bacteria 2136
99 Ga0097621_100016142 3300006237 Bacteria 5638
100 Ga0097621_100307751 3300006237 Bacteria 1401
101 Ga0075370_10009166 3300006353 Bacteria 5124
102 Ga0075370_10025933 3300006353 Bacteria 3244
103 Ga0075370_10041524 3300006353 Bacteria 2596
104 Ga0068871_100162275 3300006358 Bacteria 1912
105 Ga0075434_100205515 3300006871 Bacteria 1989
106 Ga0099825_1032376 3300006941 Bacteria 2127
107 Ga0099824_1016133 3300006942 Bacteria 6855
108 Ga0099823_1044958 3300006944 Bacteria 2968
109 Ga0099794_10055211 3300007265 Bacteria 1919
110 Ga0105251_10164062 3300009011 Bacteria 1002
111 Ga0105240_10031852 3300009093 Bacteria 6832
112 Ga0105240_10077493 3300009093 Bacteria 4095
113 Ga0105240_10125673 3300009093 Bacteria 3082
114 Ga0105245_10001585 3300009098 Bacteria 20674
115 Ga0105245_10004121 3300009098 Bacteria 12904
116 Ga0105243_10650653 3300009148 Bacteria 1021
117 Ga0105241_10023166 3300009174 Bacteria 4603
118 Ga0105241_10033535 3300009174 Bacteria 3854
119 Ga0105241_10057648 3300009174 Bacteria 2980
120 Ga0105241_10375328 3300009174 Bacteria 1241
121 Ga0105241_10499596 3300009174 Bacteria 1084
122 Ga0105248_10004940 3300009177 Bacteria 14731
123 Ga0105248_10012339 3300009177 Bacteria 9428
124 Ga0105248_10098240 3300009177 Bacteria 3298
125 Ga0105237_10014161 3300009545 Bacteria 8349
126 Ga0105237_10015754 3300009545 Bacteria 7862
127 Ga0105237_10051651 3300009545 Bacteria 4129
128 Ga0105237_10430259 3300009545 Bacteria 1325
129 Ga0105237_10449661 3300009545 Bacteria 1294
130 Ga0105249_10288445 3300009553 Bacteria 1642
131 Ga0105239_10052215 3300010375 Bacteria 4482
132 Ga0105239_10181027 3300010375 Bacteria 2358
133 Ga0105239_10192370 3300010375 Bacteria 2284
134 Ga0105239_10250456 3300010375 Bacteria 1989
135 Ga0105246_10001515 3300011119 Bacteria 13777
136 Ga0105246_10096611 3300011119 Bacteria 2142
137 Ga0105246_10141857 3300011119 Bacteria 1808
138 Ga0105246_10172710 3300011119 Bacteria 1657
139 Ga0157370_10013630 3300013104 Bacteria 8365
140 Ga0157370_10083372 3300013104 Bacteria 3006
141 Ga0157370_10095939 3300013104 Bacteria 2782
142 Ga0157369_10026130 3300013105 Bacteria 6478
143 Ga0157369_10078089 3300013105 Bacteria 3547
144 Ga0157374_10033415 3300013296 Bacteria 4693
145 Ga0157374_10266386 3300013296 Bacteria 1689
146 Ga0157378_10158618 3300013297 Bacteria 2114
147 Ga0163162_10138456 3300013306 Bacteria 2545
148 Ga0163162_10219951 3300013306 Bacteria 2029
149 Ga0157372_10209269 3300013307 Bacteria 2260
150 Ga0163163_10017116 3300014325 Bacteria 6752
151 Ga0157377_10133828 3300014745 Bacteria 1517
152 Ga0157376_10043971 3300014969 Bacteria 3669
153 Ga0209563_101494 3300025230 Bacteria 6143
154 Ga0207425_1017592 3300025245 Bacteria 1567
155 Ga0209677_105896 3300025253 Bacteria 3061
156 Ga0209148_1000344 3300025254 Bacteria 61011
157 Ga0209233_1005823 3300025261 Bacteria 4049
158 Ga0209673_1024307 3300025273 Bacteria 2039
159 Ga0209564_1002208 3300025295 Bacteria 16231
160 Ga0209758_1000407 3300025297 Bacteria 73945
161 Ga0209758_1000900 3300025297 Bacteria 40401
162 Ga0209758_1000952 3300025297 Bacteria 39040
163 Ga0209758_1011752 3300025297 Bacteria 5019
164 Ga0209758_1030934 3300025297 Bacteria 2206
165 Ga0209256_1019540 3300025299 Bacteria 2151
166 Ga0207426_1000466 3300025302 Bacteria 62533
167 Ga0207426_1000865 3300025302 Bacteria 31635
168 Ga0207426_1003194 3300025302 Bacteria 9234
169 Ga0207426_1008651 3300025302 Bacteria 4086
170 Ga0207426_1024999 3300025302 Bacteria 2018
171 Ga0209257_1001445 3300025304 Bacteria 28079
172 Ga0207697_10032884 3300025315 Bacteria 2123
173 Ga0207697_10060508 3300025315 Bacteria 1575
174 Ga0207692_10000318 3300025898 Bacteria 16715
175 Ga0207692_10027670 3300025898 Bacteria 2673
176 Ga0207692_10140739 3300025898 Bacteria 1372
177 Ga0207692_10189975 3300025898 Bacteria 1202
178 Ga0207710_10130873 3300025900 Bacteria 1205
179 Ga0207647_10008614 3300025904 Bacteria 7300
180 Ga0207685_10001710 3300025905 Bacteria 4749
181 Ga0207685_10049864 3300025905 Bacteria 1610
182 Ga0207699_10021869 3300025906 Bacteria 3456
183 Ga0207699_10064756 3300025906 Bacteria 2213
184 Ga0207643_10216684 3300025908 Bacteria 1170
185 Ga0207684_10037545 3300025910 Bacteria 4111
186 Ga0207684_10200944 3300025910 Bacteria 1719
187 Ga0207654_10001150 3300025911 Bacteria 14244
188 Ga0207654_10084567 3300025911 Bacteria 1918
189 Ga0207654_10170555 3300025911 Bacteria 1413
190 Ga0207707_10001119 3300025912 Bacteria 25478
191 Ga0207707_10003222 3300025912 Bacteria 14487
192 Ga0207707_10007981 3300025912 Bacteria 9195
193 Ga0207707_10220119 3300025912 Bacteria 1652
194 Ga0207707_10234549 3300025912 Bacteria 1596
195 Ga0207695_10000029 3300025913 Bacteria 548364
196 Ga0207695_10063666 3300025913 Bacteria 3801
197 Ga0207695_10074630 3300025913 Bacteria 3453
198 Ga0207695_10275109 3300025913 Bacteria 1578
199 Ga0207671_10005971 3300025914 Bacteria 11027
200 Ga0207671_10048682 3300025914 Bacteria 3137
201 Ga0207671_10143580 3300025914 Bacteria 1841
202 Ga0207671_10164947 3300025914 Bacteria 1717
203 Ga0207693_10027725 3300025915 Bacteria 4477
204 Ga0207663_10002625 3300025916 Bacteria 8648
205 Ga0207663_10303285 3300025916 Bacteria 1194
206 Ga0207660_10012652 3300025917 Bacteria 5527
207 Ga0207660_10038528 3300025917 Bacteria 3338
208 Ga0207660_10084511 3300025917 Bacteria 2339
209 Ga0207660_10334749 3300025917 Bacteria 1211
210 Ga0207657_10064333 3300025919 Bacteria 3131
211 Ga0207657_10250543 3300025919 Bacteria 1412
212 Ga0207652_10008142 3300025921 Bacteria 8418
213 Ga0207652_10010456 3300025921 Bacteria 7470
214 Ga0207652_10026854 3300025921 Bacteria 4798
215 Ga0207694_10221557 3300025924 Bacteria 1543
216 Ga0207650_10091560 3300025925 Bacteria 2324
217 Ga0207687_10055275 3300025927 Bacteria 2781
218 Ga0207700_10007250 3300025928 Bacteria 6764
219 Ga0207700_10022832 3300025928 Bacteria 4299
220 Ga0207700_10511229 3300025928 Bacteria 1063
221 Ga0207664_10204060 3300025929 Bacteria 1708
222 Ga0207644_10086201 3300025931 Bacteria 2331
223 Ga0207690_10531007 3300025932 Bacteria 955
224 Ga0207706_10125734 3300025933 Bacteria 2255
225 Ga0207706_10326521 3300025933 Bacteria 1335
226 Ga0207709_10026733 3300025935 Bacteria 3317
227 Ga0207665_10000311 3300025939 Bacteria 33740
228 Ga0207711_10212668 3300025941 Bacteria 1767
229 Ga0207711_10224952 3300025941 Bacteria 1717
230 Ga0207689_10014007 3300025942 Bacteria 6827
231 Ga0207661_10008392 3300025944 Bacteria 7381
232 Ga0207679_10034372 3300025945 Bacteria 3576
233 Ga0207667_10037454 3300025949 Bacteria 5183
234 Ga0207667_10134031 3300025949 Bacteria 2551
235 Ga0207667_10728591 3300025949 Bacteria 992
236 Ga0207651_10096664 3300025960 Bacteria 2179
237 Ga0207668_10139792 3300025972 Bacteria 1860
238 Ga0207658_10030261 3300025986 Bacteria 3832
239 Ga0207658_10576004 3300025986 Bacteria 1009
240 Ga0207677_10013899 3300026023 Bacteria 4679
241 Ga0207703_10162839 3300026035 Bacteria 1955
242 Ga0207639_10456198 3300026041 Bacteria 1161
243 Ga0207678_10042504 3300026067 Bacteria 3937
244 Ga0207678_10523324 3300026067 Bacteria 1035
245 Ga0207702_10734210 3300026078 Bacteria 974
246 Ga0207676_10236809 3300026095 Bacteria 1635
247 Ga0207674_10056763 3300026116 Bacteria 3973
248 Ga0207674_10068547 3300026116 Bacteria 3570
249 Ga0207674_10371185 3300026116 Bacteria 1383
250 Ga0207675_100154789 3300026118 Bacteria 2184
251 Ga0207698_10015126 3300026142 Bacteria 5158
252 Ga0207698_10459006 3300026142 Bacteria 1232
253 Ga0209389_1000011 3300027296 Bacteria 223265
254 Ga0209389_1000025 3300027296 Bacteria 149588
255 Ga0209589_1000066 3300027357 Bacteria 100795
256 Ga0209489_100017 3300027361 Bacteria 223265
257 Ga0209489_100030 3300027361 Bacteria 185999
258 Ga0209700_100027 3300027363 Bacteria 223462
259 Ga0209179_1006560 3300027512 Bacteria 1883
