F477162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 506 | 530 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10449661|Ga0105237_104496611 |
| Length | 263 |
| Sequence | MSTEAAGDGPMMSSSADFSTVLNRILDTAADNLRIAKILVQMGLDPNNITYEAFALIGAVFFVATLLMQTMVPLRIANMAGCTFFVAFGALSGNVATFLLYLLLLPINAVRLRQMRNLIRKARLATESDTSMEWLRPFMTERRYRRGDTLCKKDDAANEMFLTITGRYLVTEIGVELPPGRIVGELGFLTPNKQRTATVECIEDGQVLTITYEKLLEIYFQNPQFGYYFLVLTSQRLLENISRLEGIVAQEKAARQGAGAADI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 10 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 11 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 12 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 13 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 14 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 15 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355199 | |||
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 30 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 31 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 32 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 33 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 34 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 35 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 36 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 37 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 38 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 39 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 40 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 41 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 42 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 43 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 44 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 45 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 46 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 47 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 48 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 49 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 50 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 51 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 52 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 53 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 54 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 55 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 56 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 57 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 58 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 59 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 60 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 61 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 62 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 63 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 64 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 65 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 66 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 67 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 68 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 69 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 70 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 71 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 72 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 73 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 74 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 75 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 76 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 77 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 78 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 79 | 2904699407 | |||
| 80 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 81 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 82 | 2906610324 | |||
| 83 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 84 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 85 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 86 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 87 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 88 | 2922368715 | |||
| 89 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 90 | 2922425934 | |||
| 91 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 92 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 93 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 94 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 95 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 96 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 97 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 98 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 99 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 100 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 101 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 102 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 103 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 104 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 105 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 106 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 107 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 108 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 109 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 110 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 111 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 112 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 113 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 114 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 115 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 116 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 117 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 118 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 119 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 120 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 121 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 122 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 123 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 124 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 125 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 126 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 127 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 128 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 129 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 130 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 131 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 132 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 133 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 134 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 135 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 136 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 137 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 138 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 139 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 140 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 141 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 142 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 143 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 144 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 145 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 146 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 147 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 148 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 149 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 150 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 151 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 152 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 153 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 154 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 155 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 156 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 157 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 158 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 159 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 160 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 162 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 163 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 164 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 165 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 166 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 167 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 169 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 171 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 180 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 181 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 187 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 188 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 189 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 190 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 192 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 193 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 195 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 196 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 197 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 198 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 199 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 200 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 201 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 202 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 204 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 205 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 206 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 207 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 210 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 211 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 212 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 213 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 215 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 216 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 217 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 218 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 219 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 220 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 221 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 242 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 247 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 249 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 297 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 304 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 305 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 306 