260 Ga0209588_1002751 3300027671 Bacteria 4807
261 Ga0268264_10134165 3300028381 Bacteria 2199
262 Ga0265762_1034850 3300030760 Bacteria 967
263 Ga0265314_10071779 3300031711 Bacteria 2315
264 Ga0265342_10021560 3300031712 Bacteria 4111
265 Ga0307516_10062981 3300031730 Bacteria 3592
266 Ga0307510_10042405 3300033180 Bacteria 4959
267 Ga0316215_1000880 3300033544 Bacteria 2949
268 Ga0373944_0048648 3300035089 Bacteria 1331
269 Ga0373936_0108395 3300035113 Bacteria 1177
270 Ga0373936_0120468 3300035113 Bacteria 1120
271 Ga0373945_0064938 3300035116 Bacteria 1369
272 Ga0373957_0051449 3300035120 Bacteria 1576
273 Ga0373943_0005471 3300035170 Bacteria 5717
274 Ga0373943_0031479 3300035170 Bacteria 2517
275 Ga0373946_0027185 3300035171 Bacteria 2261
276 Ga0373955_0009368 3300035172 Bacteria 4583
277 Ga0373955_0019488 3300035172 Bacteria 3392
278 Ga0373924_0069072 3300035410 Bacteria 1488
279 Ga0373935_0010393 3300035692 Bacteria 5581
280 Ga0373927_0000515 3300035695 Bacteria 29473
281 Ga0373933_0008698 3300035724 Bacteria 5535
282 Ga0373933_0037509 3300035724 Bacteria 2843
283 Ga0373947_0011552 3300035725 Bacteria 5065
284 Ga0373947_0027207 3300035725 Bacteria 3346
285 Ga0373937_0368708 3300036401 Bacteria 1361
286 Ga0373937_0503138 3300036401 Bacteria 1151
287 Ga0373925_0001116 3300037068 Bacteria 23846
288 Ga0373925_0052470 3300037068 Bacteria 3046
289 Ga0395900_0001980 3300037418 Bacteria 23121
290 Ga0395898_0018122 3300037466 Bacteria 7186
291 Ga0395905_0015966 3300037471 Bacteria 7137
292 Ga0395905_0083925 3300037471 Bacteria 2984
293 Ga0395905_0311355 3300037471 Bacteria 1463
294 Ga0395901_0026781 3300038443 Bacteria 5920
295 Ga0395901_0071278 3300038443 Bacteria 3621
296 Ga0395901_0093836 3300038443 Bacteria 3143
297 Ga0395901_0148346 3300038443 Bacteria 2465
298 Ga0436361_1211699 3300039447 Bacteria 1967
299 Ga0436363_0232520 3300039450 Bacteria 4878
300 Ga0466972_0000261 3300044658 Bacteria 34759
301 Ga0466972_0008229 3300044658 Bacteria 5228
302 Ga0466966_0000211 3300044684 Bacteria 38929
303 Ga0466966_0205536 3300044684 Bacteria 1191
304 Ga0466961_0005032 3300044693 Bacteria 8314
305 Ga0466961_0165283 3300044693 Bacteria 1378
306 Ga0466963_0221714 3300044694 Bacteria 1324
307 Ga0466971_0037598 3300044719 Bacteria 2170
308 Ga0466968_0001473 3300044735 Bacteria 8432
309 Ga0466970_0296155 3300044765 Bacteria 912
310 Ga0466957_0017412 3300044842 Bacteria 4208
311 Ga0466960_0002388 3300044901 Bacteria 7066
312 Ga0466959_0011922 3300045049 Bacteria 6266
313 Ga0466959_0012080 3300045049 Bacteria 6231
314 Ga0495592_0032474 3300046454 Bacteria 3938
315 Ga0495592_0195789 3300046454 Bacteria 1367
316 Ga0495603_0000156 3300046455 Bacteria 34369
317 Ga0495629_0000297 3300046459 Bacteria 42433
318 Ga0495629_0014255 3300046459 Bacteria 5724
319 Ga0495629_0085568 3300046459 Bacteria 2200
320 Ga0495629_0119612 3300046459 Bacteria 1835
321 Ga0495638_0009098 3300046460 Bacteria 6993
322 Ga0495641_0003323 3300046461 Bacteria 12109
323 Ga0495651_0152145 3300046462 Bacteria 1666
324 Ga0495651_0205242 3300046462 Bacteria 1376
325 Ga0495653_0081497 3300046463 Bacteria 2391
326 Ga0495653_0102683 3300046463 Bacteria 2069
327 Ga0495580_0004927 3300046472 Bacteria 11163
328 Ga0495582_0000087 3300046473 Bacteria 47529
329 Ga0495582_0145047 3300046473 Bacteria 1346
330 Ga0495639_0003735 3300046475 Bacteria 6549
331 Ga0495639_0053073 3300046475 Bacteria 1846
332 Ga0495662_0001853 3300046476 Bacteria 10603
333 Ga0495662_0106921 3300046476 Bacteria 1370
334 Ga0495664_0036389 3300046477 Bacteria 2901
335 Ga0495664_0122796 3300046477 Bacteria 1570
336 Ga0495594_0000722 3300046499 Bacteria 16979
337 Ga0495583_0025158 3300046506 Bacteria 2979
338 Ga0495606_0034700 3300046507 Bacteria 3459
339 Ga0495608_0012913 3300046511 Bacteria 5797
340 Ga0495610_0039636 3300046512 Bacteria 2381
341 Ga0495618_0018261 3300046514 Bacteria 4306
342 Ga0495618_0077691 3300046514 Bacteria 2115
343 Ga0495628_0061710 3300046516 Bacteria 2940
344 Ga0495628_0270695 3300046516 Bacteria 1263
345 Ga0495628_0347869 3300046516 Bacteria 1090
346 Ga0495630_0004575 3300046517 Bacteria 9693
347 Ga0495648_0013331 3300046524 Bacteria 6084
348 Ga0495648_0161593 3300046524 Bacteria 1157
349 Ga0495652_0048579 3300046529 Bacteria 3635
350 Ga0495652_0167152 3300046529 Bacteria 1701
351 Ga0495652_0178992 3300046529 Bacteria 1629
352 Ga0495652_0264297 3300046529 Bacteria 1268
353 Ga0495665_0000117 3300046531 Bacteria 37802
354 Ga0495640_0014622 3300046533 Bacteria 5930
355 Ga0495640_0038248 3300046533 Bacteria 3376
356 Ga0495640_0126489 3300046533 Bacteria 1657
357 Ga0495586_0208382 3300046535 Bacteria 1109
358 Ga0495587_0152159 3300046536 Bacteria 1318
359 Ga0495597_0029333 3300046542 Bacteria 2512
360 Ga0495622_0034064 3300046557 Bacteria 2376
361 Ga0495667_0010331 3300046559 Bacteria 6314
362 Ga0495667_0064983 3300046559 Bacteria 2386
363 Ga0495667_0292051 3300046559 Bacteria 1034
364 Ga0495667_0296516 3300046559 Bacteria 1025
365 Ga0495668_0198568 3300046616 Bacteria 1098
366 Ga0495634_0005647 3300046642 Bacteria 9582
367 Ga0495634_0057409 3300046642 Bacteria 2598
368 Ga0495634_0084852 3300046642 Bacteria 2065
369 Ga0495611_0120783 3300046648 Bacteria 1222
370 Ga0495625_0011551 3300046660 Bacteria 7194
371 Ga0495625_0205447 3300046660 Bacteria 1297
372 Ga0495635_0002863 3300046663 Bacteria 11862
373 Ga0495635_0007694 3300046663 Bacteria 7517
374 Ga0495635_0298433 3300046663 Bacteria 1080
375 Ga0495657_0009077 3300046675 Bacteria 7557
376 Ga0495657_0014067 3300046675 Bacteria 5878
377 Ga0495599_0116566 3300046678 Bacteria 1661
378 Ga0495623_0111389 3300046679 Bacteria 1658
379 Ga0495646_0019514 3300046680 Bacteria 4291
380 Ga0495647_0000849 3300046681 Bacteria 9146
381 Ga0495658_0000331 3300046683 Bacteria 26505
382 Ga0495613_0008600 3300046689 Bacteria 7576
383 Ga0495613_0070731 3300046689 Bacteria 2544
384 Ga0495624_0001012 3300046690 Bacteria 22250
385 Ga0495624_0110149 3300046690 Bacteria 1693
386 Ga0495649_0070668 3300046694 Bacteria 1871
387 Ga0495649_0116789 3300046694 Bacteria 1412
388 Ga0495600_0032498 3300046809 Bacteria 3386
389 Ga0495600_0111490 3300046809 Bacteria 1781
390 Ga0495581_0000543 3300047315 Bacteria 19442
391 Ga0495581_0139496 3300047315 Bacteria 1414
392 Ga0495581_0160633 3300047315 Bacteria 1313
393 Ga0495604_0045510 3300047317 Bacteria 3424
394 Ga0495604_0134140 3300047317 Bacteria 1776
395 Ga0495674_0000177 3300047319 Bacteria 50030
396 Ga0495674_0055953 3300047319 Bacteria 3457
397 Ga0495676_0052488 3300047321 Bacteria 3254
398 Ga0495676_0158294 3300047321 Bacteria 1605
399 Ga0495676_0206390 3300047321 Bacteria 1362
400 Ga0495680_0077188 3300047322 Bacteria 2523
401 Ga0495687_018792 3300047443 Bacteria 3407
402 Ga0495675_0053976 3300047444 Bacteria 2550
403 Ga0495673_0007095 3300047469 Bacteria 6493
404 Ga0495684_0000357 3300047471 Bacteria 36963
405 Ga0495684_0015566 3300047471 Bacteria 5855
406 Ga0495684_0016950 3300047471 Bacteria 5612
407 Ga0495684_0049442 3300047471 Bacteria 3212
408 Ga0495686_0044369 3300047472 Bacteria 2815
409 Ga0495593_0000156 3300047673 Bacteria 34308
410 Ga0495593_0049272 3300047673 Bacteria 2236
411 Ga0495602_0210882 3300048088 Bacteria 1474
412 Ga0495614_0086117 3300048089 Bacteria 1364
413 Ga0496102_0010378 3300048905 Bacteria 8014
414 Ga0496103_0020315 3300048906 Bacteria 3989
415 Ga0496104_0019267 3300048907 Bacteria 6240
416 Ga0496104_0097493 3300048907 Bacteria 2814
417 Ga0496104_0543750 3300048907 Bacteria 1072
418 Ga0496105_0063051 3300048908 Bacteria 3058
419 Ga0496106_0017841 3300048909 Bacteria 5248
420 Ga0496108_0040294 3300048911 Bacteria 3893
421 Ga0496108_0328005 3300048911 Bacteria 1334
422 Ga0496109_0257512 3300048912 Bacteria 1643
423 Ga0496109_0387527 3300048912 Bacteria 1320
424 Ga0496110_0021826 3300048913 Bacteria 5428
425 Ga0496110_0041338 3300048913 Bacteria 4022
426 Ga0496110_0205828 3300048913 Bacteria 1788
427 Ga0496111_0150775 3300048914 Bacteria 1724
428 Ga0496111_0538468 3300048914 Bacteria 858
429 Ga0496112_0062188 3300048915 Bacteria 3682
430 Ga0496112_0098946 3300048915 Bacteria 2886
431 Ga0496112_0296889 3300048915 Bacteria 1561
432 Ga0496112_0388751 3300048915 Bacteria 1335
433 Ga0496113_0046252 3300048916 Bacteria 3230
434 Ga0496114_0242677 3300048917 Bacteria 1585
435 Ga0496114_0353741 3300048917 Bacteria 1299
436 Ga0496115_0074634 3300048918 Bacteria 2754
437 Ga0496115_0147902 3300048918 Bacteria 1939
438 Ga0496117_0080961 3300048920 Bacteria 2133
439 Ga0496119_0081115 3300048922 Bacteria 1869
440 Ga0496119_0174238 3300048922 Bacteria 1133
441 Ga0496120_0010597 3300048923 Bacteria 6411
442 Ga0496121_0035122 3300048924 Bacteria 4498
443 Ga0496121_0055828 3300048924 Bacteria 3287
444 Ga0496121_0250475 3300048924 Bacteria 1228
445 Ga0496121_0389356 3300048924 Bacteria 916
446 Ga0496123_0088746 3300048926 Bacteria 1845
447 Ga0496124_0178147 3300048927 Bacteria 1638
448 Ga0496124_0301428 3300048927 Bacteria 1157
449 Ga0496125_0096219 3300048928 Bacteria 2199
450 Ga0496126_0172539 3300048929 Bacteria 1841
451 Ga0495678_092178 3300049459 Bacteria 1065
452 Ga0495682_0031543 3300049460 Bacteria 1958
453 Ga0501071_0200210 3300049587 Bacteria 1500
454 Ga0501076_0176722 3300049592 Bacteria 1740
455 nmdc:mga03683_55123_c1 3300050489 Bacteria 1669
456 nmdc:mga03n38_152974_c1 3300050490 Bacteria 1162
457 nmdc:mga03n38_6610_c1 3300050490 Bacteria 4043
458 nmdc:mga00v17_114536_c1 3300050491 Bacteria 1713
459 nmdc:mga00v17_173408_c1 3300050491 Bacteria 1391
460 nmdc:mga00v17_35992_c1 3300050491 Bacteria 2949
461 nmdc:mga0yw44_21091_c1 3300050492 Bacteria 3629
462 nmdc:mga0yw44_34705_c1 3300050492 Bacteria 2958
463 nmdc:mga0yw44_363580_c1 3300050492 Unclassified 975
464 nmdc:mga0yw44_73169_c1 3300050492 Bacteria 2132
465 nmdc:mga0k408_5049_c1 3300050493 Bacteria 6988
466 nmdc:mga0k408_73421_c1 3300050493 Bacteria 1998
467 nmdc:mga06z11_102459_c1 3300050494 Bacteria 1573
468 nmdc:mga06z11_10611_c1 3300050494 Bacteria 3934
469 nmdc:mga04h51_36793_c1 3300050495 Bacteria 1577
470 nmdc:mga07m45_105346_c1 3300050496 Bacteria 1622
471 nmdc:mga07m45_111515_c1 3300050496 Bacteria 1576
472 nmdc:mga07m45_189268_c1 3300050496 Bacteria 1197
473 nmdc:mga07m45_29462_c1 3300050496 Bacteria 3036
474 nmdc:mga07m45_75185_c1 3300050496 Bacteria 1925
475 nmdc:mga0n895_220181_c1 3300050512 Bacteria 1927
476 nmdc:mga0rr50_340956_c1 3300050513 Bacteria 1259
477 nmdc:mga0sz30_1122_c1 3300050516 Bacteria 9615
478 nmdc:mga0sz30_68994_c2 3300050516 Bacteria 1090
479 Ga0495601_0115025 3300053077 Bacteria 1744
480 Ga0495601_0140802 3300053077 Bacteria 1573
481 Ga0495619_0006157 3300053085 Bacteria 7601
482 Ga0495619_0169023 3300053085 Bacteria 1512
483 Ga0495619_0264354 3300053085 Bacteria 1192
484 Ga0500643_000019 3300053087 Bacteria 294301
485 Ga0500647_0166196 3300053091 Bacteria 1021
486 Ga0500651_0044361 3300053093 Bacteria 2800
487 Ga0500566_0001353 3300053094 Bacteria 14341
488 Ga0500566_0007323 3300053094 Bacteria 6536
489 Ga0500640_002668 3300053095 Bacteria 5968
490 Ga0500554_030255 3300053102 Bacteria 1590
491 Ga0500556_0027156 3300053104 Bacteria 1908
492 Ga0500557_000149 3300053105 Bacteria 16191
493 Ga0500562_005797 3300053108 Bacteria 3109
494 Ga0500569_021894 3300053109 Bacteria 1695
495 Ga0500580_050558 3300053113 Bacteria 1749
496 Ga0500591_089605 3300053115 Bacteria 1346
497 Ga0500595_000651 3300053119 Bacteria 20888
498 Ga0500595_030868 3300053119 Bacteria 1801
499 Ga0500597_142710 3300053120 Bacteria 1031
500 Ga0500607_012439 3300053121 Bacteria 4992
501 Ga0500608_005278 3300053122 Bacteria 5114
502 Ga0500608_057597 3300053122 Bacteria 1861
503 Ga0500614_006096 3300053123 Bacteria 2536
504 Ga0500618_027048 3300053125 Bacteria 1366
505 Ga0500621_054857 3300053126 Bacteria 1612
506 Ga0500642_0000063 3300053130 Bacteria 58680
507 Ga0500642_0004724 3300053130 Bacteria 4307
508 Ga0500652_062106 3300053131 Bacteria 1540
509 Ga0500655_009335 3300053133 Bacteria 1768
510 Ga0500559_0043444 3300053136 Bacteria 1963
511 Ga0500559_0053205 3300053136 Bacteria 1791
512 Ga0500588_0021225 3300053146 Bacteria 1751
513 Ga0500590_110155 3300053148 Bacteria 1307
514 Ga0500604_0027833 3300053151 Bacteria 1638
515 Ga0500616_0000045 3300053153 Bacteria 339292
516 Ga0500616_0062461 3300053153 Bacteria 1924
517 Ga0500622_0008022 3300053156 Bacteria 5942
518 Ga0500630_004105 3300053159 Bacteria 7089
519 Ga0500634_0089276 3300053161 Bacteria 1569
520 Ga0500638_008408 3300053162 Bacteria 4398
521 Ga0500639_000007 3300053163 Bacteria 152350
522 Ga0500636_0000194 3300053177 Bacteria 32748
523 Ga0500637_0000502 3300053178 Bacteria 15181
524 Ga0500649_129715 3300053722 Bacteria 945
525 Ga0500625_003068 3300053729 Bacteria 6482
526 Ga0500645_024565 3300053730 Bacteria 1841
527 Ga0500609_000571 3300053731 Bacteria 5571
528 Ga0500596_000834 3300053735 Bacteria 6103
529 Ga0500661_000333 3300055283 Bacteria 8566
530 Ga0501082_0258657 3300060353 Bacteria 1514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025949 Ga0207667_10728591 Ga0207667_107285911 240
2 3300053153 Ga0500616_0000045 Ga0500616_0000045_245589_246539 240
3 iso_pu_bacteria 8016603502 8016612277 248
4 3300009177 Ga0105248_10098240 Ga0105248_100982403 249
5 3300048924 Ga0496121_0035122 Ga0496121_0035122_692_1537 249
6 3300050491 nmdc:mga00v17_114536_c1 nmdc:mga00v17_114536_c1_176_1021 249
7 3300050492 nmdc:mga0yw44_21091_c1 nmdc:mga0yw44_21091_c1_716_1561 249
8 3300050496 nmdc:mga07m45_111515_c1 nmdc:mga07m45_111515_c1_416_1261 249
9 3300009545 Ga0105237_10449661 Ga0105237_104496611 252
10 3300007265 Ga0099794_10055211 Ga0099794_100552113 253
11 3300035724 Ga0373933_0008698 Ga0373933_0008698_211_1158 256
12 3300036401 Ga0373937_0368708 Ga0373937_0368708_211_1158 256
13 3300037418 Ga0395900_0001980 Ga0395900_0001980_17610_18467 256
14 3300037466 Ga0395898_0018122 Ga0395898_0018122_1966_2823 256
15 3300037471 Ga0395905_0311355 Ga0395905_0311355_204_1061 256
16 3300038443 Ga0395901_0026781 Ga0395901_0026781_4259_5116 256
17 3300046454 Ga0495592_0195789 Ga0495592_0195789_204_1151 256
18 3300046459 Ga0495629_0014255 Ga0495629_0014255_4596_5543 256
19 3300046462 Ga0495651_0152145 Ga0495651_0152145_229_1176 256
20 3300046463 Ga0495653_0081497 Ga0495653_0081497_1398_2345 256
21 3300046511 Ga0495608_0012913 Ga0495608_0012913_4636_5583 256
22 3300046516 Ga0495628_0270695 Ga0495628_0270695_193_1140 256
23 3300046529 Ga0495652_0178992 Ga0495652_0178992_491_1438 256
24 3300046536 Ga0495587_0152159 Ga0495587_0152159_150_1097 256
25 3300046559 Ga0495667_0064983 Ga0495667_0064983_232_1179 256
26 3300046675 Ga0495657_0009077 Ga0495657_0009077_193_1140 256
27 3300046678 Ga0495599_0116566 Ga0495599_0116566_491_1438 256
28 3300046679 Ga0495623_0111389 Ga0495623_0111389_491_1438 256
29 3300046809 Ga0495600_0032498 Ga0495600_0032498_2208_3155 256
30 3300047322 Ga0495680_0077188 Ga0495680_0077188_211_1158 256
31 3300047444 Ga0495675_0053976 Ga0495675_0053976_232_1179 256
32 3300047471 Ga0495684_0000357 Ga0495684_0000357_35792_36739 256
33 3300048088 Ga0495602_0210882 Ga0495602_0210882_296_1243 256
34 3300053085 Ga0495619_0006157 Ga0495619_0006157_6393_7340 256
35 3300009545 Ga0105237_10051651 Ga0105237_100516514 261
36 3300013306 Ga0163162_10138456 Ga0163162_101384561 261
37 3300014745 Ga0157377_10133828 Ga0157377_101338281 261
38 3300014969 Ga0157376_10043971 Ga0157376_100439712 261
39 3300048907 Ga0496104_0097493 Ga0496104_0097493_663_1529 261
40 3300048911 Ga0496108_0040294 Ga0496108_0040294_2459_3325 261
41 3300048913 Ga0496110_0041338 Ga0496110_0041338_1301_2167 261
42 3300048914 Ga0496111_0150775 Ga0496111_0150775_80_946 261