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 307 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 308 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 309 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 310 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 312 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 313 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 314 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 315 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 316 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 317 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 318 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 319 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 320 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 323 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 324 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 325 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 326 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 327 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 328 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 329 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 330 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 331 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 332 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 333 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 334 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 335 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 396 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 397 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 398 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 399 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 422 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 425 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 426 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 427 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 434 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 435 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 436 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 438 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 439 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 441 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 442 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 443 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 444 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 445 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 447 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 448 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 449 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 450 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 452 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 454 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 455 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 457 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 458 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 461 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 462 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 463 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 465 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 467 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 469 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 472 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 473 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 475 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 476 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 477 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 478 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 479 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 480 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 481 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 482 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 483 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 484 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 485 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 486 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 487 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 488 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 489 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 490 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 491 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 492 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 493 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 494 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 495 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 496 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 497 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 498 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 499 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 500 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 501 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 502 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 503 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 504 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 505 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 506 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.19 |
| Metatranscriptomes | 0.14 |
| Isolates | 25.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.43 |
| Nodule | 19.64 |
| Rhizoplane | 3.48 |
| Rhizosphere | 50.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001591 | 3300003203 | Bacteria | 10726 |
| 2 | JGI25406J46586_10003138 | 3300003203 | Bacteria | 7765 |
| 3 | JGI25153J46596_10001822 | 3300003215 | Bacteria | 12629 |
| 4 | JGI25153J46596_10003459 | 3300003215 | Bacteria | 8844 |
| 5 | JGI25153J46596_10004454 | 3300003215 | Bacteria | 7551 |
| 6 | JGI25153J46596_10030199 | 3300003215 | Bacteria | 1848 |
| 7 | JGI25160J50197_1000729 | 3300003354 | Bacteria | 17998 |
| 8 | JGI25160J50197_1002598 | 3300003354 | Bacteria | 8344 |
| 9 | JGI25404J52841_10009491 | 3300003659 | Bacteria | 2080 |
| 10 | Ga0055542_1005244 | 3300003762 | Bacteria | 2964 |
| 11 | Ga0055526_1051644 | 3300003771 | Bacteria | 933 |
| 12 | Ga0055531_10004381 | 3300003794 | Bacteria | 8620 |
| 13 | JGI25405J52794_10035098 | 3300003911 | Bacteria | 1050 |
| 14 | Ga0055543_1001967 | 3300004625 | Bacteria | 7323 |
| 15 | Ga0065165_1000278 | 3300005262 | Bacteria | 87353 |
| 16 | Ga0065165_1005698 | 3300005262 | Bacteria | 6856 |
| 17 | Ga0065165_1010190 | 3300005262 | Bacteria | 4099 |
| 18 | Ga0070683_100015396 | 3300005329 | Bacteria | 6717 |
| 19 | Ga0070670_100061597 | 3300005331 | Bacteria | 3221 |
| 20 | Ga0068869_100067311 | 3300005334 | Bacteria | 2642 |
| 21 | Ga0070680_100007902 | 3300005336 | Bacteria | 8111 |
| 22 | Ga0070680_100011830 | 3300005336 | Bacteria | 6768 |
| 23 | Ga0068868_100004886 | 3300005338 | Bacteria | 9409 |
| 24 | Ga0068868_100152190 | 3300005338 | Bacteria | 1906 |
| 25 | Ga0070660_100099635 | 3300005339 | Bacteria | 2301 |
| 26 | Ga0070660_100388847 | 3300005339 | Bacteria | 1152 |
| 27 | Ga0070661_100282180 | 3300005344 | Bacteria | 1289 |
| 28 | Ga0070668_100148632 | 3300005347 | Bacteria | 1893 |
| 29 | Ga0070669_100265305 | 3300005353 | Bacteria | 1371 |
| 30 | Ga0070675_100220742 | 3300005354 | Bacteria | 1651 |
| 31 | Ga0070671_100012665 | 3300005355 | Bacteria | 6799 |
| 32 | Ga0070673_100117541 | 3300005364 | Bacteria | 2213 |
| 33 | Ga0070673_100147632 | 3300005364 | Bacteria | 1989 |
| 34 | Ga0070709_10043295 | 3300005434 | Bacteria | 2783 |
| 35 | Ga0070709_10066265 | 3300005434 | Bacteria | 2315 |
| 36 | Ga0070709_10336632 | 3300005434 | Bacteria | 1112 |
| 37 | Ga0070713_100003997 | 3300005436 | Bacteria | 9815 |
| 38 | Ga0070710_10003009 | 3300005437 | Bacteria | 8016 |
| 39 | Ga0070710_10128048 | 3300005437 | Bacteria | 1544 |
| 40 | Ga0070711_100043044 | 3300005439 | Bacteria | 3056 |
| 41 | Ga0070663_100033372 | 3300005455 | Bacteria | 3556 |
| 42 | Ga0070663_100067025 | 3300005455 | Bacteria | 2603 |
| 43 | Ga0070663_100301617 | 3300005455 | Bacteria | 1282 |
| 44 | Ga0070662_100097867 | 3300005457 | Bacteria | 2215 |
| 45 | Ga0070681_10018303 | 3300005458 | Bacteria | 7001 |
| 46 | Ga0070681_10039237 | 3300005458 | Bacteria | 4747 |
| 47 | Ga0070681_10221653 | 3300005458 | Bacteria | 1806 |
| 48 | Ga0070698_100013516 | 3300005471 | Bacteria | 8642 |
| 49 | Ga0070684_100014665 | 3300005535 | Bacteria | 6356 |
| 50 | Ga0070684_100191857 | 3300005535 | Bacteria | 1859 |
| 51 | Ga0070697_100468120 | 3300005536 | Bacteria | 1099 |
| 52 | Ga0068853_100047034 | 3300005539 | Bacteria | 3702 |
| 53 | Ga0068853_100132298 | 3300005539 | Bacteria | 2234 |
| 54 | Ga0068853_100262303 | 3300005539 | Bacteria | 1589 |
| 55 | Ga0068853_100404795 | 3300005539 | Bacteria | 1278 |
| 56 | Ga0068855_100017763 | 3300005563 | Bacteria | 8551 |
| 57 | Ga0068855_100031717 | 3300005563 | Bacteria | 6309 |
| 58 | Ga0070664_100063775 | 3300005564 | Bacteria | 3142 |
| 59 | Ga0068857_100142520 | 3300005577 | Bacteria | 2167 |
| 60 | Ga0068857_100176731 | 3300005577 | Bacteria | 1942 |
| 61 | Ga0068857_100358954 | 3300005577 | Bacteria | 1350 |
| 62 | Ga0068857_100404836 | 3300005577 | Bacteria | 1270 |
| 63 | Ga0068856_100219740 | 3300005614 | Bacteria | 1915 |
| 64 | Ga0070702_100094805 | 3300005615 | Bacteria | 1818 |
| 65 | Ga0068852_100010094 | 3300005616 | Bacteria | 7030 |
| 66 | Ga0068852_100524486 | 3300005616 | Bacteria | 1182 |
| 67 | Ga0068864_100141029 | 3300005618 | Bacteria | 2174 |
| 68 | Ga0068864_100231811 | 3300005618 | Bacteria | 1708 |
| 69 | Ga0068861_100109478 | 3300005719 | Bacteria | 2211 |
| 70 | Ga0068863_100628002 | 3300005841 | Bacteria | 1064 |
| 71 | Ga0068862_100052050 | 3300005844 | Bacteria | 3502 |
| 72 | Ga0068862_100099684 | 3300005844 | Bacteria | 2540 |
| 73 | Ga0081455_10042189 | 3300005937 | Bacteria | 4005 |
| 74 | Ga0081455_10042301 | 3300005937 | Bacteria | 3999 |
| 75 | Ga0081540_1001897 | 3300005983 | Bacteria | 17504 |
| 76 | Ga0081540_1003613 | 3300005983 | Bacteria | 12137 |
| 77 | Ga0081539_10000945 | 3300005985 | Bacteria | 54444 |
| 78 | Ga0070717_10007297 | 3300006028 | Bacteria | 8199 |
| 79 | Ga0070717_10019413 | 3300006028 | Bacteria | 5329 |
| 80 | Ga0070717_10142595 | 3300006028 | Bacteria | 2067 |
| 81 | Ga0075365_10008873 | 3300006038 | Bacteria | 5740 |
| 82 | Ga0075365_10161387 | 3300006038 | Unclassified | 1562 |
| 83 | Ga0075368_10006951 | 3300006042 | Bacteria | 3979 |
| 84 | Ga0075363_100043257 | 3300006048 | Bacteria | 2382 |
| 85 | Ga0075364_10007096 | 3300006051 | Bacteria | 6624 |
| 86 | Ga0075364_10008417 | 3300006051 | Bacteria | 6165 |
| 87 | Ga0070715_10000729 | 3300006163 | Bacteria | 8879 |
| 88 | Ga0070712_100027427 | 3300006175 | Bacteria | 3803 |
| 89 | Ga0070712_100040008 | 3300006175 | Bacteria | 3211 |
| 90 | Ga0075362_10014038 | 3300006177 | Bacteria | 3224 |
| 91 | Ga0075367_10008803 | 3300006178 | Bacteria | 5249 |
| 92 | Ga0075367_10049439 | 3300006178 | Bacteria | 2478 |
| 93 | Ga0075367_10077069 | 3300006178 | Bacteria | 2012 |
| 94 | Ga0075369_10030768 | 3300006186 | Bacteria | 2262 |
| 95 | Ga0075369_10087434 | 3300006186 | Bacteria | 1388 |
| 96 | Ga0075366_10004318 | 3300006195 | Bacteria | 7627 |
| 97 | Ga0075366_10063342 | 3300006195 | Bacteria | 2198 |
| 98 | Ga0075366_10067000 | 3300006195 | Bacteria | 2136 |
| 99 | Ga0097621_100016142 | 3300006237 | Bacteria | 5638 |
| 100 | Ga0097621_100307751 | 3300006237 | Bacteria | 1401 |
| 101 | Ga0075370_10009166 | 3300006353 | Bacteria | 5124 |
| 102 | Ga0075370_10025933 | 3300006353 | Bacteria | 3244 |
| 103 | Ga0075370_10041524 | 3300006353 | Bacteria | 2596 |
| 104 | Ga0068871_100162275 | 3300006358 | Bacteria | 1912 |
| 105 | Ga0075434_100205515 | 3300006871 | Bacteria | 1989 |
| 106 | Ga0099825_1032376 | 3300006941 | Bacteria | 2127 |
| 107 | Ga0099824_1016133 | 3300006942 | Bacteria | 6855 |
| 108 | Ga0099823_1044958 | 3300006944 | Bacteria | 2968 |
| 109 | Ga0099794_10055211 | 3300007265 | Bacteria | 1919 |
| 110 | Ga0105251_10164062 | 3300009011 | Bacteria | 1002 |
| 111 | Ga0105240_10031852 | 3300009093 | Bacteria | 6832 |
| 112 | Ga0105240_10077493 | 3300009093 | Bacteria | 4095 |
| 113 | Ga0105240_10125673 | 3300009093 | Bacteria | 3082 |
| 114 | Ga0105245_10001585 | 3300009098 | Bacteria | 20674 |
| 115 | Ga0105245_10004121 | 3300009098 | Bacteria | 12904 |
| 116 | Ga0105243_10650653 | 3300009148 | Bacteria | 1021 |
| 117 | Ga0105241_10023166 | 3300009174 | Bacteria | 4603 |
| 118 | Ga0105241_10033535 | 3300009174 | Bacteria | 3854 |
| 119 | Ga0105241_10057648 | 3300009174 | Bacteria | 2980 |
| 120 | Ga0105241_10375328 | 3300009174 | Bacteria | 1241 |
| 121 | Ga0105241_10499596 | 3300009174 | Bacteria | 1084 |
| 122 | Ga0105248_10004940 | 3300009177 | Bacteria | 14731 |
| 123 | Ga0105248_10012339 | 3300009177 | Bacteria | 9428 |
| 124 | Ga0105248_10098240 | 3300009177 | Bacteria | 3298 |
| 125 | Ga0105237_10014161 | 3300009545 | Bacteria | 8349 |
| 126 | Ga0105237_10015754 | 3300009545 | Bacteria | 7862 |
| 127 | Ga0105237_10051651 | 3300009545 | Bacteria | 4129 |
| 128 | Ga0105237_10430259 | 3300009545 | Bacteria | 1325 |
| 129 | Ga0105237_10449661 | 3300009545 | Bacteria | 1294 |
| 130 | Ga0105249_10288445 | 3300009553 | Bacteria | 1642 |
| 131 | Ga0105239_10052215 | 3300010375 | Bacteria | 4482 |
| 132 | Ga0105239_10181027 | 3300010375 | Bacteria | 2358 |
| 133 | Ga0105239_10192370 | 3300010375 | Bacteria | 2284 |
| 134 | Ga0105239_10250456 | 3300010375 | Bacteria | 1989 |
| 135 | Ga0105246_10001515 | 3300011119 | Bacteria | 13777 |
| 136 | Ga0105246_10096611 | 3300011119 | Bacteria | 2142 |
| 137 | Ga0105246_10141857 | 3300011119 | Bacteria | 1808 |
| 138 | Ga0105246_10172710 | 3300011119 | Bacteria | 1657 |
| 139 | Ga0157370_10013630 | 3300013104 | Bacteria | 8365 |
| 140 | Ga0157370_10083372 | 3300013104 | Bacteria | 3006 |
| 141 | Ga0157370_10095939 | 3300013104 | Bacteria | 2782 |
| 142 | Ga0157369_10026130 | 3300013105 | Bacteria | 6478 |
| 143 | Ga0157369_10078089 | 3300013105 | Bacteria | 3547 |
| 144 | Ga0157374_10033415 | 3300013296 | Bacteria | 4693 |
| 145 | Ga0157374_10266386 | 3300013296 | Bacteria | 1689 |
| 146 | Ga0157378_10158618 | 3300013297 | Bacteria | 2114 |
| 147 | Ga0163162_10138456 | 3300013306 | Bacteria | 2545 |
| 148 | Ga0163162_10219951 | 3300013306 | Bacteria | 2029 |
| 149 | Ga0157372_10209269 | 3300013307 | Bacteria | 2260 |
| 150 | Ga0163163_10017116 | 3300014325 | Bacteria | 6752 |
| 151 | Ga0157377_10133828 | 3300014745 | Bacteria | 1517 |
| 152 | Ga0157376_10043971 | 3300014969 | Bacteria | 3669 |
| 153 | Ga0209563_101494 | 3300025230 | Bacteria | 6143 |
| 154 | Ga0207425_1017592 | 3300025245 | Bacteria | 1567 |
| 155 | Ga0209677_105896 | 3300025253 | Bacteria | 3061 |
| 156 | Ga0209148_1000344 | 3300025254 | Bacteria | 61011 |
| 157 | Ga0209233_1005823 | 3300025261 | Bacteria | 4049 |
| 158 | Ga0209673_1024307 | 3300025273 | Bacteria | 2039 |
| 159 | Ga0209564_1002208 | 3300025295 | Bacteria | 16231 |
| 160 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 161 | Ga0209758_1000900 | 3300025297 | Bacteria | 40401 |
| 162 | Ga0209758_1000952 | 3300025297 | Bacteria | 39040 |
| 163 | Ga0209758_1011752 | 3300025297 | Bacteria | 5019 |
| 164 | Ga0209758_1030934 | 3300025297 | Bacteria | 2206 |
| 165 | Ga0209256_1019540 | 3300025299 | Bacteria | 2151 |
| 166 | Ga0207426_1000466 | 3300025302 | Bacteria | 62533 |
| 167 | Ga0207426_1000865 | 3300025302 | Bacteria | 31635 |
| 168 | Ga0207426_1003194 | 3300025302 | Bacteria | 9234 |
| 169 | Ga0207426_1008651 | 3300025302 | Bacteria | 4086 |
| 170 | Ga0207426_1024999 | 3300025302 | Bacteria | 2018 |
| 171 | Ga0209257_1001445 | 3300025304 | Bacteria | 28079 |
| 172 | Ga0207697_10032884 | 3300025315 | Bacteria | 2123 |
| 173 | Ga0207697_10060508 | 3300025315 | Bacteria | 1575 |
| 174 | Ga0207692_10000318 | 3300025898 | Bacteria | 16715 |
| 175 | Ga0207692_10027670 | 3300025898 | Bacteria | 2673 |
| 176 | Ga0207692_10140739 | 3300025898 | Bacteria | 1372 |
| 177 | Ga0207692_10189975 | 3300025898 | Bacteria | 1202 |
| 178 | Ga0207710_10130873 | 3300025900 | Bacteria | 1205 |
| 179 | Ga0207647_10008614 | 3300025904 | Bacteria | 7300 |
| 180 | Ga0207685_10001710 | 3300025905 | Bacteria | 4749 |
| 181 | Ga0207685_10049864 | 3300025905 | Bacteria | 1610 |
| 182 | Ga0207699_10021869 | 3300025906 | Bacteria | 3456 |
| 183 | Ga0207699_10064756 | 3300025906 | Bacteria | 2213 |
| 184 | Ga0207643_10216684 | 3300025908 | Bacteria | 1170 |
| 185 | Ga0207684_10037545 | 3300025910 | Bacteria | 4111 |
| 186 | Ga0207684_10200944 | 3300025910 | Bacteria | 1719 |
| 187 | Ga0207654_10001150 | 3300025911 | Bacteria | 14244 |
| 188 | Ga0207654_10084567 | 3300025911 | Bacteria | 1918 |
| 189 | Ga0207654_10170555 | 3300025911 | Bacteria | 1413 |
| 190 | Ga0207707_10001119 | 3300025912 | Bacteria | 25478 |
| 191 | Ga0207707_10003222 | 3300025912 | Bacteria | 14487 |
| 192 | Ga0207707_10007981 | 3300025912 | Bacteria | 9195 |
| 193 | Ga0207707_10220119 | 3300025912 | Bacteria | 1652 |
| 194 | Ga0207707_10234549 | 3300025912 | Bacteria | 1596 |
| 195 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 196 | Ga0207695_10063666 | 3300025913 | Bacteria | 3801 |
| 197 | Ga0207695_10074630 | 3300025913 | Bacteria | 3453 |
| 198 | Ga0207695_10275109 | 3300025913 | Bacteria | 1578 |
| 199 | Ga0207671_10005971 | 3300025914 | Bacteria | 11027 |
| 200 | Ga0207671_10048682 | 3300025914 | Bacteria | 3137 |
| 201 | Ga0207671_10143580 | 3300025914 | Bacteria | 1841 |
| 202 | Ga0207671_10164947 | 3300025914 | Bacteria | 1717 |
| 203 | Ga0207693_10027725 | 3300025915 | Bacteria | 4477 |
| 204 | Ga0207663_10002625 | 3300025916 | Bacteria | 8648 |
| 205 | Ga0207663_10303285 | 3300025916 | Bacteria | 1194 |
| 206 | Ga0207660_10012652 | 3300025917 | Bacteria | 5527 |
| 207 | Ga0207660_10038528 | 3300025917 | Bacteria | 3338 |
| 208 | Ga0207660_10084511 | 3300025917 | Bacteria | 2339 |
| 209 | Ga0207660_10334749 | 3300025917 | Bacteria | 1211 |
| 210 | Ga0207657_10064333 | 3300025919 | Bacteria | 3131 |
| 211 | Ga0207657_10250543 | 3300025919 | Bacteria | 1412 |
| 212 | Ga0207652_10008142 | 3300025921 | Bacteria | 8418 |
| 213 | Ga0207652_10010456 | 3300025921 | Bacteria | 7470 |
| 214 | Ga0207652_10026854 | 3300025921 | Bacteria | 4798 |
| 215 | Ga0207694_10221557 | 3300025924 | Bacteria | 1543 |
| 216 | Ga0207650_10091560 | 3300025925 | Bacteria | 2324 |
| 217 | Ga0207687_10055275 | 3300025927 | Bacteria | 2781 |
| 218 | Ga0207700_10007250 | 3300025928 | Bacteria | 6764 |
| 219 | Ga0207700_10022832 | 3300025928 | Bacteria | 4299 |
| 220 | Ga0207700_10511229 | 3300025928 | Bacteria | 1063 |
| 221 | Ga0207664_10204060 | 3300025929 | Bacteria | 1708 |
| 222 | Ga0207644_10086201 | 3300025931 | Bacteria | 2331 |
| 223 | Ga0207690_10531007 | 3300025932 | Bacteria | 955 |
| 224 | Ga0207706_10125734 | 3300025933 | Bacteria | 2255 |
| 225 | Ga0207706_10326521 | 3300025933 | Bacteria | 1335 |
| 226 | Ga0207709_10026733 | 3300025935 | Bacteria | 3317 |
| 227 | Ga0207665_10000311 | 3300025939 | Bacteria | 33740 |
| 228 | Ga0207711_10212668 | 3300025941 | Bacteria | 1767 |
| 229 | Ga0207711_10224952 | 3300025941 | Bacteria | 1717 |
| 230 | Ga0207689_10014007 | 3300025942 | Bacteria | 6827 |
| 231 | Ga0207661_10008392 | 3300025944 | Bacteria | 7381 |
| 232 | Ga0207679_10034372 | 3300025945 | Bacteria | 3576 |
| 233 | Ga0207667_10037454 | 3300025949 | Bacteria | 5183 |
| 234 | Ga0207667_10134031 | 3300025949 | Bacteria | 2551 |
| 235 | Ga0207667_10728591 | 3300025949 | Bacteria | 992 |
| 236 | Ga0207651_10096664 | 3300025960 | Bacteria | 2179 |
| 237 | Ga0207668_10139792 | 3300025972 | Bacteria | 1860 |
| 238 | Ga0207658_10030261 | 3300025986 | Bacteria | 3832 |
| 239 | Ga0207658_10576004 | 3300025986 | Bacteria | 1009 |
| 240 | Ga0207677_10013899 | 3300026023 | Bacteria | 4679 |
| 241 | Ga0207703_10162839 | 3300026035 | Bacteria | 1955 |
| 242 | Ga0207639_10456198 | 3300026041 | Bacteria | 1161 |
| 243 | Ga0207678_10042504 | 3300026067 | Bacteria | 3937 |
| 244 | Ga0207678_10523324 | 3300026067 | Bacteria | 1035 |
| 245 | Ga0207702_10734210 | 3300026078 | Bacteria | 974 |
| 246 | Ga0207676_10236809 | 3300026095 | Bacteria | 1635 |
| 247 | Ga0207674_10056763 | 3300026116 | Bacteria | 3973 |
| 248 | Ga0207674_10068547 | 3300026116 | Bacteria | 3570 |
| 249 | Ga0207674_10371185 | 3300026116 | Bacteria | 1383 |
| 250 | Ga0207675_100154789 | 3300026118 | Bacteria | 2184 |
| 251 | Ga0207698_10015126 | 3300026142 | Bacteria | 5158 |
| 252 | Ga0207698_10459006 | 3300026142 | Bacteria | 1232 |
| 253 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 254 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 255 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 256 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 257 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 258 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 259 | Ga0209179_1006560 | 3300027512 | Bacteria | 1883 |
| 260 | Ga0209588_1002751 | 3300027671 | Bacteria | 4807 |
| 261 | Ga0268264_10134165 | 3300028381 | Bacteria | 2199 |
| 262 | Ga0265762_1034850 | 3300030760 | Bacteria | 967 |
| 263 | Ga0265314_10071779 | 3300031711 | Bacteria | 2315 |
| 264 | Ga0265342_10021560 | 3300031712 | Bacteria | 4111 |
| 265 | Ga0307516_10062981 | 3300031730 | Bacteria | 3592 |
| 266 | Ga0307510_10042405 | 3300033180 | Bacteria | 4959 |
| 267 | Ga0316215_1000880 | 3300033544 | Bacteria | 2949 |
| 268 | Ga0373944_0048648 | 3300035089 | Bacteria | 1331 |
| 269 | Ga0373936_0108395 | 3300035113 | Bacteria | 1177 |
| 270 | Ga0373936_0120468 | 3300035113 | Bacteria | 1120 |
| 271 | Ga0373945_0064938 | 3300035116 | Bacteria | 1369 |