43 3300048915 Ga0496112_0098946 Ga0496112_0098946_1271_2137 261
44 3300048917 Ga0496114_0242677 Ga0496114_0242677_134_1000 261
45 3300005334 Ga0068869_100067311 Ga0068869_1000673113 262
46 3300005338 Ga0068868_100152190 Ga0068868_1001521902 262
47 3300005364 Ga0070673_100117541 Ga0070673_1001175412 262
48 3300005618 Ga0068864_100231811 Ga0068864_1002318112 262
49 3300006358 Ga0068871_100162275 Ga0068871_1001622752 262
50 3300009098 Ga0105245_10001585 Ga0105245_1000158521 262
51 3300011119 Ga0105246_10141857 Ga0105246_101418572 262
52 3300013297 Ga0157378_10158618 Ga0157378_101586182 262
53 3300025960 Ga0207651_10096664 Ga0207651_100966642 262
54 3300026095 Ga0207676_10236809 Ga0207676_102368091 262
55 iso_pu_bacteria 2508501009 2508544073 262
56 iso_pu_bacteria 2508501042 2508697989 262
57 iso_pu_bacteria 2511231028 2511398633 262
58 iso_pu_bacteria 2513237092 2513628069 262
59 iso_pu_bacteria 2513237094 2513643599 262
60 iso_pu_bacteria 2513237095 2513648961 262
61 iso_pu_bacteria 2513237102 2513705940 262
62 iso_pu_bacteria 2513237139 2513878075 262
63 iso_pu_bacteria 2513237161 2514012628 262
64 iso_pu_bacteria 2515154112 2515629423 262
65 iso_pu_bacteria 2517093001 2517107572 262
66 iso_pu_bacteria 2524023205 2524439104 262
67 iso_pu_bacteria 2528768022 2528849645 262
68 iso_pu_bacteria 2617270735 2617353030 262
69 iso_pu_bacteria 2617270741 2617378995 262
70 iso_pu_bacteria 2744054633 2745078783 262
71 iso_pu_bacteria 2791355196 2793059949 262
72 iso_pu_bacteria 2802429603 2805920035 262
73 iso_pu_bacteria 2816332527 2818241635 262
74 iso_pu_bacteria 2824600985 2824606205 262
75 iso_pu_bacteria 2824609381 2824609813 262
76 iso_pu_bacteria 2824617872 2824622756 262
77 iso_pu_bacteria 2824626560 2824632411 262
78 iso_pu_bacteria 2824635225 2824640430 262
79 iso_pu_bacteria 2824644064 2824647419 262
80 iso_pu_bacteria 2824653114 2824657696 262
81 iso_pu_bacteria 2824661429 2824668745 262
82 iso_pu_bacteria 2824671348 2824674297 262
83 iso_pu_bacteria 2824679649 2824682583 262
84 iso_pu_bacteria 2824687955 2824690919 262
85 iso_pu_bacteria 2824696289 2824698505 262
86 iso_pu_bacteria 2824704595 2824708343 262
87 iso_pu_bacteria 2824714736 2824721455 262
88 iso_pu_bacteria 2824723954 2824728690 262
89 iso_pu_bacteria 2824732956 2824736336 262
90 iso_pu_bacteria 2824746037 2824750005 262
91 iso_pu_bacteria 2824753945 2824758948 262
92 iso_pu_bacteria 2824763712 2824766124 262
93 iso_pu_bacteria 2824773399 2824778232 262
94 iso_pu_bacteria 2838122688 2838127486 262
95 iso_pu_bacteria 2841941048 2841941561 262
96 iso_pu_bacteria 2841949485 2841952423 262
97 iso_pu_bacteria 2841957949 2841959442 262
98 iso_pu_bacteria 2841966195 2841967705 262
99 iso_pu_bacteria 2841974524 2841982129 262
100 iso_pu_bacteria 2841983080 2841986447 262
101 iso_pu_bacteria 2842038055 2842038211 262
102 iso_pu_bacteria 2842045827 2842048843 262
103 iso_pu_bacteria 2844315083 2844317693 262
104 iso_pu_bacteria 2847930680 2847934482 262
105 iso_pu_bacteria 2847939898 2847945084 262
106 iso_pu_bacteria 2849076700 2849080730 262
107 iso_pu_bacteria 2857509624 2857509910 262
108 iso_pu_bacteria 2874590934 2874593273 262
109 iso_pu_bacteria 2874612657 2874618183 262
110 iso_pu_bacteria 2874620515 2874623169 262
111 iso_pu_bacteria 2874628541 2874636086 262
112 iso_pu_bacteria 2874645413 2874652952 262
113 iso_pu_bacteria 2876771140 2876773313 262
114 iso_pu_bacteria 2876818435 2876821266 262
115 iso_pu_bacteria 2879074833 2879077229 262
116 iso_pu_bacteria 2879083081 2879089675 262
117 iso_pu_bacteria 2879099564 2879107687 262
118 iso_pu_bacteria 2879127579 2879130214 262
119 iso_pu_bacteria 2879142872 2879146729 262
120 iso_pu_bacteria 2881364244 2881365717 262
121 iso_pu_bacteria 2881665667 2881670928 262
122 iso_pu_bacteria 2885366525 2885368891 262
123 iso_pu_bacteria 2885409591 2885410173 262
124 iso_pu_bacteria 2888378607 2888382414 262
125 iso_pu_bacteria 2888388044 2888388278 262
126 iso_pu_bacteria 2888419890 2888423001 262
127 iso_pu_bacteria 2903727486 2903735373 262
128 iso_pu_bacteria 2904666416 2904669989 262
129 iso_pu_bacteria 2904711408 2904718524 262
130 iso_pu_bacteria 2906602504 2906608708 262
131 iso_pu_bacteria 2906626472 2906630145 262
132 iso_pu_bacteria 2906643746 2906646644 262
133 iso_pu_bacteria 2908775508 2908778666 262
134 iso_pu_bacteria 2922368715 2922375548 262
135 iso_pu_bacteria 2922393267 2922394941 262
136 iso_pu_bacteria 2929615660 2929616284 262
137 iso_pu_bacteria 2929624759 2929625028 262
138 iso_pu_bacteria 2932784394 2932787052 262
139 iso_pu_bacteria 2932794094 2932797279 262
140 iso_pu_bacteria 2932801729 2932804836 262
141 iso_pu_bacteria 2932809354 2932811247 262
142 iso_pu_bacteria 2932818245 2932819880 262
143 iso_pu_bacteria 2932828146 2932832359 262
144 iso_pu_bacteria 2933577622 2933578432 262
145 iso_pu_bacteria 2935608549 2935611024 262
146 iso_pu_bacteria 2935616580 2935619070 262
147 iso_pu_bacteria 2935638405 2935643112 262
148 iso_pu_bacteria 2935648319 2935648455 262
149 iso_pu_bacteria 2935656913 2935657557 262
150 iso_pu_bacteria 2935665750 2935669739 262
151 iso_pu_bacteria 2935675223 2935677121 262
152 iso_pu_bacteria 2935684952 2935693156 262
153 iso_pu_bacteria 2935694250 2935695350 262
154 iso_pu_bacteria 2935703347 2935709541 262
155 iso_pu_bacteria 2935713505 2935719764 262
156 iso_pu_bacteria 2935722832 2935729469 262
157 iso_pu_bacteria 2935732158 2935739647 262
158 iso_pu_bacteria 2935741537 2935748685 262
159 iso_pu_bacteria 2935750917 2935756728 262
160 iso_pu_bacteria 2935760218 2935761287 262
161 iso_pu_bacteria 2935769743 2935771439 262
162 iso_pu_bacteria 2935777560 2935779128 262
163 iso_pu_bacteria 2935785616 2935788332 262
164 iso_pu_bacteria 2935793552 2935800869 262
165 iso_pu_bacteria 2935801545 2935807260 262
166 iso_pu_bacteria 2935810662 2935812399 262
167 iso_pu_bacteria 2935819856 2935820509 262
168 iso_pu_bacteria 2935827899 2935832743 262
169 iso_pu_bacteria 2935837841 2935839177 262
170 iso_pu_bacteria 2935847175 2935849482 262
171 iso_pu_bacteria 2935855204 2935857435 262
172 iso_pu_bacteria 2935864058 2935864965 262
173 iso_pu_bacteria 2935873716 2935876743 262
174 iso_pu_bacteria 2935883170 2935884928 262
175 iso_pu_bacteria 2935908558 2935911744 262
176 iso_pu_bacteria 2935916978 2935919399 262
177 iso_pu_bacteria 2935926038 2935928773 262
178 iso_pu_bacteria 2935934488 2935938418 262
179 iso_pu_bacteria 2935942939 2935945690 262
180 iso_pu_bacteria 2935951376 2935954703 262
181 iso_pu_bacteria 2935967501 2935970590 262
182 iso_pu_bacteria 2935975950 2935979174 262
183 iso_pu_bacteria 2935984226 2935987814 262
184 iso_pu_bacteria 2935992306 2935999644 262
185 iso_pu_bacteria 2936002035 2936008334 262
186 iso_pu_bacteria 2936011229 2936011365 262
187 iso_pu_bacteria 2936019824 2936019960 262
188 iso_pu_bacteria 2936028420 2936028556 262
189 iso_pu_bacteria 2936037263 2936038992 262
190 iso_pu_bacteria 2936046547 2936046683 262
191 iso_pu_bacteria 2936055302 2936063066 262
192 iso_pu_bacteria 2940556831 2940562642 262
193 iso_pu_bacteria 2941538514 2941539867 262
194 iso_pu_bacteria 3005483717 3005487894 262
195 iso_pu_bacteria 3005506211 3005508786 262
196 iso_pu_bacteria 3005587118 3005589400 262
197 iso_pu_bacteria 3005594810 3005597426 262
198 iso_pu_bacteria 3005710791 3005713458 262
199 iso_pu_bacteria 3005718088 3005720868 262
200 iso_pu_bacteria 8016511872 8016515156 262
201 iso_pu_bacteria 8016522445 8016522946 262
202 iso_pu_bacteria 8016530956 8016536407 262
203 iso_pu_bacteria 8016539877 8016540687 262
204 iso_pu_bacteria 8016548790 8016552560 262
205 iso_pu_bacteria 8016557553 8016560936 262
206 iso_pu_bacteria 8016566248 8016574770 262
207 iso_pu_bacteria 8016575299 8016578844 262
208 iso_pu_bacteria 8016583857 8016590792 262