| 272 | Ga0373957_0051449 | 3300035120 | Bacteria | 1576 |
| 273 | Ga0373943_0005471 | 3300035170 | Bacteria | 5717 |
| 274 | Ga0373943_0031479 | 3300035170 | Bacteria | 2517 |
| 275 | Ga0373946_0027185 | 3300035171 | Bacteria | 2261 |
| 276 | Ga0373955_0009368 | 3300035172 | Bacteria | 4583 |
| 277 | Ga0373955_0019488 | 3300035172 | Bacteria | 3392 |
| 278 | Ga0373924_0069072 | 3300035410 | Bacteria | 1488 |
| 279 | Ga0373935_0010393 | 3300035692 | Bacteria | 5581 |
| 280 | Ga0373927_0000515 | 3300035695 | Bacteria | 29473 |
| 281 | Ga0373933_0008698 | 3300035724 | Bacteria | 5535 |
| 282 | Ga0373933_0037509 | 3300035724 | Bacteria | 2843 |
| 283 | Ga0373947_0011552 | 3300035725 | Bacteria | 5065 |
| 284 | Ga0373947_0027207 | 3300035725 | Bacteria | 3346 |
| 285 | Ga0373937_0368708 | 3300036401 | Bacteria | 1361 |
| 286 | Ga0373937_0503138 | 3300036401 | Bacteria | 1151 |
| 287 | Ga0373925_0001116 | 3300037068 | Bacteria | 23846 |
| 288 | Ga0373925_0052470 | 3300037068 | Bacteria | 3046 |
| 289 | Ga0395900_0001980 | 3300037418 | Bacteria | 23121 |
| 290 | Ga0395898_0018122 | 3300037466 | Bacteria | 7186 |
| 291 | Ga0395905_0015966 | 3300037471 | Bacteria | 7137 |
| 292 | Ga0395905_0083925 | 3300037471 | Bacteria | 2984 |
| 293 | Ga0395905_0311355 | 3300037471 | Bacteria | 1463 |
| 294 | Ga0395901_0026781 | 3300038443 | Bacteria | 5920 |
| 295 | Ga0395901_0071278 | 3300038443 | Bacteria | 3621 |
| 296 | Ga0395901_0093836 | 3300038443 | Bacteria | 3143 |
| 297 | Ga0395901_0148346 | 3300038443 | Bacteria | 2465 |
| 298 | Ga0436361_1211699 | 3300039447 | Bacteria | 1967 |
| 299 | Ga0436363_0232520 | 3300039450 | Bacteria | 4878 |
| 300 | Ga0466972_0000261 | 3300044658 | Bacteria | 34759 |
| 301 | Ga0466972_0008229 | 3300044658 | Bacteria | 5228 |
| 302 | Ga0466966_0000211 | 3300044684 | Bacteria | 38929 |
| 303 | Ga0466966_0205536 | 3300044684 | Bacteria | 1191 |
| 304 | Ga0466961_0005032 | 3300044693 | Bacteria | 8314 |
| 305 | Ga0466961_0165283 | 3300044693 | Bacteria | 1378 |
| 306 | Ga0466963_0221714 | 3300044694 | Bacteria | 1324 |
| 307 | Ga0466971_0037598 | 3300044719 | Bacteria | 2170 |
| 308 | Ga0466968_0001473 | 3300044735 | Bacteria | 8432 |
| 309 | Ga0466970_0296155 | 3300044765 | Bacteria | 912 |
| 310 | Ga0466957_0017412 | 3300044842 | Bacteria | 4208 |
| 311 | Ga0466960_0002388 | 3300044901 | Bacteria | 7066 |
| 312 | Ga0466959_0011922 | 3300045049 | Bacteria | 6266 |
| 313 | Ga0466959_0012080 | 3300045049 | Bacteria | 6231 |
| 314 | Ga0495592_0032474 | 3300046454 | Bacteria | 3938 |
| 315 | Ga0495592_0195789 | 3300046454 | Bacteria | 1367 |
| 316 | Ga0495603_0000156 | 3300046455 | Bacteria | 34369 |
| 317 | Ga0495629_0000297 | 3300046459 | Bacteria | 42433 |
| 318 | Ga0495629_0014255 | 3300046459 | Bacteria | 5724 |
| 319 | Ga0495629_0085568 | 3300046459 | Bacteria | 2200 |
| 320 | Ga0495629_0119612 | 3300046459 | Bacteria | 1835 |
| 321 | Ga0495638_0009098 | 3300046460 | Bacteria | 6993 |
| 322 | Ga0495641_0003323 | 3300046461 | Bacteria | 12109 |
| 323 | Ga0495651_0152145 | 3300046462 | Bacteria | 1666 |
| 324 | Ga0495651_0205242 | 3300046462 | Bacteria | 1376 |
| 325 | Ga0495653_0081497 | 3300046463 | Bacteria | 2391 |
| 326 | Ga0495653_0102683 | 3300046463 | Bacteria | 2069 |
| 327 | Ga0495580_0004927 | 3300046472 | Bacteria | 11163 |
| 328 | Ga0495582_0000087 | 3300046473 | Bacteria | 47529 |
| 329 | Ga0495582_0145047 | 3300046473 | Bacteria | 1346 |
| 330 | Ga0495639_0003735 | 3300046475 | Bacteria | 6549 |
| 331 | Ga0495639_0053073 | 3300046475 | Bacteria | 1846 |
| 332 | Ga0495662_0001853 | 3300046476 | Bacteria | 10603 |
| 333 | Ga0495662_0106921 | 3300046476 | Bacteria | 1370 |
| 334 | Ga0495664_0036389 | 3300046477 | Bacteria | 2901 |
| 335 | Ga0495664_0122796 | 3300046477 | Bacteria | 1570 |
| 336 | Ga0495594_0000722 | 3300046499 | Bacteria | 16979 |
| 337 | Ga0495583_0025158 | 3300046506 | Bacteria | 2979 |
| 338 | Ga0495606_0034700 | 3300046507 | Bacteria | 3459 |
| 339 | Ga0495608_0012913 | 3300046511 | Bacteria | 5797 |
| 340 | Ga0495610_0039636 | 3300046512 | Bacteria | 2381 |
| 341 | Ga0495618_0018261 | 3300046514 | Bacteria | 4306 |
| 342 | Ga0495618_0077691 | 3300046514 | Bacteria | 2115 |
| 343 | Ga0495628_0061710 | 3300046516 | Bacteria | 2940 |
| 344 | Ga0495628_0270695 | 3300046516 | Bacteria | 1263 |
| 345 | Ga0495628_0347869 | 3300046516 | Bacteria | 1090 |
| 346 | Ga0495630_0004575 | 3300046517 | Bacteria | 9693 |
| 347 | Ga0495648_0013331 | 3300046524 | Bacteria | 6084 |
| 348 | Ga0495648_0161593 | 3300046524 | Bacteria | 1157 |
| 349 | Ga0495652_0048579 | 3300046529 | Bacteria | 3635 |
| 350 | Ga0495652_0167152 | 3300046529 | Bacteria | 1701 |
| 351 | Ga0495652_0178992 | 3300046529 | Bacteria | 1629 |
| 352 | Ga0495652_0264297 | 3300046529 | Bacteria | 1268 |
| 353 | Ga0495665_0000117 | 3300046531 | Bacteria | 37802 |
| 354 | Ga0495640_0014622 | 3300046533 | Bacteria | 5930 |
| 355 | Ga0495640_0038248 | 3300046533 | Bacteria | 3376 |
| 356 | Ga0495640_0126489 | 3300046533 | Bacteria | 1657 |
| 357 | Ga0495586_0208382 | 3300046535 | Bacteria | 1109 |
| 358 | Ga0495587_0152159 | 3300046536 | Bacteria | 1318 |
| 359 | Ga0495597_0029333 | 3300046542 | Bacteria | 2512 |
| 360 | Ga0495622_0034064 | 3300046557 | Bacteria | 2376 |
| 361 | Ga0495667_0010331 | 3300046559 | Bacteria | 6314 |
| 362 | Ga0495667_0064983 | 3300046559 | Bacteria | 2386 |
| 363 | Ga0495667_0292051 | 3300046559 | Bacteria | 1034 |
| 364 | Ga0495667_0296516 | 3300046559 | Bacteria | 1025 |
| 365 | Ga0495668_0198568 | 3300046616 | Bacteria | 1098 |
| 366 | Ga0495634_0005647 | 3300046642 | Bacteria | 9582 |
| 367 | Ga0495634_0057409 | 3300046642 | Bacteria | 2598 |
| 368 | Ga0495634_0084852 | 3300046642 | Bacteria | 2065 |
| 369 | Ga0495611_0120783 | 3300046648 | Bacteria | 1222 |
| 370 | Ga0495625_0011551 | 3300046660 | Bacteria | 7194 |
| 371 | Ga0495625_0205447 | 3300046660 | Bacteria | 1297 |
| 372 | Ga0495635_0002863 | 3300046663 | Bacteria | 11862 |
| 373 | Ga0495635_0007694 | 3300046663 | Bacteria | 7517 |
| 374 | Ga0495635_0298433 | 3300046663 | Bacteria | 1080 |
| 375 | Ga0495657_0009077 | 3300046675 | Bacteria | 7557 |
| 376 | Ga0495657_0014067 | 3300046675 | Bacteria | 5878 |
| 377 | Ga0495599_0116566 | 3300046678 | Bacteria | 1661 |
| 378 | Ga0495623_0111389 | 3300046679 | Bacteria | 1658 |
| 379 | Ga0495646_0019514 | 3300046680 | Bacteria | 4291 |
| 380 | Ga0495647_0000849 | 3300046681 | Bacteria | 9146 |
| 381 | Ga0495658_0000331 | 3300046683 | Bacteria | 26505 |
| 382 | Ga0495613_0008600 | 3300046689 | Bacteria | 7576 |
| 383 | Ga0495613_0070731 | 3300046689 | Bacteria | 2544 |
| 384 | Ga0495624_0001012 | 3300046690 | Bacteria | 22250 |
| 385 | Ga0495624_0110149 | 3300046690 | Bacteria | 1693 |
| 386 | Ga0495649_0070668 | 3300046694 | Bacteria | 1871 |
| 387 | Ga0495649_0116789 | 3300046694 | Bacteria | 1412 |
| 388 | Ga0495600_0032498 | 3300046809 | Bacteria | 3386 |
| 389 | Ga0495600_0111490 | 3300046809 | Bacteria | 1781 |
| 390 | Ga0495581_0000543 | 3300047315 | Bacteria | 19442 |
| 391 | Ga0495581_0139496 | 3300047315 | Bacteria | 1414 |
| 392 | Ga0495581_0160633 | 3300047315 | Bacteria | 1313 |
| 393 | Ga0495604_0045510 | 3300047317 | Bacteria | 3424 |
| 394 | Ga0495604_0134140 | 3300047317 | Bacteria | 1776 |
| 395 | Ga0495674_0000177 | 3300047319 | Bacteria | 50030 |
| 396 | Ga0495674_0055953 | 3300047319 | Bacteria | 3457 |
| 397 | Ga0495676_0052488 | 3300047321 | Bacteria | 3254 |
| 398 | Ga0495676_0158294 | 3300047321 | Bacteria | 1605 |
| 399 | Ga0495676_0206390 | 3300047321 | Bacteria | 1362 |
| 400 | Ga0495680_0077188 | 3300047322 | Bacteria | 2523 |
| 401 | Ga0495687_018792 | 3300047443 | Bacteria | 3407 |
| 402 | Ga0495675_0053976 | 3300047444 | Bacteria | 2550 |
| 403 | Ga0495673_0007095 | 3300047469 | Bacteria | 6493 |
| 404 | Ga0495684_0000357 | 3300047471 | Bacteria | 36963 |
| 405 | Ga0495684_0015566 | 3300047471 | Bacteria | 5855 |
| 406 | Ga0495684_0016950 | 3300047471 | Bacteria | 5612 |
| 407 | Ga0495684_0049442 | 3300047471 | Bacteria | 3212 |
| 408 | Ga0495686_0044369 | 3300047472 | Bacteria | 2815 |
| 409 | Ga0495593_0000156 | 3300047673 | Bacteria | 34308 |
| 410 | Ga0495593_0049272 | 3300047673 | Bacteria | 2236 |
| 411 | Ga0495602_0210882 | 3300048088 | Bacteria | 1474 |
| 412 | Ga0495614_0086117 | 3300048089 | Bacteria | 1364 |
| 413 | Ga0496102_0010378 | 3300048905 | Bacteria | 8014 |
| 414 | Ga0496103_0020315 | 3300048906 | Bacteria | 3989 |
| 415 | Ga0496104_0019267 | 3300048907 | Bacteria | 6240 |
| 416 | Ga0496104_0097493 | 3300048907 | Bacteria | 2814 |
| 417 | Ga0496104_0543750 | 3300048907 | Bacteria | 1072 |
| 418 | Ga0496105_0063051 | 3300048908 | Bacteria | 3058 |
| 419 | Ga0496106_0017841 | 3300048909 | Bacteria | 5248 |
| 420 | Ga0496108_0040294 | 3300048911 | Bacteria | 3893 |
| 421 | Ga0496108_0328005 | 3300048911 | Bacteria | 1334 |
| 422 | Ga0496109_0257512 | 3300048912 | Bacteria | 1643 |
| 423 | Ga0496109_0387527 | 3300048912 | Bacteria | 1320 |
| 424 | Ga0496110_0021826 | 3300048913 | Bacteria | 5428 |
| 425 | Ga0496110_0041338 | 3300048913 | Bacteria | 4022 |
| 426 | Ga0496110_0205828 | 3300048913 | Bacteria | 1788 |
| 427 | Ga0496111_0150775 | 3300048914 | Bacteria | 1724 |
| 428 | Ga0496111_0538468 | 3300048914 | Bacteria | 858 |
| 429 | Ga0496112_0062188 | 3300048915 | Bacteria | 3682 |
| 430 | Ga0496112_0098946 | 3300048915 | Bacteria | 2886 |
| 431 | Ga0496112_0296889 | 3300048915 | Bacteria | 1561 |
| 432 | Ga0496112_0388751 | 3300048915 | Bacteria | 1335 |
| 433 | Ga0496113_0046252 | 3300048916 | Bacteria | 3230 |
| 434 | Ga0496114_0242677 | 3300048917 | Bacteria | 1585 |
| 435 | Ga0496114_0353741 | 3300048917 | Bacteria | 1299 |
| 436 | Ga0496115_0074634 | 3300048918 | Bacteria | 2754 |
| 437 | Ga0496115_0147902 | 3300048918 | Bacteria | 1939 |
| 438 | Ga0496117_0080961 | 3300048920 | Bacteria | 2133 |
| 439 | Ga0496119_0081115 | 3300048922 | Bacteria | 1869 |
| 440 | Ga0496119_0174238 | 3300048922 | Bacteria | 1133 |
| 441 | Ga0496120_0010597 | 3300048923 | Bacteria | 6411 |
| 442 | Ga0496121_0035122 | 3300048924 | Bacteria | 4498 |
| 443 | Ga0496121_0055828 | 3300048924 | Bacteria | 3287 |
| 444 | Ga0496121_0250475 | 3300048924 | Bacteria | 1228 |
| 445 | Ga0496121_0389356 | 3300048924 | Bacteria | 916 |
| 446 | Ga0496123_0088746 | 3300048926 | Bacteria | 1845 |
| 447 | Ga0496124_0178147 | 3300048927 | Bacteria | 1638 |
| 448 | Ga0496124_0301428 | 3300048927 | Bacteria | 1157 |
| 449 | Ga0496125_0096219 | 3300048928 | Bacteria | 2199 |
| 450 | Ga0496126_0172539 | 3300048929 | Bacteria | 1841 |
| 451 | Ga0495678_092178 | 3300049459 | Bacteria | 1065 |
| 452 | Ga0495682_0031543 | 3300049460 | Bacteria | 1958 |
| 453 | Ga0501071_0200210 | 3300049587 | Bacteria | 1500 |
| 454 | Ga0501076_0176722 | 3300049592 | Bacteria | 1740 |
| 455 | nmdc:mga03683_55123_c1 | 3300050489 | Bacteria | 1669 |
| 456 | nmdc:mga03n38_152974_c1 | 3300050490 | Bacteria | 1162 |
| 457 | nmdc:mga03n38_6610_c1 | 3300050490 | Bacteria | 4043 |
| 458 | nmdc:mga00v17_114536_c1 | 3300050491 | Bacteria | 1713 |
| 459 | nmdc:mga00v17_173408_c1 | 3300050491 | Bacteria | 1391 |
| 460 | nmdc:mga00v17_35992_c1 | 3300050491 | Bacteria | 2949 |
| 461 | nmdc:mga0yw44_21091_c1 | 3300050492 | Bacteria | 3629 |
| 462 | nmdc:mga0yw44_34705_c1 | 3300050492 | Bacteria | 2958 |
| 463 | nmdc:mga0yw44_363580_c1 | 3300050492 | Unclassified | 975 |
| 464 | nmdc:mga0yw44_73169_c1 | 3300050492 | Bacteria | 2132 |
| 465 | nmdc:mga0k408_5049_c1 | 3300050493 | Bacteria | 6988 |
| 466 | nmdc:mga0k408_73421_c1 | 3300050493 | Bacteria | 1998 |
| 467 | nmdc:mga06z11_102459_c1 | 3300050494 | Bacteria | 1573 |
| 468 | nmdc:mga06z11_10611_c1 | 3300050494 | Bacteria | 3934 |
| 469 | nmdc:mga04h51_36793_c1 | 3300050495 | Bacteria | 1577 |
| 470 | nmdc:mga07m45_105346_c1 | 3300050496 | Bacteria | 1622 |
| 471 | nmdc:mga07m45_111515_c1 | 3300050496 | Bacteria | 1576 |
| 472 | nmdc:mga07m45_189268_c1 | 3300050496 | Bacteria | 1197 |
| 473 | nmdc:mga07m45_29462_c1 | 3300050496 | Bacteria | 3036 |
| 474 | nmdc:mga07m45_75185_c1 | 3300050496 | Bacteria | 1925 |
| 475 | nmdc:mga0n895_220181_c1 | 3300050512 | Bacteria | 1927 |
| 476 | nmdc:mga0rr50_340956_c1 | 3300050513 | Bacteria | 1259 |
| 477 | nmdc:mga0sz30_1122_c1 | 3300050516 | Bacteria | 9615 |
| 478 | nmdc:mga0sz30_68994_c2 | 3300050516 | Bacteria | 1090 |
| 479 | Ga0495601_0115025 | 3300053077 | Bacteria | 1744 |
| 480 | Ga0495601_0140802 | 3300053077 | Bacteria | 1573 |
| 481 | Ga0495619_0006157 | 3300053085 | Bacteria | 7601 |
| 482 | Ga0495619_0169023 | 3300053085 | Bacteria | 1512 |
| 483 | Ga0495619_0264354 | 3300053085 | Bacteria | 1192 |
| 484 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 485 | Ga0500647_0166196 | 3300053091 | Bacteria | 1021 |
| 486 | Ga0500651_0044361 | 3300053093 | Bacteria | 2800 |
| 487 | Ga0500566_0001353 | 3300053094 | Bacteria | 14341 |
| 488 | Ga0500566_0007323 | 3300053094 | Bacteria | 6536 |
| 489 | Ga0500640_002668 | 3300053095 | Bacteria | 5968 |
| 490 | Ga0500554_030255 | 3300053102 | Bacteria | 1590 |
| 491 | Ga0500556_0027156 | 3300053104 | Bacteria | 1908 |
| 492 | Ga0500557_000149 | 3300053105 | Bacteria | 16191 |
| 493 | Ga0500562_005797 | 3300053108 | Bacteria | 3109 |
| 494 | Ga0500569_021894 | 3300053109 | Bacteria | 1695 |
| 495 | Ga0500580_050558 | 3300053113 | Bacteria | 1749 |
| 496 | Ga0500591_089605 | 3300053115 | Bacteria | 1346 |
| 497 | Ga0500595_000651 | 3300053119 | Bacteria | 20888 |
| 498 | Ga0500595_030868 | 3300053119 | Bacteria | 1801 |
| 499 | Ga0500597_142710 | 3300053120 | Bacteria | 1031 |
| 500 | Ga0500607_012439 | 3300053121 | Bacteria | 4992 |
| 501 | Ga0500608_005278 | 3300053122 | Bacteria | 5114 |
| 502 | Ga0500608_057597 | 3300053122 | Bacteria | 1861 |
| 503 | Ga0500614_006096 | 3300053123 | Bacteria | 2536 |
| 504 | Ga0500618_027048 | 3300053125 | Bacteria | 1366 |
| 505 | Ga0500621_054857 | 3300053126 | Bacteria | 1612 |
| 506 | Ga0500642_0000063 | 3300053130 | Bacteria | 58680 |
| 507 | Ga0500642_0004724 | 3300053130 | Bacteria | 4307 |
| 508 | Ga0500652_062106 | 3300053131 | Bacteria | 1540 |
| 509 | Ga0500655_009335 | 3300053133 | Bacteria | 1768 |
| 510 | Ga0500559_0043444 | 3300053136 | Bacteria | 1963 |
| 511 | Ga0500559_0053205 | 3300053136 | Bacteria | 1791 |
| 512 | Ga0500588_0021225 | 3300053146 | Bacteria | 1751 |
| 513 | Ga0500590_110155 | 3300053148 | Bacteria | 1307 |
| 514 | Ga0500604_0027833 | 3300053151 | Bacteria | 1638 |
| 515 | Ga0500616_0000045 | 3300053153 | Bacteria | 339292 |
| 516 | Ga0500616_0062461 | 3300053153 | Bacteria | 1924 |
| 517 | Ga0500622_0008022 | 3300053156 | Bacteria | 5942 |
| 518 | Ga0500630_004105 | 3300053159 | Bacteria | 7089 |
| 519 | Ga0500634_0089276 | 3300053161 | Bacteria | 1569 |
| 520 | Ga0500638_008408 | 3300053162 | Bacteria | 4398 |
| 521 | Ga0500639_000007 | 3300053163 | Bacteria | 152350 |
| 522 | Ga0500636_0000194 | 3300053177 | Bacteria | 32748 |
| 523 | Ga0500637_0000502 | 3300053178 | Bacteria | 15181 |
| 524 | Ga0500649_129715 | 3300053722 | Bacteria | 945 |
| 525 | Ga0500625_003068 | 3300053729 | Bacteria | 6482 |
| 526 | Ga0500645_024565 | 3300053730 | Bacteria | 1841 |
| 527 | Ga0500609_000571 | 3300053731 | Bacteria | 5571 |
| 528 | Ga0500596_000834 | 3300053735 | Bacteria | 6103 |
| 529 | Ga0500661_000333 | 3300055283 | Bacteria | 8566 |
| 530 | Ga0501082_0258657 | 3300060353 | Bacteria | 1514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025949 | Ga0207667_10728591 | Ga0207667_107285911 | 240 |
| 2 | 3300053153 | Ga0500616_0000045 | Ga0500616_0000045_245589_246539 | 240 |
| 3 | iso_pu_bacteria | 8016603502 | 8016612277 | 248 |
| 4 | 3300009177 | Ga0105248_10098240 | Ga0105248_100982403 | 249 |
| 5 | 3300048924 | Ga0496121_0035122 | Ga0496121_0035122_692_1537 | 249 |
| 6 | 3300050491 | nmdc:mga00v17_114536_c1 | nmdc:mga00v17_114536_c1_176_1021 | 249 |
| 7 | 3300050492 | nmdc:mga0yw44_21091_c1 | nmdc:mga0yw44_21091_c1_716_1561 | 249 |
| 8 | 3300050496 | nmdc:mga07m45_111515_c1 | nmdc:mga07m45_111515_c1_416_1261 | 249 |
| 9 | 3300009545 | Ga0105237_10449661 | Ga0105237_104496611 | 252 |
| 10 | 3300007265 | Ga0099794_10055211 | Ga0099794_100552113 | 253 |
| 11 | 3300035724 | Ga0373933_0008698 | Ga0373933_0008698_211_1158 | 256 |
| 12 | 3300036401 | Ga0373937_0368708 | Ga0373937_0368708_211_1158 | 256 |
| 13 | 3300037418 | Ga0395900_0001980 | Ga0395900_0001980_17610_18467 | 256 |
| 14 | 3300037466 | Ga0395898_0018122 | Ga0395898_0018122_1966_2823 | 256 |
| 15 | 3300037471 | Ga0395905_0311355 | Ga0395905_0311355_204_1061 | 256 |
| 16 | 3300038443 | Ga0395901_0026781 | Ga0395901_0026781_4259_5116 | 256 |
| 17 | 3300046454 | Ga0495592_0195789 | Ga0495592_0195789_204_1151 | 256 |
| 18 | 3300046459 | Ga0495629_0014255 | Ga0495629_0014255_4596_5543 | 256 |
| 19 | 3300046462 | Ga0495651_0152145 | Ga0495651_0152145_229_1176 | 256 |
| 20 | 3300046463 | Ga0495653_0081497 | Ga0495653_0081497_1398_2345 | 256 |
| 21 | 3300046511 | Ga0495608_0012913 | Ga0495608_0012913_4636_5583 | 256 |
| 22 | 3300046516 | Ga0495628_0270695 | Ga0495628_0270695_193_1140 | 256 |
| 23 | 3300046529 | Ga0495652_0178992 | Ga0495652_0178992_491_1438 | 256 |
| 24 | 3300046536 | Ga0495587_0152159 | Ga0495587_0152159_150_1097 | 256 |
| 25 | 3300046559 | Ga0495667_0064983 | Ga0495667_0064983_232_1179 | 256 |
| 26 | 3300046675 | Ga0495657_0009077 | Ga0495657_0009077_193_1140 | 256 |
| 27 | 3300046678 | Ga0495599_0116566 | Ga0495599_0116566_491_1438 | 256 |
| 28 | 3300046679 | Ga0495623_0111389 | Ga0495623_0111389_491_1438 | 256 |
| 29 | 3300046809 | Ga0495600_0032498 | Ga0495600_0032498_2208_3155 | 256 |
| 30 | 3300047322 | Ga0495680_0077188 | Ga0495680_0077188_211_1158 | 256 |
| 31 | 3300047444 | Ga0495675_0053976 | Ga0495675_0053976_232_1179 | 256 |
| 32 | 3300047471 | Ga0495684_0000357 | Ga0495684_0000357_35792_36739 | 256 |
| 33 | 3300048088 | Ga0495602_0210882 | Ga0495602_0210882_296_1243 | 256 |
| 34 | 3300053085 | Ga0495619_0006157 | Ga0495619_0006157_6393_7340 | 256 |
| 35 | 3300009545 | Ga0105237_10051651 | Ga0105237_100516514 | 261 |
| 36 | 3300013306 | Ga0163162_10138456 | Ga0163162_101384561 | 261 |
| 37 | 3300014745 | Ga0157377_10133828 | Ga0157377_101338281 | 261 |
| 38 | 3300014969 | Ga0157376_10043971 | Ga0157376_100439712 | 261 |
| 39 | 3300048907 | Ga0496104_0097493 | Ga0496104_0097493_663_1529 | 261 |
| 40 | 3300048911 | Ga0496108_0040294 | Ga0496108_0040294_2459_3325 | 261 |
| 41 | 3300048913 | Ga0496110_0041338 | Ga0496110_0041338_1301_2167 | 261 |
| 42 | 3300048914 | Ga0496111_0150775 | Ga0496111_0150775_80_946 | 261 |
| 43 | 3300048915 | Ga0496112_0098946 | Ga0496112_0098946_1271_2137 | 261 |
| 44 | 3300048917 | Ga0496114_0242677 | Ga0496114_0242677_134_1000 | 261 |
| 45 | 3300005334 | Ga0068869_100067311 | Ga0068869_1000673113 | 262 |
| 46 | 3300005338 | Ga0068868_100152190 | Ga0068868_1001521902 | 262 |
| 47 | 3300005364 | Ga0070673_100117541 | Ga0070673_1001175412 | 262 |
| 48 | 3300005618 | Ga0068864_100231811 | Ga0068864_1002318112 | 262 |
| 49 | 3300006358 | Ga0068871_100162275 | Ga0068871_1001622752 | 262 |
| 50 | 3300009098 | Ga0105245_10001585 | Ga0105245_1000158521 | 262 |
| 51 | 3300011119 | Ga0105246_10141857 | Ga0105246_101418572 | 262 |
| 52 | 3300013297 | Ga0157378_10158618 | Ga0157378_101586182 | 262 |
| 53 | 3300025960 | Ga0207651_10096664 | Ga0207651_100966642 | 262 |
| 54 | 3300026095 | Ga0207676_10236809 | Ga0207676_102368091 | 262 |
| 55 | iso_pu_bacteria | 2508501009 | 2508544073 | 262 |
| 56 | iso_pu_bacteria | 2508501042 | 2508697989 | 262 |
| 57 | iso_pu_bacteria | 2511231028 | 2511398633 | 262 |
| 58 | iso_pu_bacteria | 2513237092 | 2513628069 | 262 |
| 59 | iso_pu_bacteria | 2513237094 | 2513643599 | 262 |
| 60 | iso_pu_bacteria | 2513237095 | 2513648961 | 262 |
| 61 | iso_pu_bacteria | 2513237102 | 2513705940 | 262 |
| 62 | iso_pu_bacteria | 2513237139 | 2513878075 | 262 |
| 63 | iso_pu_bacteria | 2513237161 | 2514012628 | 262 |
| 64 | iso_pu_bacteria | 2515154112 | 2515629423 | 262 |
| 65 | iso_pu_bacteria | 2517093001 | 2517107572 | 262 |
| 66 | iso_pu_bacteria | 2524023205 | 2524439104 | 262 |
| 67 | iso_pu_bacteria | 2528768022 | 2528849645 | 262 |
| 68 | iso_pu_bacteria | 2617270735 | 2617353030 | 262 |
| 69 | iso_pu_bacteria | 2617270741 | 2617378995 | 262 |
| 70 | iso_pu_bacteria | 2744054633 | 2745078783 | 262 |
| 71 | iso_pu_bacteria | 2791355196 | 2793059949 | 262 |
| 72 | iso_pu_bacteria | 2802429603 | 2805920035 | 262 |
| 73 | iso_pu_bacteria | 2816332527 | 2818241635 | 262 |
| 74 | iso_pu_bacteria | 2824600985 | 2824606205 | 262 |
| 75 | iso_pu_bacteria | 2824609381 | 2824609813 | 262 |
| 76 | iso_pu_bacteria | 2824617872 | 2824622756 | 262 |
| 77 | iso_pu_bacteria | 2824626560 | 2824632411 | 262 |
| 78 | iso_pu_bacteria | 2824635225 | 2824640430 | 262 |
| 79 | iso_pu_bacteria | 2824644064 | 2824647419 | 262 |
| 80 | iso_pu_bacteria | 2824653114 | 2824657696 | 262 |
| 81 | iso_pu_bacteria | 2824661429 | 2824668745 | 262 |
| 82 | iso_pu_bacteria | 2824671348 | 2824674297 | 262 |
| 83 | iso_pu_bacteria | 2824679649 | 2824682583 | 262 |
| 84 | iso_pu_bacteria | 2824687955 | 2824690919 | 262 |
| 85 | iso_pu_bacteria | 2824696289 | 2824698505 | 262 |
| 86 | iso_pu_bacteria | 2824704595 | 2824708343 | 262 |
| 87 | iso_pu_bacteria | 2824714736 | 2824721455 | 262 |
| 88 | iso_pu_bacteria | 2824723954 | 2824728690 | 262 |
| 89 | iso_pu_bacteria | 2824732956 | 2824736336 | 262 |
| 90 | iso_pu_bacteria | 2824746037 | 2824750005 | 262 |
| 91 | iso_pu_bacteria | 2824753945 | 2824758948 | 262 |
| 92 | iso_pu_bacteria | 2824763712 | 2824766124 | 262 |
| 93 | iso_pu_bacteria | 2824773399 | 2824778232 | 262 |
| 94 | iso_pu_bacteria | 2838122688 | 2838127486 | 262 |
| 95 | iso_pu_bacteria | 2841941048 | 2841941561 | 262 |
| 96 | iso_pu_bacteria | 2841949485 | 2841952423 | 262 |