209 iso_pu_bacteria 8016595262 8016598804 262
210 iso_pu_bacteria 8016613128 8016621530 262
211 iso_pu_bacteria 8016630954 8016632630 262
212 iso_pu_bacteria 8017057580 8017061298 262
213 iso_pu_bacteria 8019530166 8019536128 262
214 iso_pu_bacteria 8019538911 8019543343 262
215 iso_pu_bacteria 8019547302 8019555513 262
216 iso_pu_bacteria 8019576017 8019580767 262
217 iso_pu_bacteria 8019586578 8019588500 262
218 iso_pu_bacteria 8019597564 8019602837 262
219 iso_pu_bacteria 8019608314 8019615718 262
220 iso_pu_bacteria 8019619141 8019626466 262
221 iso_pu_bacteria 8019659431 8019663790 262
222 iso_pu_bacteria 8019687851 8019688391 262
223 iso_pu_bacteria 8055742211 8055747930 262
224 iso_pu_bacteria 8056967851 8056969495 262
225 3300011119 Ga0105246_10096611 Ga0105246_100966111 264
226 3300003215 JGI25153J46596_10001822 JGI25153J46596_100018226 266
227 3300003215 JGI25153J46596_10003459 JGI25153J46596_100034597 266
228 3300003215 JGI25153J46596_10004454 JGI25153J46596_100044544 266
229 3300003215 JGI25153J46596_10030199 JGI25153J46596_100301992 266
230 3300003354 JGI25160J50197_1000729 JGI25160J50197_10007299 266
231 3300003354 JGI25160J50197_1002598 JGI25160J50197_10025985 266
232 3300003762 Ga0055542_1005244 Ga0055542_10052443 266
233 3300003771 Ga0055526_1051644 Ga0055526_10516441 266
234 3300003794 Ga0055531_10004381 Ga0055531_100043814 266
235 3300004625 Ga0055543_1001967 Ga0055543_10019674 266
236 3300005262 Ga0065165_1000278 Ga0065165_100027889 266
237 3300005262 Ga0065165_1005698 Ga0065165_10056982 266
238 3300005262 Ga0065165_1010190 Ga0065165_10101903 266
239 3300005329 Ga0070683_100015396 Ga0070683_1000153967 266
240 3300005331 Ga0070670_100061597 Ga0070670_1000615973 266
241 3300005336 Ga0070680_100007902 Ga0070680_1000079027 266
242 3300005344 Ga0070661_100282180 Ga0070661_1002821802 266
243 3300005353 Ga0070669_100265305 Ga0070669_1002653052 266
244 3300005354 Ga0070675_100220742 Ga0070675_1002207422 266
245 3300005355 Ga0070671_100012665 Ga0070671_1000126655 266
246 3300005364 Ga0070673_100147632 Ga0070673_1001476322 266
247 3300005434 Ga0070709_10043295 Ga0070709_100432952 266
248 3300005455 Ga0070663_100301617 Ga0070663_1003016171 266
249 3300005458 Ga0070681_10018303 Ga0070681_100183032 266
250 3300005535 Ga0070684_100014665 Ga0070684_1000146652 266
251 3300005539 Ga0068853_100404795 Ga0068853_1004047951 266
252 3300005577 Ga0068857_100142520 Ga0068857_1001425202 266
253 3300005577 Ga0068857_100358954 Ga0068857_1003589542 266
254 3300005614 Ga0068856_100219740 Ga0068856_1002197402 266
255 3300005616 Ga0068852_100010094 Ga0068852_1000100944 266
256 3300005841 Ga0068863_100628002 Ga0068863_1006280022 266
257 3300005844 Ga0068862_100099684 Ga0068862_1000996842 266
258 3300006042 Ga0075368_10006951 Ga0075368_100069513 266
259 3300006048 Ga0075363_100043257 Ga0075363_1000432572 266
260 3300006051 Ga0075364_10008417 Ga0075364_100084178 266
261 3300006186 Ga0075369_10030768 Ga0075369_100307682 266
262 3300006186 Ga0075369_10087434 Ga0075369_100874342 266
263 3300006195 Ga0075366_10004318 Ga0075366_100043184 266
264 3300006237 Ga0097621_100307751 Ga0097621_1003077513 266
265 3300006353 Ga0075370_10009166 Ga0075370_100091664 266
266 3300006941 Ga0099825_1032376 Ga0099825_10323763 266
267 3300006942 Ga0099824_1016133 Ga0099824_10161334 266
268 3300006944 Ga0099823_1044958 Ga0099823_10449582 266
269 3300009011 Ga0105251_10164062 Ga0105251_101640622 266
270 3300009093 Ga0105240_10077493 Ga0105240_100774935 266
271 3300009174 Ga0105241_10023166 Ga0105241_100231664 266
272 3300009174 Ga0105241_10033535 Ga0105241_100335352 266
273 3300009174 Ga0105241_10057648 Ga0105241_100576482 266
274 3300009177 Ga0105248_10012339 Ga0105248_100123395 266
275 3300009545 Ga0105237_10015754 Ga0105237_100157545 266
276 3300009553 Ga0105249_10288445 Ga0105249_102884452 266
277 3300010375 Ga0105239_10052215 Ga0105239_100522152 266
278 3300010375 Ga0105239_10181027 Ga0105239_101810272 266
279 3300010375 Ga0105239_10250456 Ga0105239_102504563 266
280 3300013105 Ga0157369_10078089 Ga0157369_100780898 266
281 3300013296 Ga0157374_10033415 Ga0157374_100334152 266
282 3300013307 Ga0157372_10209269 Ga0157372_102092691 266
283 3300014325 Ga0163163_10017116 Ga0163163_100171162 266
284 3300025230 Ga0209563_101494 Ga0209563_1014942 266
285 3300025245 Ga0207425_1017592 Ga0207425_10175922 266
286 3300025253 Ga0209677_105896 Ga0209677_1058963 266
287 3300025254 Ga0209148_1000344 Ga0209148_100034431 266
288 3300025261 Ga0209233_1005823 Ga0209233_10058233 266
289 3300025273 Ga0209673_1024307 Ga0209673_10243072 266
290 3300025295 Ga0209564_1002208 Ga0209564_10022086 266
291 3300025297 Ga0209758_1000407 Ga0209758_100040729 266
292 3300025297 Ga0209758_1000900 Ga0209758_100090024 266
293 3300025297 Ga0209758_1000952 Ga0209758_10009524 266
294 3300025297 Ga0209758_1011752 Ga0209758_10117526 266
295 3300025297 Ga0209758_1030934 Ga0209758_10309341 266
296 3300025299 Ga0209256_1019540 Ga0209256_10195403 266
297 3300025302 Ga0207426_1000466 Ga0207426_100046639 266
298 3300025302 Ga0207426_1000865 Ga0207426_100086511 266
299 3300025302 Ga0207426_1003194 Ga0207426_10031947 266
300 3300025302 Ga0207426_1008651 Ga0207426_10086513 266
301 3300025302 Ga0207426_1024999 Ga0207426_10249992 266
302 3300025304 Ga0209257_1001445 Ga0209257_100144520 266
303 3300025315 Ga0207697_10032884 Ga0207697_100328842 266
304 3300025898 Ga0207692_10189975 Ga0207692_101899751 266
305 3300025904 Ga0207647_10008614 Ga0207647_100086145 266
306 3300025908 Ga0207643_10216684 Ga0207643_102166841 266
307 3300025911 Ga0207654_10084567 Ga0207654_100845672 266
308 3300025911 Ga0207654_10170555 Ga0207654_101705552 266
309 3300025912 Ga0207707_10001119 Ga0207707_1000111920 266
310 3300025912 Ga0207707_10007981 Ga0207707_1000798110 266
311 3300025913 Ga0207695_10000029 Ga0207695_10000029140 266
312 3300025914 Ga0207671_10005971 Ga0207671_100059719 266
313 3300025914 Ga0207671_10048682 Ga0207671_100486822 266
314 3300025914 Ga0207671_10143580 Ga0207671_101435802 266
315 3300025917 Ga0207660_10012652 Ga0207660_100126528 266
316 3300025921 Ga0207652_10010456 Ga0207652_100104562 266
317 3300025925 Ga0207650_10091560 Ga0207650_100915602 266
318 3300025927 Ga0207687_10055275 Ga0207687_100552752 266
319 3300025931 Ga0207644_10086201 Ga0207644_100862012 266
320 3300025933 Ga0207706_10326521 Ga0207706_103265212 266
321 3300025935 Ga0207709_10026733 Ga0207709_100267333 266
322 3300025941 Ga0207711_10212668 Ga0207711_102126682 266
323 3300025944 Ga0207661_10008392 Ga0207661_100083929 266
324 3300025949 Ga0207667_10134031 Ga0207667_101340312 266
325 3300025986 Ga0207658_10576004 Ga0207658_105760041 266
326 3300026035 Ga0207703_10162839 Ga0207703_101628392 266
327 3300026067 Ga0207678_10523324 Ga0207678_105233242 266
328 3300026078 Ga0207702_10734210 Ga0207702_107342102 266
329 3300026116 Ga0207674_10068547 Ga0207674_100685473 266
330 3300026142 Ga0207698_10015126 Ga0207698_100151261 266
331 3300027296 Ga0209389_1000011 Ga0209389_100001186 266
332 3300027296 Ga0209389_1000025 Ga0209389_1000025145 266
333 3300027357 Ga0209589_1000066 Ga0209589_100006694 266
334 3300027361 Ga0209489_100017 Ga0209489_100017148 266
335 3300027361 Ga0209489_100030 Ga0209489_10003019 266
336 3300027363 Ga0209700_100027 Ga0209700_10002786 266
337 3300028381 Ga0268264_10134165 Ga0268264_101341651 266
338 3300030760 Ga0265762_1034850 Ga0265762_10348501 266
339 3300033180 Ga0307510_10042405 Ga0307510_100424052 266
340 3300035170 Ga0373943_0031479 Ga0373943_0031479_835_1635 266
341 3300035171 Ga0373946_0027185 Ga0373946_0027185_235_1035 266
342 3300035172 Ga0373955_0019488 Ga0373955_0019488_2448_3248 266
343 3300035725 Ga0373947_0027207 Ga0373947_0027207_853_1653 266
344 3300037068 Ga0373925_0052470 Ga0373925_0052470_1520_2320 266