| 97 | iso_pu_bacteria | 2841957949 | 2841959442 | 262 |
| 98 | iso_pu_bacteria | 2841966195 | 2841967705 | 262 |
| 99 | iso_pu_bacteria | 2841974524 | 2841982129 | 262 |
| 100 | iso_pu_bacteria | 2841983080 | 2841986447 | 262 |
| 101 | iso_pu_bacteria | 2842038055 | 2842038211 | 262 |
| 102 | iso_pu_bacteria | 2842045827 | 2842048843 | 262 |
| 103 | iso_pu_bacteria | 2844315083 | 2844317693 | 262 |
| 104 | iso_pu_bacteria | 2847930680 | 2847934482 | 262 |
| 105 | iso_pu_bacteria | 2847939898 | 2847945084 | 262 |
| 106 | iso_pu_bacteria | 2849076700 | 2849080730 | 262 |
| 107 | iso_pu_bacteria | 2857509624 | 2857509910 | 262 |
| 108 | iso_pu_bacteria | 2874590934 | 2874593273 | 262 |
| 109 | iso_pu_bacteria | 2874612657 | 2874618183 | 262 |
| 110 | iso_pu_bacteria | 2874620515 | 2874623169 | 262 |
| 111 | iso_pu_bacteria | 2874628541 | 2874636086 | 262 |
| 112 | iso_pu_bacteria | 2874645413 | 2874652952 | 262 |
| 113 | iso_pu_bacteria | 2876771140 | 2876773313 | 262 |
| 114 | iso_pu_bacteria | 2876818435 | 2876821266 | 262 |
| 115 | iso_pu_bacteria | 2879074833 | 2879077229 | 262 |
| 116 | iso_pu_bacteria | 2879083081 | 2879089675 | 262 |
| 117 | iso_pu_bacteria | 2879099564 | 2879107687 | 262 |
| 118 | iso_pu_bacteria | 2879127579 | 2879130214 | 262 |
| 119 | iso_pu_bacteria | 2879142872 | 2879146729 | 262 |
| 120 | iso_pu_bacteria | 2881364244 | 2881365717 | 262 |
| 121 | iso_pu_bacteria | 2881665667 | 2881670928 | 262 |
| 122 | iso_pu_bacteria | 2885366525 | 2885368891 | 262 |
| 123 | iso_pu_bacteria | 2885409591 | 2885410173 | 262 |
| 124 | iso_pu_bacteria | 2888378607 | 2888382414 | 262 |
| 125 | iso_pu_bacteria | 2888388044 | 2888388278 | 262 |
| 126 | iso_pu_bacteria | 2888419890 | 2888423001 | 262 |
| 127 | iso_pu_bacteria | 2903727486 | 2903735373 | 262 |
| 128 | iso_pu_bacteria | 2904666416 | 2904669989 | 262 |
| 129 | iso_pu_bacteria | 2904711408 | 2904718524 | 262 |
| 130 | iso_pu_bacteria | 2906602504 | 2906608708 | 262 |
| 131 | iso_pu_bacteria | 2906626472 | 2906630145 | 262 |
| 132 | iso_pu_bacteria | 2906643746 | 2906646644 | 262 |
| 133 | iso_pu_bacteria | 2908775508 | 2908778666 | 262 |
| 134 | iso_pu_bacteria | 2922368715 | 2922375548 | 262 |
| 135 | iso_pu_bacteria | 2922393267 | 2922394941 | 262 |
| 136 | iso_pu_bacteria | 2929615660 | 2929616284 | 262 |
| 137 | iso_pu_bacteria | 2929624759 | 2929625028 | 262 |
| 138 | iso_pu_bacteria | 2932784394 | 2932787052 | 262 |
| 139 | iso_pu_bacteria | 2932794094 | 2932797279 | 262 |
| 140 | iso_pu_bacteria | 2932801729 | 2932804836 | 262 |
| 141 | iso_pu_bacteria | 2932809354 | 2932811247 | 262 |
| 142 | iso_pu_bacteria | 2932818245 | 2932819880 | 262 |
| 143 | iso_pu_bacteria | 2932828146 | 2932832359 | 262 |
| 144 | iso_pu_bacteria | 2933577622 | 2933578432 | 262 |
| 145 | iso_pu_bacteria | 2935608549 | 2935611024 | 262 |
| 146 | iso_pu_bacteria | 2935616580 | 2935619070 | 262 |
| 147 | iso_pu_bacteria | 2935638405 | 2935643112 | 262 |
| 148 | iso_pu_bacteria | 2935648319 | 2935648455 | 262 |
| 149 | iso_pu_bacteria | 2935656913 | 2935657557 | 262 |
| 150 | iso_pu_bacteria | 2935665750 | 2935669739 | 262 |
| 151 | iso_pu_bacteria | 2935675223 | 2935677121 | 262 |
| 152 | iso_pu_bacteria | 2935684952 | 2935693156 | 262 |
| 153 | iso_pu_bacteria | 2935694250 | 2935695350 | 262 |
| 154 | iso_pu_bacteria | 2935703347 | 2935709541 | 262 |
| 155 | iso_pu_bacteria | 2935713505 | 2935719764 | 262 |
| 156 | iso_pu_bacteria | 2935722832 | 2935729469 | 262 |
| 157 | iso_pu_bacteria | 2935732158 | 2935739647 | 262 |
| 158 | iso_pu_bacteria | 2935741537 | 2935748685 | 262 |
| 159 | iso_pu_bacteria | 2935750917 | 2935756728 | 262 |
| 160 | iso_pu_bacteria | 2935760218 | 2935761287 | 262 |
| 161 | iso_pu_bacteria | 2935769743 | 2935771439 | 262 |
| 162 | iso_pu_bacteria | 2935777560 | 2935779128 | 262 |
| 163 | iso_pu_bacteria | 2935785616 | 2935788332 | 262 |
| 164 | iso_pu_bacteria | 2935793552 | 2935800869 | 262 |
| 165 | iso_pu_bacteria | 2935801545 | 2935807260 | 262 |
| 166 | iso_pu_bacteria | 2935810662 | 2935812399 | 262 |
| 167 | iso_pu_bacteria | 2935819856 | 2935820509 | 262 |
| 168 | iso_pu_bacteria | 2935827899 | 2935832743 | 262 |
| 169 | iso_pu_bacteria | 2935837841 | 2935839177 | 262 |
| 170 | iso_pu_bacteria | 2935847175 | 2935849482 | 262 |
| 171 | iso_pu_bacteria | 2935855204 | 2935857435 | 262 |
| 172 | iso_pu_bacteria | 2935864058 | 2935864965 | 262 |
| 173 | iso_pu_bacteria | 2935873716 | 2935876743 | 262 |
| 174 | iso_pu_bacteria | 2935883170 | 2935884928 | 262 |
| 175 | iso_pu_bacteria | 2935908558 | 2935911744 | 262 |
| 176 | iso_pu_bacteria | 2935916978 | 2935919399 | 262 |
| 177 | iso_pu_bacteria | 2935926038 | 2935928773 | 262 |
| 178 | iso_pu_bacteria | 2935934488 | 2935938418 | 262 |
| 179 | iso_pu_bacteria | 2935942939 | 2935945690 | 262 |
| 180 | iso_pu_bacteria | 2935951376 | 2935954703 | 262 |
| 181 | iso_pu_bacteria | 2935967501 | 2935970590 | 262 |
| 182 | iso_pu_bacteria | 2935975950 | 2935979174 | 262 |
| 183 | iso_pu_bacteria | 2935984226 | 2935987814 | 262 |
| 184 | iso_pu_bacteria | 2935992306 | 2935999644 | 262 |
| 185 | iso_pu_bacteria | 2936002035 | 2936008334 | 262 |
| 186 | iso_pu_bacteria | 2936011229 | 2936011365 | 262 |
| 187 | iso_pu_bacteria | 2936019824 | 2936019960 | 262 |
| 188 | iso_pu_bacteria | 2936028420 | 2936028556 | 262 |
| 189 | iso_pu_bacteria | 2936037263 | 2936038992 | 262 |
| 190 | iso_pu_bacteria | 2936046547 | 2936046683 | 262 |
| 191 | iso_pu_bacteria | 2936055302 | 2936063066 | 262 |
| 192 | iso_pu_bacteria | 2940556831 | 2940562642 | 262 |
| 193 | iso_pu_bacteria | 2941538514 | 2941539867 | 262 |
| 194 | iso_pu_bacteria | 3005483717 | 3005487894 | 262 |
| 195 | iso_pu_bacteria | 3005506211 | 3005508786 | 262 |
| 196 | iso_pu_bacteria | 3005587118 | 3005589400 | 262 |
| 197 | iso_pu_bacteria | 3005594810 | 3005597426 | 262 |
| 198 | iso_pu_bacteria | 3005710791 | 3005713458 | 262 |
| 199 | iso_pu_bacteria | 3005718088 | 3005720868 | 262 |
| 200 | iso_pu_bacteria | 8016511872 | 8016515156 | 262 |
| 201 | iso_pu_bacteria | 8016522445 | 8016522946 | 262 |
| 202 | iso_pu_bacteria | 8016530956 | 8016536407 | 262 |
| 203 | iso_pu_bacteria | 8016539877 | 8016540687 | 262 |
| 204 | iso_pu_bacteria | 8016548790 | 8016552560 | 262 |
| 205 | iso_pu_bacteria | 8016557553 | 8016560936 | 262 |
| 206 | iso_pu_bacteria | 8016566248 | 8016574770 | 262 |
| 207 | iso_pu_bacteria | 8016575299 | 8016578844 | 262 |
| 208 | iso_pu_bacteria | 8016583857 | 8016590792 | 262 |
| 209 | iso_pu_bacteria | 8016595262 | 8016598804 | 262 |
| 210 | iso_pu_bacteria | 8016613128 | 8016621530 | 262 |
| 211 | iso_pu_bacteria | 8016630954 | 8016632630 | 262 |
| 212 | iso_pu_bacteria | 8017057580 | 8017061298 | 262 |
| 213 | iso_pu_bacteria | 8019530166 | 8019536128 | 262 |
| 214 | iso_pu_bacteria | 8019538911 | 8019543343 | 262 |
| 215 | iso_pu_bacteria | 8019547302 | 8019555513 | 262 |
| 216 | iso_pu_bacteria | 8019576017 | 8019580767 | 262 |
| 217 | iso_pu_bacteria | 8019586578 | 8019588500 | 262 |
| 218 | iso_pu_bacteria | 8019597564 | 8019602837 | 262 |
| 219 | iso_pu_bacteria | 8019608314 | 8019615718 | 262 |
| 220 | iso_pu_bacteria | 8019619141 | 8019626466 | 262 |
| 221 | iso_pu_bacteria | 8019659431 | 8019663790 | 262 |
| 222 | iso_pu_bacteria | 8019687851 | 8019688391 | 262 |
| 223 | iso_pu_bacteria | 8055742211 | 8055747930 | 262 |
| 224 | iso_pu_bacteria | 8056967851 | 8056969495 | 262 |
| 225 | 3300011119 | Ga0105246_10096611 | Ga0105246_100966111 | 264 |
| 226 | 3300003215 | JGI25153J46596_10001822 | JGI25153J46596_100018226 | 266 |
| 227 | 3300003215 | JGI25153J46596_10003459 | JGI25153J46596_100034597 | 266 |
| 228 | 3300003215 | JGI25153J46596_10004454 | JGI25153J46596_100044544 | 266 |
| 229 | 3300003215 | JGI25153J46596_10030199 | JGI25153J46596_100301992 | 266 |
| 230 | 3300003354 | JGI25160J50197_1000729 | JGI25160J50197_10007299 | 266 |
| 231 | 3300003354 | JGI25160J50197_1002598 | JGI25160J50197_10025985 | 266 |
| 232 | 3300003762 | Ga0055542_1005244 | Ga0055542_10052443 | 266 |
| 233 | 3300003771 | Ga0055526_1051644 | Ga0055526_10516441 | 266 |
| 234 | 3300003794 | Ga0055531_10004381 | Ga0055531_100043814 | 266 |
| 235 | 3300004625 | Ga0055543_1001967 | Ga0055543_10019674 | 266 |
| 236 | 3300005262 | Ga0065165_1000278 | Ga0065165_100027889 | 266 |
| 237 | 3300005262 | Ga0065165_1005698 | Ga0065165_10056982 | 266 |
| 238 | 3300005262 | Ga0065165_1010190 | Ga0065165_10101903 | 266 |
| 239 | 3300005329 | Ga0070683_100015396 | Ga0070683_1000153967 | 266 |
| 240 | 3300005331 | Ga0070670_100061597 | Ga0070670_1000615973 | 266 |
| 241 | 3300005336 | Ga0070680_100007902 | Ga0070680_1000079027 | 266 |
| 242 | 3300005344 | Ga0070661_100282180 | Ga0070661_1002821802 | 266 |
| 243 | 3300005353 | Ga0070669_100265305 | Ga0070669_1002653052 | 266 |
| 244 | 3300005354 | Ga0070675_100220742 | Ga0070675_1002207422 | 266 |
| 245 | 3300005355 | Ga0070671_100012665 | Ga0070671_1000126655 | 266 |
| 246 | 3300005364 | Ga0070673_100147632 | Ga0070673_1001476322 | 266 |
| 247 | 3300005434 | Ga0070709_10043295 | Ga0070709_100432952 | 266 |
| 248 | 3300005455 | Ga0070663_100301617 | Ga0070663_1003016171 | 266 |
| 249 | 3300005458 | Ga0070681_10018303 | Ga0070681_100183032 | 266 |
| 250 | 3300005535 | Ga0070684_100014665 | Ga0070684_1000146652 | 266 |
| 251 | 3300005539 | Ga0068853_100404795 | Ga0068853_1004047951 | 266 |
| 252 | 3300005577 | Ga0068857_100142520 | Ga0068857_1001425202 | 266 |
| 253 | 3300005577 | Ga0068857_100358954 | Ga0068857_1003589542 | 266 |
| 254 | 3300005614 | Ga0068856_100219740 | Ga0068856_1002197402 | 266 |
| 255 | 3300005616 | Ga0068852_100010094 | Ga0068852_1000100944 | 266 |
| 256 | 3300005841 | Ga0068863_100628002 | Ga0068863_1006280022 | 266 |
| 257 | 3300005844 | Ga0068862_100099684 | Ga0068862_1000996842 | 266 |
| 258 | 3300006042 | Ga0075368_10006951 | Ga0075368_100069513 | 266 |
| 259 | 3300006048 | Ga0075363_100043257 | Ga0075363_1000432572 | 266 |
| 260 | 3300006051 | Ga0075364_10008417 | Ga0075364_100084178 | 266 |
| 261 | 3300006186 | Ga0075369_10030768 | Ga0075369_100307682 | 266 |
| 262 | 3300006186 | Ga0075369_10087434 | Ga0075369_100874342 | 266 |
| 263 | 3300006195 | Ga0075366_10004318 | Ga0075366_100043184 | 266 |
| 264 | 3300006237 | Ga0097621_100307751 | Ga0097621_1003077513 | 266 |
| 265 | 3300006353 | Ga0075370_10009166 | Ga0075370_100091664 | 266 |
| 266 | 3300006941 | Ga0099825_1032376 | Ga0099825_10323763 | 266 |
| 267 | 3300006942 | Ga0099824_1016133 | Ga0099824_10161334 | 266 |
| 268 | 3300006944 | Ga0099823_1044958 | Ga0099823_10449582 | 266 |
| 269 | 3300009011 | Ga0105251_10164062 | Ga0105251_101640622 | 266 |
| 270 | 3300009093 | Ga0105240_10077493 | Ga0105240_100774935 | 266 |
| 271 | 3300009174 | Ga0105241_10023166 | Ga0105241_100231664 | 266 |
| 272 | 3300009174 | Ga0105241_10033535 | Ga0105241_100335352 | 266 |
| 273 | 3300009174 | Ga0105241_10057648 | Ga0105241_100576482 | 266 |
| 274 | 3300009177 | Ga0105248_10012339 | Ga0105248_100123395 | 266 |
| 275 | 3300009545 | Ga0105237_10015754 | Ga0105237_100157545 | 266 |
| 276 | 3300009553 | Ga0105249_10288445 | Ga0105249_102884452 | 266 |
| 277 | 3300010375 | Ga0105239_10052215 | Ga0105239_100522152 | 266 |
| 278 | 3300010375 | Ga0105239_10181027 | Ga0105239_101810272 | 266 |
| 279 | 3300010375 | Ga0105239_10250456 | Ga0105239_102504563 | 266 |
| 280 | 3300013105 | Ga0157369_10078089 | Ga0157369_100780898 | 266 |
| 281 | 3300013296 | Ga0157374_10033415 | Ga0157374_100334152 | 266 |
| 282 | 3300013307 | Ga0157372_10209269 | Ga0157372_102092691 | 266 |
| 283 | 3300014325 | Ga0163163_10017116 | Ga0163163_100171162 | 266 |
| 284 | 3300025230 | Ga0209563_101494 | Ga0209563_1014942 | 266 |
| 285 | 3300025245 | Ga0207425_1017592 | Ga0207425_10175922 | 266 |
| 286 | 3300025253 | Ga0209677_105896 | Ga0209677_1058963 | 266 |
| 287 | 3300025254 | Ga0209148_1000344 | Ga0209148_100034431 | 266 |
| 288 | 3300025261 | Ga0209233_1005823 | Ga0209233_10058233 | 266 |
| 289 | 3300025273 | Ga0209673_1024307 | Ga0209673_10243072 | 266 |
| 290 | 3300025295 | Ga0209564_1002208 | Ga0209564_10022086 | 266 |
| 291 | 3300025297 | Ga0209758_1000407 | Ga0209758_100040729 | 266 |
| 292 | 3300025297 | Ga0209758_1000900 | Ga0209758_100090024 | 266 |
| 293 | 3300025297 | Ga0209758_1000952 | Ga0209758_10009524 | 266 |
| 294 | 3300025297 | Ga0209758_1011752 | Ga0209758_10117526 | 266 |
| 295 | 3300025297 | Ga0209758_1030934 | Ga0209758_10309341 | 266 |
| 296 | 3300025299 | Ga0209256_1019540 | Ga0209256_10195403 | 266 |
| 297 | 3300025302 | Ga0207426_1000466 | Ga0207426_100046639 | 266 |
| 298 | 3300025302 | Ga0207426_1000865 | Ga0207426_100086511 | 266 |
| 299 | 3300025302 | Ga0207426_1003194 | Ga0207426_10031947 | 266 |
| 300 | 3300025302 | Ga0207426_1008651 | Ga0207426_10086513 | 266 |
| 301 | 3300025302 | Ga0207426_1024999 | Ga0207426_10249992 | 266 |
| 302 | 3300025304 | Ga0209257_1001445 | Ga0209257_100144520 | 266 |
| 303 | 3300025315 | Ga0207697_10032884 | Ga0207697_100328842 | 266 |
| 304 | 3300025898 | Ga0207692_10189975 | Ga0207692_101899751 | 266 |
| 305 | 3300025904 | Ga0207647_10008614 | Ga0207647_100086145 | 266 |
| 306 | 3300025908 | Ga0207643_10216684 | Ga0207643_102166841 | 266 |
| 307 | 3300025911 | Ga0207654_10084567 | Ga0207654_100845672 | 266 |
| 308 | 3300025911 | Ga0207654_10170555 | Ga0207654_101705552 | 266 |
| 309 | 3300025912 | Ga0207707_10001119 | Ga0207707_1000111920 | 266 |
| 310 | 3300025912 | Ga0207707_10007981 | Ga0207707_1000798110 | 266 |
| 311 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029140 | 266 |
| 312 | 3300025914 | Ga0207671_10005971 | Ga0207671_100059719 | 266 |
| 313 | 3300025914 | Ga0207671_10048682 | Ga0207671_100486822 | 266 |
| 314 | 3300025914 | Ga0207671_10143580 | Ga0207671_101435802 | 266 |
| 315 | 3300025917 | Ga0207660_10012652 | Ga0207660_100126528 | 266 |
| 316 | 3300025921 | Ga0207652_10010456 | Ga0207652_100104562 | 266 |
| 317 | 3300025925 | Ga0207650_10091560 | Ga0207650_100915602 | 266 |
| 318 | 3300025927 | Ga0207687_10055275 | Ga0207687_100552752 | 266 |
| 319 | 3300025931 | Ga0207644_10086201 | Ga0207644_100862012 | 266 |
| 320 | 3300025933 | Ga0207706_10326521 | Ga0207706_103265212 | 266 |
| 321 | 3300025935 | Ga0207709_10026733 | Ga0207709_100267333 | 266 |
| 322 | 3300025941 | Ga0207711_10212668 | Ga0207711_102126682 | 266 |
| 323 | 3300025944 | Ga0207661_10008392 | Ga0207661_100083929 | 266 |
| 324 | 3300025949 | Ga0207667_10134031 | Ga0207667_101340312 | 266 |
| 325 | 3300025986 | Ga0207658_10576004 | Ga0207658_105760041 | 266 |
| 326 | 3300026035 | Ga0207703_10162839 | Ga0207703_101628392 | 266 |
| 327 | 3300026067 | Ga0207678_10523324 | Ga0207678_105233242 | 266 |
| 328 | 3300026078 | Ga0207702_10734210 | Ga0207702_107342102 | 266 |
| 329 | 3300026116 | Ga0207674_10068547 | Ga0207674_100685473 | 266 |
| 330 | 3300026142 | Ga0207698_10015126 | Ga0207698_100151261 | 266 |
| 331 | 3300027296 | Ga0209389_1000011 | Ga0209389_100001186 | 266 |
| 332 | 3300027296 | Ga0209389_1000025 | Ga0209389_1000025145 | 266 |
| 333 | 3300027357 | Ga0209589_1000066 | Ga0209589_100006694 | 266 |
| 334 | 3300027361 | Ga0209489_100017 | Ga0209489_100017148 | 266 |
| 335 | 3300027361 | Ga0209489_100030 | Ga0209489_10003019 | 266 |
| 336 | 3300027363 | Ga0209700_100027 | Ga0209700_10002786 | 266 |
| 337 | 3300028381 | Ga0268264_10134165 | Ga0268264_101341651 | 266 |
| 338 | 3300030760 | Ga0265762_1034850 | Ga0265762_10348501 | 266 |
| 339 | 3300033180 | Ga0307510_10042405 | Ga0307510_100424052 | 266 |
| 340 | 3300035170 | Ga0373943_0031479 | Ga0373943_0031479_835_1635 | 266 |
| 341 | 3300035171 | Ga0373946_0027185 | Ga0373946_0027185_235_1035 | 266 |
| 342 | 3300035172 | Ga0373955_0019488 | Ga0373955_0019488_2448_3248 | 266 |
| 343 | 3300035725 | Ga0373947_0027207 | Ga0373947_0027207_853_1653 | 266 |
| 344 | 3300037068 | Ga0373925_0052470 | Ga0373925_0052470_1520_2320 | 266 |
| 345 | 3300037471 | Ga0395905_0015966 | Ga0395905_0015966_1075_1881 | 266 |
| 346 | 3300037471 | Ga0395905_0083925 | Ga0395905_0083925_1564_2370 | 266 |
| 347 | 3300038443 | Ga0395901_0093836 | Ga0395901_0093836_1251_2057 | 266 |
| 348 | 3300038443 | Ga0395901_0148346 | Ga0395901_0148346_1513_2319 | 266 |
| 349 | 3300044658 | Ga0466972_0000261 | Ga0466972_0000261_28684_29490 | 266 |
| 350 | 3300044658 | Ga0466972_0008229 | Ga0466972_0008229_3075_3881 | 266 |
| 351 | 3300044684 | Ga0466966_0000211 | Ga0466966_0000211_35248_36054 | 266 |
| 352 | 3300044693 | Ga0466961_0005032 | Ga0466961_0005032_967_1773 | 266 |
| 353 | 3300044693 | Ga0466961_0165283 | Ga0466961_0165283_290_1096 | 266 |
| 354 | 3300044719 | Ga0466971_0037598 | Ga0466971_0037598_84_884 | 266 |
| 355 | 3300044735 | Ga0466968_0001473 | Ga0466968_0001473_5988_6794 | 266 |
| 356 | 3300044765 | Ga0466970_0296155 | Ga0466970_0296155_84_890 | 266 |
| 357 | 3300044842 | Ga0466957_0017412 | Ga0466957_0017412_2494_3294 | 266 |
| 358 | 3300044901 | Ga0466960_0002388 | Ga0466960_0002388_3756_4562 | 266 |
| 359 | 3300045049 | Ga0466959_0011922 | Ga0466959_0011922_3754_4560 | 266 |
| 360 | 3300045049 | Ga0466959_0012080 | Ga0466959_0012080_2813_3613 | 266 |
| 361 | 3300046459 | Ga0495629_0085568 | Ga0495629_0085568_737_1537 | 266 |
| 362 | 3300046459 | Ga0495629_0119612 | Ga0495629_0119612_652_1458 | 266 |
| 363 | 3300046460 | Ga0495638_0009098 | Ga0495638_0009098_2169_2975 | 266 |
| 364 | 3300046463 | Ga0495653_0102683 | Ga0495653_0102683_1182_1988 | 266 |
| 365 | 3300046475 | Ga0495639_0053073 | Ga0495639_0053073_200_1000 | 266 |
| 366 | 3300046476 | Ga0495662_0106921 | Ga0495662_0106921_183_983 | 266 |
| 367 | 3300046477 | Ga0495664_0122796 | Ga0495664_0122796_717_1517 | 266 |
| 368 | 3300046506 | Ga0495583_0025158 | Ga0495583_0025158_252_1058 | 266 |
| 369 | 3300046507 | Ga0495606_0034700 | Ga0495606_0034700_1346_2152 | 266 |
| 370 | 3300046512 | Ga0495610_0039636 | Ga0495610_0039636_591_1397 | 266 |
| 371 | 3300046516 | Ga0495628_0347869 | Ga0495628_0347869_208_1014 | 266 |
| 372 | 3300046524 | Ga0495648_0013331 | Ga0495648_0013331_1193_1999 | 266 |
| 373 | 3300046524 | Ga0495648_0161593 | Ga0495648_0161593_226_1032 | 266 |
| 374 | 3300046529 | Ga0495652_0167152 | Ga0495652_0167152_22_828 | 266 |
| 375 | 3300046529 | Ga0495652_0264297 | Ga0495652_0264297_375_1181 | 266 |
| 376 | 3300046533 | Ga0495640_0038248 | Ga0495640_0038248_2005_2805 | 266 |
| 377 | 3300046533 | Ga0495640_0126489 | Ga0495640_0126489_223_1029 | 266 |
| 378 | 3300046542 | Ga0495597_0029333 | Ga0495597_0029333_1594_2400 | 266 |
| 379 | 3300046557 | Ga0495622_0034064 | Ga0495622_0034064_481_1287 | 266 |
| 380 | 3300046616 | Ga0495668_0198568 | Ga0495668_0198568_141_947 | 266 |
| 381 | 3300046642 | Ga0495634_0057409 | Ga0495634_0057409_1491_2291 | 266 |
| 382 | 3300046642 | Ga0495634_0084852 | Ga0495634_0084852_706_1512 | 266 |
| 383 | 3300046660 | Ga0495625_0011551 | Ga0495625_0011551_4189_4995 | 266 |
| 384 | 3300046660 | Ga0495625_0205447 | Ga0495625_0205447_272_1078 | 266 |
| 385 | 3300046663 | Ga0495635_0002863 | Ga0495635_0002863_9655_10461 | 266 |
| 386 | 3300046663 | Ga0495635_0298433 | Ga0495635_0298433_88_888 | 266 |
| 387 | 3300046675 | Ga0495657_0014067 | Ga0495657_0014067_336_1142 | 266 |
| 388 | 3300046689 | Ga0495613_0070731 | Ga0495613_0070731_462_1268 | 266 |
| 389 | 3300046690 | Ga0495624_0110149 | Ga0495624_0110149_332_1132 | 266 |
| 390 | 3300046694 | Ga0495649_0070668 | Ga0495649_0070668_444_1250 | 266 |
| 391 | 3300046694 | Ga0495649_0116789 | Ga0495649_0116789_177_983 | 266 |
| 392 | 3300046809 | Ga0495600_0111490 | Ga0495600_0111490_440_1246 | 266 |
| 393 | 3300047315 | Ga0495581_0139496 | Ga0495581_0139496_381_1187 | 266 |
| 394 | 3300047315 | Ga0495581_0160633 | Ga0495581_0160633_272_1072 | 266 |
| 395 | 3300047317 | Ga0495604_0045510 | Ga0495604_0045510_51_857 | 266 |
| 396 | 3300047317 | Ga0495604_0134140 | Ga0495604_0134140_278_1078 | 266 |
| 397 | 3300047319 | Ga0495674_0055953 | Ga0495674_0055953_1916_2716 | 266 |
| 398 | 3300047321 | Ga0495676_0158294 | Ga0495676_0158294_658_1458 | 266 |
| 399 | 3300047321 | Ga0495676_0206390 | Ga0495676_0206390_336_1142 | 266 |
| 400 | 3300047443 | Ga0495687_018792 | Ga0495687_018792_783_1589 | 266 |
| 401 | 3300047471 | Ga0495684_0016950 | Ga0495684_0016950_2258_3058 | 266 |
| 402 | 3300047472 | Ga0495686_0044369 | Ga0495686_0044369_1020_1826 | 266 |
| 403 | 3300048905 | Ga0496102_0010378 | Ga0496102_0010378_450_1256 | 266 |
| 404 | 3300048906 | Ga0496103_0020315 | Ga0496103_0020315_687_1493 | 266 |
| 405 | 3300048907 | Ga0496104_0019267 | Ga0496104_0019267_5200_6006 | 266 |
| 406 | 3300048908 | Ga0496105_0063051 | Ga0496105_0063051_1710_2516 | 266 |
| 407 | 3300048911 | Ga0496108_0328005 | Ga0496108_0328005_400_1206 | 266 |
| 408 | 3300048912 | Ga0496109_0257512 | Ga0496109_0257512_732_1538 | 266 |
| 409 | 3300048913 | Ga0496110_0205828 | Ga0496110_0205828_447_1253 | 266 |
| 410 | 3300048915 | Ga0496112_0296889 | Ga0496112_0296889_100_906 | 266 |
| 411 | 3300048916 | Ga0496113_0046252 | Ga0496113_0046252_762_1568 | 266 |
| 412 | 3300048918 | Ga0496115_0074634 | Ga0496115_0074634_926_1732 | 266 |
| 413 | 3300048920 | Ga0496117_0080961 | Ga0496117_0080961_402_1208 | 266 |
| 414 | 3300048922 | Ga0496119_0081115 | Ga0496119_0081115_843_1649 | 266 |
| 415 | 3300048922 | Ga0496119_0174238 | Ga0496119_0174238_80_886 | 266 |
| 416 | 3300048923 | Ga0496120_0010597 | Ga0496120_0010597_2935_3741 | 266 |
| 417 | 3300048924 | Ga0496121_0250475 | Ga0496121_0250475_139_945 | 266 |
| 418 | 3300048926 | Ga0496123_0088746 | Ga0496123_0088746_101_907 | 266 |
| 419 | 3300048927 | Ga0496124_0178147 | Ga0496124_0178147_93_899 | 266 |
| 420 | 3300048927 | Ga0496124_0301428 | Ga0496124_0301428_244_1050 | 266 |
| 421 | 3300048928 | Ga0496125_0096219 | Ga0496125_0096219_940_1746 | 266 |
| 422 | 3300048929 | Ga0496126_0172539 | Ga0496126_0172539_308_1114 | 266 |