345 3300037471 Ga0395905_0015966 Ga0395905_0015966_1075_1881 266
346 3300037471 Ga0395905_0083925 Ga0395905_0083925_1564_2370 266
347 3300038443 Ga0395901_0093836 Ga0395901_0093836_1251_2057 266
348 3300038443 Ga0395901_0148346 Ga0395901_0148346_1513_2319 266
349 3300044658 Ga0466972_0000261 Ga0466972_0000261_28684_29490 266
350 3300044658 Ga0466972_0008229 Ga0466972_0008229_3075_3881 266
351 3300044684 Ga0466966_0000211 Ga0466966_0000211_35248_36054 266
352 3300044693 Ga0466961_0005032 Ga0466961_0005032_967_1773 266
353 3300044693 Ga0466961_0165283 Ga0466961_0165283_290_1096 266
354 3300044719 Ga0466971_0037598 Ga0466971_0037598_84_884 266
355 3300044735 Ga0466968_0001473 Ga0466968_0001473_5988_6794 266
356 3300044765 Ga0466970_0296155 Ga0466970_0296155_84_890 266
357 3300044842 Ga0466957_0017412 Ga0466957_0017412_2494_3294 266
358 3300044901 Ga0466960_0002388 Ga0466960_0002388_3756_4562 266
359 3300045049 Ga0466959_0011922 Ga0466959_0011922_3754_4560 266
360 3300045049 Ga0466959_0012080 Ga0466959_0012080_2813_3613 266
361 3300046459 Ga0495629_0085568 Ga0495629_0085568_737_1537 266
362 3300046459 Ga0495629_0119612 Ga0495629_0119612_652_1458 266
363 3300046460 Ga0495638_0009098 Ga0495638_0009098_2169_2975 266
364 3300046463 Ga0495653_0102683 Ga0495653_0102683_1182_1988 266
365 3300046475 Ga0495639_0053073 Ga0495639_0053073_200_1000 266
366 3300046476 Ga0495662_0106921 Ga0495662_0106921_183_983 266
367 3300046477 Ga0495664_0122796 Ga0495664_0122796_717_1517 266
368 3300046506 Ga0495583_0025158 Ga0495583_0025158_252_1058 266
369 3300046507 Ga0495606_0034700 Ga0495606_0034700_1346_2152 266
370 3300046512 Ga0495610_0039636 Ga0495610_0039636_591_1397 266
371 3300046516 Ga0495628_0347869 Ga0495628_0347869_208_1014 266
372 3300046524 Ga0495648_0013331 Ga0495648_0013331_1193_1999 266
373 3300046524 Ga0495648_0161593 Ga0495648_0161593_226_1032 266
374 3300046529 Ga0495652_0167152 Ga0495652_0167152_22_828 266
375 3300046529 Ga0495652_0264297 Ga0495652_0264297_375_1181 266
376 3300046533 Ga0495640_0038248 Ga0495640_0038248_2005_2805 266
377 3300046533 Ga0495640_0126489 Ga0495640_0126489_223_1029 266
378 3300046542 Ga0495597_0029333 Ga0495597_0029333_1594_2400 266
379 3300046557 Ga0495622_0034064 Ga0495622_0034064_481_1287 266
380 3300046616 Ga0495668_0198568 Ga0495668_0198568_141_947 266
381 3300046642 Ga0495634_0057409 Ga0495634_0057409_1491_2291 266
382 3300046642 Ga0495634_0084852 Ga0495634_0084852_706_1512 266
383 3300046660 Ga0495625_0011551 Ga0495625_0011551_4189_4995 266
384 3300046660 Ga0495625_0205447 Ga0495625_0205447_272_1078 266
385 3300046663 Ga0495635_0002863 Ga0495635_0002863_9655_10461 266
386 3300046663 Ga0495635_0298433 Ga0495635_0298433_88_888 266
387 3300046675 Ga0495657_0014067 Ga0495657_0014067_336_1142 266
388 3300046689 Ga0495613_0070731 Ga0495613_0070731_462_1268 266
389 3300046690 Ga0495624_0110149 Ga0495624_0110149_332_1132 266
390 3300046694 Ga0495649_0070668 Ga0495649_0070668_444_1250 266
391 3300046694 Ga0495649_0116789 Ga0495649_0116789_177_983 266
392 3300046809 Ga0495600_0111490 Ga0495600_0111490_440_1246 266
393 3300047315 Ga0495581_0139496 Ga0495581_0139496_381_1187 266
394 3300047315 Ga0495581_0160633 Ga0495581_0160633_272_1072 266
395 3300047317 Ga0495604_0045510 Ga0495604_0045510_51_857 266
396 3300047317 Ga0495604_0134140 Ga0495604_0134140_278_1078 266
397 3300047319 Ga0495674_0055953 Ga0495674_0055953_1916_2716 266
398 3300047321 Ga0495676_0158294 Ga0495676_0158294_658_1458 266
399 3300047321 Ga0495676_0206390 Ga0495676_0206390_336_1142 266
400 3300047443 Ga0495687_018792 Ga0495687_018792_783_1589 266
401 3300047471 Ga0495684_0016950 Ga0495684_0016950_2258_3058 266
402 3300047472 Ga0495686_0044369 Ga0495686_0044369_1020_1826 266
403 3300048905 Ga0496102_0010378 Ga0496102_0010378_450_1256 266
404 3300048906 Ga0496103_0020315 Ga0496103_0020315_687_1493 266
405 3300048907 Ga0496104_0019267 Ga0496104_0019267_5200_6006 266
406 3300048908 Ga0496105_0063051 Ga0496105_0063051_1710_2516 266
407 3300048911 Ga0496108_0328005 Ga0496108_0328005_400_1206 266
408 3300048912 Ga0496109_0257512 Ga0496109_0257512_732_1538 266
409 3300048913 Ga0496110_0205828 Ga0496110_0205828_447_1253 266
410 3300048915 Ga0496112_0296889 Ga0496112_0296889_100_906 266
411 3300048916 Ga0496113_0046252 Ga0496113_0046252_762_1568 266
412 3300048918 Ga0496115_0074634 Ga0496115_0074634_926_1732 266
413 3300048920 Ga0496117_0080961 Ga0496117_0080961_402_1208 266
414 3300048922 Ga0496119_0081115 Ga0496119_0081115_843_1649 266
415 3300048922 Ga0496119_0174238 Ga0496119_0174238_80_886 266
416 3300048923 Ga0496120_0010597 Ga0496120_0010597_2935_3741 266
417 3300048924 Ga0496121_0250475 Ga0496121_0250475_139_945 266
418 3300048926 Ga0496123_0088746 Ga0496123_0088746_101_907 266
419 3300048927 Ga0496124_0178147 Ga0496124_0178147_93_899 266
420 3300048927 Ga0496124_0301428 Ga0496124_0301428_244_1050 266
421 3300048928 Ga0496125_0096219 Ga0496125_0096219_940_1746 266
422 3300048929 Ga0496126_0172539 Ga0496126_0172539_308_1114 266
423 3300049460 Ga0495682_0031543 Ga0495682_0031543_494_1300 266
424 3300050490 nmdc:mga03n38_6610_c1 nmdc:mga03n38_6610_c1_1791_2597 266
425 3300050491 nmdc:mga00v17_173408_c1 nmdc:mga00v17_173408_c1_427_1233 266
426 3300050491 nmdc:mga00v17_35992_c1 nmdc:mga00v17_35992_c1_1908_2714 266
427 3300050492 nmdc:mga0yw44_73169_c1 nmdc:mga0yw44_73169_c1_592_1398 266
428 3300050493 nmdc:mga0k408_5049_c1 nmdc:mga0k408_5049_c1_3852_4658 266
429 3300050494 nmdc:mga06z11_102459_c1 nmdc:mga06z11_102459_c1_176_982 266
430 3300050495 nmdc:mga04h51_36793_c1 nmdc:mga04h51_36793_c1_489_1295 266
431 3300050496 nmdc:mga07m45_105346_c1 nmdc:mga07m45_105346_c1_201_1007 266
432 3300050496 nmdc:mga07m45_75185_c1 nmdc:mga07m45_75185_c1_528_1334 266
433 3300050516 nmdc:mga0sz30_1122_c1 nmdc:mga0sz30_1122_c1_7816_8622 266
434 3300050516 nmdc:mga0sz30_68994_c2 nmdc:mga0sz30_68994_c2_65_871 266
435 3300053077 Ga0495601_0115025 Ga0495601_0115025_489_1289 266
436 3300053085 Ga0495619_0169023 Ga0495619_0169023_391_1197 266
437 3300053087 Ga0500643_000019 Ga0500643_000019_133409_134215 266
438 3300053091 Ga0500647_0166196 Ga0500647_0166196_20_826 266
439 3300053093 Ga0500651_0044361 Ga0500651_0044361_1848_2654 266
440 3300053094 Ga0500566_0001353 Ga0500566_0001353_12808_13614 266
441 3300053104 Ga0500556_0027156 Ga0500556_0027156_432_1238 266
442 3300053105 Ga0500557_000149 Ga0500557_000149_14590_15396 266
443 3300053108 Ga0500562_005797 Ga0500562_005797_1202_2008 266
444 3300053109 Ga0500569_021894 Ga0500569_021894_832_1638 266
445 3300053119 Ga0500595_030868 Ga0500595_030868_730_1536 266
446 3300053120 Ga0500597_142710 Ga0500597_142710_120_926 266
447 3300053121 Ga0500607_012439 Ga0500607_012439_2809_3615 266
448 3300053122 Ga0500608_057597 Ga0500608_057597_332_1138 266
449 3300053125 Ga0500618_027048 Ga0500618_027048_250_1056 266
450 3300053126 Ga0500621_054857 Ga0500621_054857_410_1216 266
451 3300053130 Ga0500642_0000063 Ga0500642_0000063_47545_48351 266
452 3300053130 Ga0500642_0004724 Ga0500642_0004724_162_968 266
453 3300053131 Ga0500652_062106 Ga0500652_062106_547_1353 266
454 3300053133 Ga0500655_009335 Ga0500655_009335_765_1571 266
455 3300053136 Ga0500559_0043444 Ga0500559_0043444_608_1414 266
456 3300053136 Ga0500559_0053205 Ga0500559_0053205_943_1749 266
457 3300053146 Ga0500588_0021225 Ga0500588_0021225_404_1210 266
458 3300053148 Ga0500590_110155 Ga0500590_110155_245_1051 266
459 3300053153 Ga0500616_0062461 Ga0500616_0062461_830_1636 266
460 3300053156 Ga0500622_0008022 Ga0500622_0008022_785_1591 266
461 3300053161 Ga0500634_0089276 Ga0500634_0089276_250_1056 266
462 3300053162 Ga0500638_008408 Ga0500638_008408_1700_2506 266
463 3300053177 Ga0500636_0000194 Ga0500636_0000194_9869_10675 266
464 3300053722 Ga0500649_129715 Ga0500649_129715_46_852 266
465 3300053729 Ga0500625_003068 Ga0500625_003068_4864_5670 266
466 3300053730 Ga0500645_024565 Ga0500645_024565_110_916 266
467 3300053731 Ga0500609_000571 Ga0500609_000571_789_1595 266
468 iso_pu_bacteria 2791355199 2793078717 266
469 iso_pu_bacteria 2885383462 2885391157 266
470 iso_pu_bacteria 2904690495 2904697020 266
471 iso_pu_bacteria 2904699407 2904700482 266
472 iso_pu_bacteria 2908756301 2908762712 266
473 iso_pu_bacteria 2935959822 2935963304 266
474 iso_pu_bacteria 8006933436 8006938892 266
475 iso_pu_bacteria 8006973647 8006978662 266
476 iso_pu_bacteria 8006984368 8006984799 266
477 iso_pu_bacteria 8056689827 8056695065 266
478 3300005434 Ga0070709_10066265 Ga0070709_100662652 267
479 3300005437 Ga0070710_10128048 Ga0070710_101280483 267
480 3300005439 Ga0070711_100043044 Ga0070711_1000430443 267
481 3300006175 Ga0070712_100040008 Ga0070712_1000400082 267
482 3300009174 Ga0105241_10499596 Ga0105241_104995961 267
483 3300013104 Ga0157370_10095939 Ga0157370_100959391 267
484 3300025898 Ga0207692_10027670 Ga0207692_100276702 267
485 3300025913 Ga0207695_10275109 Ga0207695_102751091 267
486 3300025916 Ga0207663_10303285 Ga0207663_103032851 267
487 3300025928 Ga0207700_10007250 Ga0207700_100072507 267
488 3300026116 Ga0207674_10371185 Ga0207674_103711852 267
489 3300031711 Ga0265314_10071779 Ga0265314_100717793 267
490 3300031712 Ga0265342_10021560 Ga0265342_100215606 267
491 3300048917 Ga0496114_0353741 Ga0496114_0353741_172_990 267
492 3300048918 Ga0496115_0147902 Ga0496115_0147902_354_1172 267
493 3300005434 Ga0070709_10336632 Ga0070709_103366321 268
494 3300005436 Ga0070713_100003997 Ga0070713_1000039975 268
495 3300005437 Ga0070710_10003009 Ga0070710_100030092 268
496 3300005458 Ga0070681_10039237 Ga0070681_100392373 268
497 3300006028 Ga0070717_10007297 Ga0070717_100072979 268
498 3300006038 Ga0075365_10161387 Ga0075365_101613872 268
499 3300006178 Ga0075367_10049439 Ga0075367_100494393 268
500 3300006195 Ga0075366_10063342 Ga0075366_100633421 268
501 3300006353 Ga0075370_10025933 Ga0075370_100259333 268
502 3300009174 Ga0105241_10375328 Ga0105241_103753281 268
503 3300025898 Ga0207692_10140739 Ga0207692_101407391 268
504 3300025906 Ga0207699_10064756 Ga0207699_100647562 268
505 3300025912 Ga0207707_10220119 Ga0207707_102201191 268
506 3300025912 Ga0207707_10234549 Ga0207707_102345492 268
507 3300025917 Ga0207660_10334749 Ga0207660_103347491 268
508 3300025928 Ga0207700_10022832 Ga0207700_100228322 268
509 3300025929 Ga0207664_10204060 Ga0207664_102040602 268
510 3300027512 Ga0209179_1006560 Ga0209179_10065602 268
511 3300035113 Ga0373936_0120468 Ga0373936_0120468_146_952 268
512 3300035120 Ga0373957_0051449 Ga0373957_0051449_480_1286 268
513 3300035410 Ga0373924_0069072 Ga0373924_0069072_166_972 268
514 3300038443 Ga0395901_0071278 Ga0395901_0071278_2527_3339 268
515 3300039447 Ga0436361_1211699 Ga0436361_1211699_1085_1891 268
516 3300044694 Ga0466963_0221714 Ga0466963_0221714_417_1223 268
517 3300046473 Ga0495582_0145047 Ga0495582_0145047_231_1037 268
518 3300046514 Ga0495618_0018261 Ga0495618_0018261_2750_3556 268
519 3300046559 Ga0495667_0296516 Ga0495667_0296516_166_972 268
520 3300048914 Ga0496111_0538468 Ga0496111_0538468_35_841 268
521 3300048924 Ga0496121_0389356 Ga0496121_0389356_91_903 268
522 3300050492 nmdc:mga0yw44_363580_c1 nmdc:mga0yw44_363580_c1_103_927 268
523 3300050493 nmdc:mga0k408_73421_c1 nmdc:mga0k408_73421_c1_411_1223 268
524 3300050496 nmdc:mga07m45_29462_c1 nmdc:mga07m45_29462_c1_1180_1992 268
525 iso_pu_bacteria 2876761206 2876766733 268
526 3300005455 Ga0070663_100033372 Ga0070663_1000333725 269
527 3300005536 Ga0070697_100468120 Ga0070697_1004681202 269
528 3300005539 Ga0068853_100047034 Ga0068853_1000470344 269
529 3300005983 Ga0081540_1003613 Ga0081540_10036137 269
530 3300025910 Ga0207684_10200944 Ga0207684_102009442 269
531 3300025928 Ga0207700_10511229 Ga0207700_105112291 269
532 3300048913 Ga0496110_0021826 Ga0496110_0021826_3562_4395 269
533 3300048915 Ga0496112_0062188 Ga0496112_0062188_685_1494 269
534 3300050513 nmdc:mga0rr50_340956_c1 nmdc:mga0rr50_340956_c1_180_1013 269
535 3300053095 Ga0500640_002668 Ga0500640_002668_4887_5744 269
536 3300053113 Ga0500580_050558 Ga0500580_050558_175_1032 269
537 3300053115 Ga0500591_089605 Ga0500591_089605_91_948 269
538 3300053122 Ga0500608_005278 Ga0500608_005278_1513_2370 269
539 3300053123 Ga0500614_006096 Ga0500614_006096_242_1099 269
540 3300053159 Ga0500630_004105 Ga0500630_004105_217_1074 269
541 3300053163 Ga0500639_000007 Ga0500639_000007_151252_152109 269
542 3300053735 Ga0500596_000834 Ga0500596_000834_5005_5862 269
543 iso_pu_bacteria 2906610324 2906616313 269
544 iso_pu_bacteria 2922361189 2922361365 269
545 iso_pu_bacteria 2922425934 2922431689 269
546 iso_pu_bacteria 8006926726 8006928755 269
547 iso_pu_bacteria 8019555841 8019565088 269
548 3300003911 JGI25405J52794_10035098 JGI25405J52794_100350981 270
549 3300005338 Ga0068868_100004886 Ga0068868_1000048864 270
550 3300005339 Ga0070660_100388847 Ga0070660_1003888471 270
551 3300005347 Ga0070668_100148632 Ga0070668_1001486322 270
552 3300005455 Ga0070663_100067025 Ga0070663_1000670252 270
553 3300005457 Ga0070662_100097867 Ga0070662_1000978671 270
554 3300005563 Ga0068855_100017763 Ga0068855_1000177635 270
555 3300005564 Ga0070664_100063775 Ga0070664_1000637753 270
556 3300005577 Ga0068857_100404836 Ga0068857_1004048362 270
557 3300005615 Ga0070702_100094805 Ga0070702_1000948051 270
558 3300005618 Ga0068864_100141029 Ga0068864_1001410292 270
559 3300005719 Ga0068861_100109478 Ga0068861_1001094784 270
560 3300005844 Ga0068862_100052050 Ga0068862_1000520503 270
561 3300005937 Ga0081455_10042189 Ga0081455_100421895 270
562 3300006028 Ga0070717_10142595 Ga0070717_101425952 270
563 3300006163 Ga0070715_10000729 Ga0070715_100007298 270
564 3300006175 Ga0070712_100027427 Ga0070712_1000274273 270
565 3300006178 Ga0075367_10077069 Ga0075367_100770692 270
566 3300006195 Ga0075366_10067000 Ga0075366_100670002 270
567 3300006237 Ga0097621_100016142 Ga0097621_1000161424 270
568 3300006353 Ga0075370_10041524 Ga0075370_100415242 270
569 3300009098 Ga0105245_10004121 Ga0105245_100041219 270
570 3300009148 Ga0105243_10650653 Ga0105243_106506532 270
571 3300009177 Ga0105248_10004940 Ga0105248_100049409 270
572 3300009545 Ga0105237_10430259 Ga0105237_104302592 270
573 3300011119 Ga0105246_10001515 Ga0105246_100015154 270
574 3300011119 Ga0105246_10172710 Ga0105246_101727102 270
575 3300013296 Ga0157374_10266386 Ga0157374_102663862 270
576 3300013306 Ga0163162_10219951 Ga0163162_102199514 270
577 3300025315 Ga0207697_10060508 Ga0207697_100605081 270
578 3300025898 Ga0207692_10000318 Ga0207692_1000031815 270
579 3300025900 Ga0207710_10130873 Ga0207710_101308731 270
580 3300025905 Ga0207685_10001710 Ga0207685_100017104 270
581 3300025905 Ga0207685_10049864 Ga0207685_100498642 270
582 3300025906 Ga0207699_10021869 Ga0207699_100218692 270
583 3300025911 Ga0207654_10001150 Ga0207654_100011509 270
584 3300025915 Ga0207693_10027725 Ga0207693_100277255 270
585 3300025916 Ga0207663_10002625 Ga0207663_100026256 270
586 3300025919 Ga0207657_10250543 Ga0207657_102505432 270
587 3300025933 Ga0207706_10125734 Ga0207706_101257341 270
588 3300025939 Ga0207665_10000311 Ga0207665_100003119 270
589 3300025941 Ga0207711_10224952 Ga0207711_102249523 270
590 3300025942 Ga0207689_10014007 Ga0207689_100140074 270
591 3300025945 Ga0207679_10034372 Ga0207679_100343723 270
592 3300025972 Ga0207668_10139792 Ga0207668_101397921 270
593 3300025986 Ga0207658_10030261 Ga0207658_100302615 270
594 3300026023 Ga0207677_10013899 Ga0207677_100138994 270
595 3300026067 Ga0207678_10042504 Ga0207678_100425042 270
596 3300026118 Ga0207675_100154789 Ga0207675_1001547892 270
597 3300026142 Ga0207698_10459006 Ga0207698_104590061 270
598 3300031730 Ga0307516_10062981 Ga0307516_100629813 270
599 3300039450 Ga0436363_0232520 Ga0436363_0232520_2107_2976 270
600 3300044684 Ga0466966_0205536 Ga0466966_0205536_29_862 270
601 3300048907 Ga0496104_0543750 Ga0496104_0543750_158_976 270
602 3300048909 Ga0496106_0017841 Ga0496106_0017841_226_1044 270
603 3300048912 Ga0496109_0387527 Ga0496109_0387527_210_1028 270
604 3300048915 Ga0496112_0388751 Ga0496112_0388751_13_831 270
605 3300048924 Ga0496121_0055828 Ga0496121_0055828_573_1385 270
606 3300049459 Ga0495678_092178 Ga0495678_092178_68_883 270
607 3300049587 Ga0501071_0200210 Ga0501071_0200210_608_1426 270
608 3300049592 Ga0501076_0176722 Ga0501076_0176722_590_1408 270
609 3300050496 nmdc:mga07m45_189268_c1 nmdc:mga07m45_189268_c1_90_908 270
610 3300053151 Ga0500604_0027833 Ga0500604_0027833_122_937 270
611 3300060353 Ga0501082_0258657 Ga0501082_0258657_96_914 270
612 3300003659 JGI25404J52841_10009491 JGI25404J52841_100094914 271
613 3300005983 Ga0081540_1001897 Ga0081540_10018973 271
614 3300035724 Ga0373933_0037509 Ga0373933_0037509_1001_1816 271
615 3300036401 Ga0373937_0503138 Ga0373937_0503138_223_1068 271
616 3300046533 Ga0495640_0014622 Ga0495640_0014622_5097_5912 271
617 3300046559 Ga0495667_0010331 Ga0495667_0010331_3523_4338 271
618 3300047471 Ga0495684_0049442 Ga0495684_0049442_799_1614 271
619 3300047673 Ga0495593_0049272 Ga0495593_0049272_709_1524 271
620 3300053094 Ga0500566_0007323 Ga0500566_0007323_3781_4596 271
621 3300053102 Ga0500554_030255 Ga0500554_030255_251_1066 271
622 3300053119 Ga0500595_000651 Ga0500595_000651_5326_6141 271
623 3300053178 Ga0500637_0000502 Ga0500637_0000502_11315_12130 271
624 3300055283 Ga0500661_000333 Ga0500661_000333_1120_1935 271
625 iso_pu_bacteria 8019678201 8019679798 271
626 3300003203 JGI25406J46586_10001591 JGI25406J46586_100015913 272
627 3300003203 JGI25406J46586_10003138 JGI25406J46586_100031386 272
628 3300005336 Ga0070680_100011830 Ga0070680_1000118303 272
629 3300005339 Ga0070660_100099635 Ga0070660_1000996352 272
630 3300005458 Ga0070681_10221653 Ga0070681_102216533 272
631 3300005471 Ga0070698_100013516 Ga0070698_10001351611 272
632 3300005535 Ga0070684_100191857 Ga0070684_1001918572 272
633 3300005539 Ga0068853_100132298 Ga0068853_1001322983 272
634 3300005539 Ga0068853_100262303 Ga0068853_1002623032 272
635 3300005563 Ga0068855_100031717 Ga0068855_1000317173 272
636 3300005577 Ga0068857_100176731 Ga0068857_1001767312 272
637 3300005616 Ga0068852_100524486 Ga0068852_1005244862 272
638 3300005937 Ga0081455_10042301 Ga0081455_100423015 272
639 3300005985 Ga0081539_10000945 Ga0081539_1000094521 272
640 3300006028 Ga0070717_10019413 Ga0070717_100194132 272
641 3300006038 Ga0075365_10008873 Ga0075365_100088733 272
642 3300006051 Ga0075364_10007096 Ga0075364_100070963 272
643 3300006177 Ga0075362_10014038 Ga0075362_100140381 272
644 3300006178 Ga0075367_10008803 Ga0075367_100088033 272
645 3300006871 Ga0075434_100205515 Ga0075434_1002055152 272
646 3300009093 Ga0105240_10031852 Ga0105240_100318526 272
647 3300009093 Ga0105240_10125673 Ga0105240_101256732 272
648 3300009545 Ga0105237_10014161 Ga0105237_100141618 272
649 3300010375 Ga0105239_10192370 Ga0105239_101923701 272
650 3300013104 Ga0157370_10013630 Ga0157370_100136307 272
651 3300013104 Ga0157370_10083372 Ga0157370_100833724 272
652 3300013105 Ga0157369_10026130 Ga0157369_100261302 272
653 3300025910 Ga0207684_10037545 Ga0207684_100375456 272
654 3300025912 Ga0207707_10003222 Ga0207707_1000322213 272
655 3300025913 Ga0207695_10063666 Ga0207695_100636663 272
656 3300025913 Ga0207695_10074630 Ga0207695_100746301 272
657 3300025914 Ga0207671_10164947 Ga0207671_101649472 272
658 3300025917 Ga0207660_10038528 Ga0207660_100385283 272
659 3300025917 Ga0207660_10084511 Ga0207660_100845111 272
660 3300025919 Ga0207657_10064333 Ga0207657_100643332 272
661 3300025921 Ga0207652_10008142 Ga0207652_100081425 272
662 3300025921 Ga0207652_10026854 Ga0207652_100268543 272
663 3300025924 Ga0207694_10221557 Ga0207694_102215571 272
664 3300025932 Ga0207690_10531007 Ga0207690_105310071 272
665 3300025949 Ga0207667_10037454 Ga0207667_100374542 272
666 3300026041 Ga0207639_10456198 Ga0207639_104561981 272
667 3300026116 Ga0207674_10056763 Ga0207674_100567632 272
668 3300027671 Ga0209588_1002751 Ga0209588_10027518 272
669 3300033544 Ga0316215_1000880 Ga0316215_10008804 272
670 3300035089 Ga0373944_0048648 Ga0373944_0048648_309_1130 272
671 3300035113 Ga0373936_0108395 Ga0373936_0108395_168_986 272
672 3300035116 Ga0373945_0064938 Ga0373945_0064938_430_1248 272
673 3300035170 Ga0373943_0005471 Ga0373943_0005471_4807_5625 272
674 3300035172 Ga0373955_0009368 Ga0373955_0009368_2479_3297 272
675 3300035692 Ga0373935_0010393 Ga0373935_0010393_852_1670 272
676 3300035695 Ga0373927_0000515 Ga0373927_0000515_19262_20080 272
677 3300035725 Ga0373947_0011552 Ga0373947_0011552_2293_3111 272
678 3300037068 Ga0373925_0001116 Ga0373925_0001116_8048_8866 272
679 3300046454 Ga0495592_0032474 Ga0495592_0032474_1923_2741 272
680 3300046455 Ga0495603_0000156 Ga0495603_0000156_5292_6110 272
681 3300046459 Ga0495629_0000297 Ga0495629_0000297_39883_40701 272
682 3300046461 Ga0495641_0003323 Ga0495641_0003323_7366_8184 272
683 3300046462 Ga0495651_0205242 Ga0495651_0205242_49_867 272
684 3300046472 Ga0495580_0004927 Ga0495580_0004927_1201_2019 272
685 3300046473 Ga0495582_0000087 Ga0495582_0000087_6827_7645 272
686 3300046475 Ga0495639_0003735 Ga0495639_0003735_4784_5602 272
687 3300046476 Ga0495662_0001853 Ga0495662_0001853_4511_5329 272
688 3300046477 Ga0495664_0036389 Ga0495664_0036389_661_1479 272
689 3300046499 Ga0495594_0000722 Ga0495594_0000722_11465_12283 272
690 3300046514 Ga0495618_0077691 Ga0495618_0077691_264_1082 272
691 3300046516 Ga0495628_0061710 Ga0495628_0061710_715_1533 272
692 3300046517 Ga0495630_0004575 Ga0495630_0004575_4632_5450 272
693 3300046529 Ga0495652_0048579 Ga0495652_0048579_1276_2094 272
694 3300046531 Ga0495665_0000117 Ga0495665_0000117_9463_10281 272
695 3300046535 Ga0495586_0208382 Ga0495586_0208382_181_999 272
696 3300046559 Ga0495667_0292051 Ga0495667_0292051_76_894 272
697 3300046642 Ga0495634_0005647 Ga0495634_0005647_4102_4920 272
698 3300046648 Ga0495611_0120783 Ga0495611_0120783_349_1167 272
699 3300046663 Ga0495635_0007694 Ga0495635_0007694_3163_3981 272
700 3300046680 Ga0495646_0019514 Ga0495646_0019514_1896_2714 272
701 3300046681 Ga0495647_0000849 Ga0495647_0000849_4115_4933 272
702 3300046683 Ga0495658_0000331 Ga0495658_0000331_1019_1837 272
703 3300046689 Ga0495613_0008600 Ga0495613_0008600_5683_6501 272
704 3300046690 Ga0495624_0001012 Ga0495624_0001012_8191_9009 272
705 3300047315 Ga0495581_0000543 Ga0495581_0000543_4431_5249 272
706 3300047319 Ga0495674_0000177 Ga0495674_0000177_39891_40709 272
707 3300047321 Ga0495676_0052488 Ga0495676_0052488_1144_1962 272
708 3300047469 Ga0495673_0007095 Ga0495673_0007095_124_942 272
709 3300047471 Ga0495684_0015566 Ga0495684_0015566_2656_3474 272
710 3300047673 Ga0495593_0000156 Ga0495593_0000156_5384_6202 272
711 3300048089 Ga0495614_0086117 Ga0495614_0086117_211_1029 272
712 3300050489 nmdc:mga03683_55123_c1 nmdc:mga03683_55123_c1_107_925 272
713 3300050490 nmdc:mga03n38_152974_c1 nmdc:mga03n38_152974_c1_171_989 272
714 3300050492 nmdc:mga0yw44_34705_c1 nmdc:mga0yw44_34705_c1_604_1422 272
715 3300050494 nmdc:mga06z11_10611_c1 nmdc:mga06z11_10611_c1_3006_3824 272
716 3300050512 nmdc:mga0n895_220181_c1 nmdc:mga0n895_220181_c1_840_1658 272
717 3300053077 Ga0495601_0140802 Ga0495601_0140802_170_988 272
718 3300053085 Ga0495619_0264354 Ga0495619_0264354_270_1088 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

141

222

0.91

Feature Viewer

pLDDT pTM Quality
74.75 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map