| 423 | 3300049460 | Ga0495682_0031543 | Ga0495682_0031543_494_1300 | 266 |
| 424 | 3300050490 | nmdc:mga03n38_6610_c1 | nmdc:mga03n38_6610_c1_1791_2597 | 266 |
| 425 | 3300050491 | nmdc:mga00v17_173408_c1 | nmdc:mga00v17_173408_c1_427_1233 | 266 |
| 426 | 3300050491 | nmdc:mga00v17_35992_c1 | nmdc:mga00v17_35992_c1_1908_2714 | 266 |
| 427 | 3300050492 | nmdc:mga0yw44_73169_c1 | nmdc:mga0yw44_73169_c1_592_1398 | 266 |
| 428 | 3300050493 | nmdc:mga0k408_5049_c1 | nmdc:mga0k408_5049_c1_3852_4658 | 266 |
| 429 | 3300050494 | nmdc:mga06z11_102459_c1 | nmdc:mga06z11_102459_c1_176_982 | 266 |
| 430 | 3300050495 | nmdc:mga04h51_36793_c1 | nmdc:mga04h51_36793_c1_489_1295 | 266 |
| 431 | 3300050496 | nmdc:mga07m45_105346_c1 | nmdc:mga07m45_105346_c1_201_1007 | 266 |
| 432 | 3300050496 | nmdc:mga07m45_75185_c1 | nmdc:mga07m45_75185_c1_528_1334 | 266 |
| 433 | 3300050516 | nmdc:mga0sz30_1122_c1 | nmdc:mga0sz30_1122_c1_7816_8622 | 266 |
| 434 | 3300050516 | nmdc:mga0sz30_68994_c2 | nmdc:mga0sz30_68994_c2_65_871 | 266 |
| 435 | 3300053077 | Ga0495601_0115025 | Ga0495601_0115025_489_1289 | 266 |
| 436 | 3300053085 | Ga0495619_0169023 | Ga0495619_0169023_391_1197 | 266 |
| 437 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_133409_134215 | 266 |
| 438 | 3300053091 | Ga0500647_0166196 | Ga0500647_0166196_20_826 | 266 |
| 439 | 3300053093 | Ga0500651_0044361 | Ga0500651_0044361_1848_2654 | 266 |
| 440 | 3300053094 | Ga0500566_0001353 | Ga0500566_0001353_12808_13614 | 266 |
| 441 | 3300053104 | Ga0500556_0027156 | Ga0500556_0027156_432_1238 | 266 |
| 442 | 3300053105 | Ga0500557_000149 | Ga0500557_000149_14590_15396 | 266 |
| 443 | 3300053108 | Ga0500562_005797 | Ga0500562_005797_1202_2008 | 266 |
| 444 | 3300053109 | Ga0500569_021894 | Ga0500569_021894_832_1638 | 266 |
| 445 | 3300053119 | Ga0500595_030868 | Ga0500595_030868_730_1536 | 266 |
| 446 | 3300053120 | Ga0500597_142710 | Ga0500597_142710_120_926 | 266 |
| 447 | 3300053121 | Ga0500607_012439 | Ga0500607_012439_2809_3615 | 266 |
| 448 | 3300053122 | Ga0500608_057597 | Ga0500608_057597_332_1138 | 266 |
| 449 | 3300053125 | Ga0500618_027048 | Ga0500618_027048_250_1056 | 266 |
| 450 | 3300053126 | Ga0500621_054857 | Ga0500621_054857_410_1216 | 266 |
| 451 | 3300053130 | Ga0500642_0000063 | Ga0500642_0000063_47545_48351 | 266 |
| 452 | 3300053130 | Ga0500642_0004724 | Ga0500642_0004724_162_968 | 266 |
| 453 | 3300053131 | Ga0500652_062106 | Ga0500652_062106_547_1353 | 266 |
| 454 | 3300053133 | Ga0500655_009335 | Ga0500655_009335_765_1571 | 266 |
| 455 | 3300053136 | Ga0500559_0043444 | Ga0500559_0043444_608_1414 | 266 |
| 456 | 3300053136 | Ga0500559_0053205 | Ga0500559_0053205_943_1749 | 266 |
| 457 | 3300053146 | Ga0500588_0021225 | Ga0500588_0021225_404_1210 | 266 |
| 458 | 3300053148 | Ga0500590_110155 | Ga0500590_110155_245_1051 | 266 |
| 459 | 3300053153 | Ga0500616_0062461 | Ga0500616_0062461_830_1636 | 266 |
| 460 | 3300053156 | Ga0500622_0008022 | Ga0500622_0008022_785_1591 | 266 |
| 461 | 3300053161 | Ga0500634_0089276 | Ga0500634_0089276_250_1056 | 266 |
| 462 | 3300053162 | Ga0500638_008408 | Ga0500638_008408_1700_2506 | 266 |
| 463 | 3300053177 | Ga0500636_0000194 | Ga0500636_0000194_9869_10675 | 266 |
| 464 | 3300053722 | Ga0500649_129715 | Ga0500649_129715_46_852 | 266 |
| 465 | 3300053729 | Ga0500625_003068 | Ga0500625_003068_4864_5670 | 266 |
| 466 | 3300053730 | Ga0500645_024565 | Ga0500645_024565_110_916 | 266 |
| 467 | 3300053731 | Ga0500609_000571 | Ga0500609_000571_789_1595 | 266 |
| 468 | iso_pu_bacteria | 2791355199 | 2793078717 | 266 |
| 469 | iso_pu_bacteria | 2885383462 | 2885391157 | 266 |
| 470 | iso_pu_bacteria | 2904690495 | 2904697020 | 266 |
| 471 | iso_pu_bacteria | 2904699407 | 2904700482 | 266 |
| 472 | iso_pu_bacteria | 2908756301 | 2908762712 | 266 |
| 473 | iso_pu_bacteria | 2935959822 | 2935963304 | 266 |
| 474 | iso_pu_bacteria | 8006933436 | 8006938892 | 266 |
| 475 | iso_pu_bacteria | 8006973647 | 8006978662 | 266 |
| 476 | iso_pu_bacteria | 8006984368 | 8006984799 | 266 |
| 477 | iso_pu_bacteria | 8056689827 | 8056695065 | 266 |
| 478 | 3300005434 | Ga0070709_10066265 | Ga0070709_100662652 | 267 |
| 479 | 3300005437 | Ga0070710_10128048 | Ga0070710_101280483 | 267 |
| 480 | 3300005439 | Ga0070711_100043044 | Ga0070711_1000430443 | 267 |
| 481 | 3300006175 | Ga0070712_100040008 | Ga0070712_1000400082 | 267 |
| 482 | 3300009174 | Ga0105241_10499596 | Ga0105241_104995961 | 267 |
| 483 | 3300013104 | Ga0157370_10095939 | Ga0157370_100959391 | 267 |
| 484 | 3300025898 | Ga0207692_10027670 | Ga0207692_100276702 | 267 |
| 485 | 3300025913 | Ga0207695_10275109 | Ga0207695_102751091 | 267 |
| 486 | 3300025916 | Ga0207663_10303285 | Ga0207663_103032851 | 267 |
| 487 | 3300025928 | Ga0207700_10007250 | Ga0207700_100072507 | 267 |
| 488 | 3300026116 | Ga0207674_10371185 | Ga0207674_103711852 | 267 |
| 489 | 3300031711 | Ga0265314_10071779 | Ga0265314_100717793 | 267 |
| 490 | 3300031712 | Ga0265342_10021560 | Ga0265342_100215606 | 267 |
| 491 | 3300048917 | Ga0496114_0353741 | Ga0496114_0353741_172_990 | 267 |
| 492 | 3300048918 | Ga0496115_0147902 | Ga0496115_0147902_354_1172 | 267 |
| 493 | 3300005434 | Ga0070709_10336632 | Ga0070709_103366321 | 268 |
| 494 | 3300005436 | Ga0070713_100003997 | Ga0070713_1000039975 | 268 |
| 495 | 3300005437 | Ga0070710_10003009 | Ga0070710_100030092 | 268 |
| 496 | 3300005458 | Ga0070681_10039237 | Ga0070681_100392373 | 268 |
| 497 | 3300006028 | Ga0070717_10007297 | Ga0070717_100072979 | 268 |
| 498 | 3300006038 | Ga0075365_10161387 | Ga0075365_101613872 | 268 |
| 499 | 3300006178 | Ga0075367_10049439 | Ga0075367_100494393 | 268 |
| 500 | 3300006195 | Ga0075366_10063342 | Ga0075366_100633421 | 268 |
| 501 | 3300006353 | Ga0075370_10025933 | Ga0075370_100259333 | 268 |
| 502 | 3300009174 | Ga0105241_10375328 | Ga0105241_103753281 | 268 |
| 503 | 3300025898 | Ga0207692_10140739 | Ga0207692_101407391 | 268 |
| 504 | 3300025906 | Ga0207699_10064756 | Ga0207699_100647562 | 268 |
| 505 | 3300025912 | Ga0207707_10220119 | Ga0207707_102201191 | 268 |
| 506 | 3300025912 | Ga0207707_10234549 | Ga0207707_102345492 | 268 |
| 507 | 3300025917 | Ga0207660_10334749 | Ga0207660_103347491 | 268 |
| 508 | 3300025928 | Ga0207700_10022832 | Ga0207700_100228322 | 268 |
| 509 | 3300025929 | Ga0207664_10204060 | Ga0207664_102040602 | 268 |
| 510 | 3300027512 | Ga0209179_1006560 | Ga0209179_10065602 | 268 |
| 511 | 3300035113 | Ga0373936_0120468 | Ga0373936_0120468_146_952 | 268 |
| 512 | 3300035120 | Ga0373957_0051449 | Ga0373957_0051449_480_1286 | 268 |
| 513 | 3300035410 | Ga0373924_0069072 | Ga0373924_0069072_166_972 | 268 |
| 514 | 3300038443 | Ga0395901_0071278 | Ga0395901_0071278_2527_3339 | 268 |
| 515 | 3300039447 | Ga0436361_1211699 | Ga0436361_1211699_1085_1891 | 268 |
| 516 | 3300044694 | Ga0466963_0221714 | Ga0466963_0221714_417_1223 | 268 |
| 517 | 3300046473 | Ga0495582_0145047 | Ga0495582_0145047_231_1037 | 268 |
| 518 | 3300046514 | Ga0495618_0018261 | Ga0495618_0018261_2750_3556 | 268 |
| 519 | 3300046559 | Ga0495667_0296516 | Ga0495667_0296516_166_972 | 268 |
| 520 | 3300048914 | Ga0496111_0538468 | Ga0496111_0538468_35_841 | 268 |
| 521 | 3300048924 | Ga0496121_0389356 | Ga0496121_0389356_91_903 | 268 |
| 522 | 3300050492 | nmdc:mga0yw44_363580_c1 | nmdc:mga0yw44_363580_c1_103_927 | 268 |
| 523 | 3300050493 | nmdc:mga0k408_73421_c1 | nmdc:mga0k408_73421_c1_411_1223 | 268 |
| 524 | 3300050496 | nmdc:mga07m45_29462_c1 | nmdc:mga07m45_29462_c1_1180_1992 | 268 |
| 525 | iso_pu_bacteria | 2876761206 | 2876766733 | 268 |
| 526 | 3300005455 | Ga0070663_100033372 | Ga0070663_1000333725 | 269 |
| 527 | 3300005536 | Ga0070697_100468120 | Ga0070697_1004681202 | 269 |
| 528 | 3300005539 | Ga0068853_100047034 | Ga0068853_1000470344 | 269 |
| 529 | 3300005983 | Ga0081540_1003613 | Ga0081540_10036137 | 269 |
| 530 | 3300025910 | Ga0207684_10200944 | Ga0207684_102009442 | 269 |
| 531 | 3300025928 | Ga0207700_10511229 | Ga0207700_105112291 | 269 |
| 532 | 3300048913 | Ga0496110_0021826 | Ga0496110_0021826_3562_4395 | 269 |
| 533 | 3300048915 | Ga0496112_0062188 | Ga0496112_0062188_685_1494 | 269 |
| 534 | 3300050513 | nmdc:mga0rr50_340956_c1 | nmdc:mga0rr50_340956_c1_180_1013 | 269 |
| 535 | 3300053095 | Ga0500640_002668 | Ga0500640_002668_4887_5744 | 269 |
| 536 | 3300053113 | Ga0500580_050558 | Ga0500580_050558_175_1032 | 269 |
| 537 | 3300053115 | Ga0500591_089605 | Ga0500591_089605_91_948 | 269 |
| 538 | 3300053122 | Ga0500608_005278 | Ga0500608_005278_1513_2370 | 269 |
| 539 | 3300053123 | Ga0500614_006096 | Ga0500614_006096_242_1099 | 269 |
| 540 | 3300053159 | Ga0500630_004105 | Ga0500630_004105_217_1074 | 269 |
| 541 | 3300053163 | Ga0500639_000007 | Ga0500639_000007_151252_152109 | 269 |
| 542 | 3300053735 | Ga0500596_000834 | Ga0500596_000834_5005_5862 | 269 |
| 543 | iso_pu_bacteria | 2906610324 | 2906616313 | 269 |
| 544 | iso_pu_bacteria | 2922361189 | 2922361365 | 269 |
| 545 | iso_pu_bacteria | 2922425934 | 2922431689 | 269 |
| 546 | iso_pu_bacteria | 8006926726 | 8006928755 | 269 |
| 547 | iso_pu_bacteria | 8019555841 | 8019565088 | 269 |
| 548 | 3300003911 | JGI25405J52794_10035098 | JGI25405J52794_100350981 | 270 |
| 549 | 3300005338 | Ga0068868_100004886 | Ga0068868_1000048864 | 270 |
| 550 | 3300005339 | Ga0070660_100388847 | Ga0070660_1003888471 | 270 |
| 551 | 3300005347 | Ga0070668_100148632 | Ga0070668_1001486322 | 270 |
| 552 | 3300005455 | Ga0070663_100067025 | Ga0070663_1000670252 | 270 |
| 553 | 3300005457 | Ga0070662_100097867 | Ga0070662_1000978671 | 270 |
| 554 | 3300005563 | Ga0068855_100017763 | Ga0068855_1000177635 | 270 |
| 555 | 3300005564 | Ga0070664_100063775 | Ga0070664_1000637753 | 270 |
| 556 | 3300005577 | Ga0068857_100404836 | Ga0068857_1004048362 | 270 |
| 557 | 3300005615 | Ga0070702_100094805 | Ga0070702_1000948051 | 270 |
| 558 | 3300005618 | Ga0068864_100141029 | Ga0068864_1001410292 | 270 |
| 559 | 3300005719 | Ga0068861_100109478 | Ga0068861_1001094784 | 270 |
| 560 | 3300005844 | Ga0068862_100052050 | Ga0068862_1000520503 | 270 |
| 561 | 3300005937 | Ga0081455_10042189 | Ga0081455_100421895 | 270 |
| 562 | 3300006028 | Ga0070717_10142595 | Ga0070717_101425952 | 270 |
| 563 | 3300006163 | Ga0070715_10000729 | Ga0070715_100007298 | 270 |
| 564 | 3300006175 | Ga0070712_100027427 | Ga0070712_1000274273 | 270 |
| 565 | 3300006178 | Ga0075367_10077069 | Ga0075367_100770692 | 270 |
| 566 | 3300006195 | Ga0075366_10067000 | Ga0075366_100670002 | 270 |
| 567 | 3300006237 | Ga0097621_100016142 | Ga0097621_1000161424 | 270 |
| 568 | 3300006353 | Ga0075370_10041524 | Ga0075370_100415242 | 270 |
| 569 | 3300009098 | Ga0105245_10004121 | Ga0105245_100041219 | 270 |
| 570 | 3300009148 | Ga0105243_10650653 | Ga0105243_106506532 | 270 |
| 571 | 3300009177 | Ga0105248_10004940 | Ga0105248_100049409 | 270 |
| 572 | 3300009545 | Ga0105237_10430259 | Ga0105237_104302592 | 270 |
| 573 | 3300011119 | Ga0105246_10001515 | Ga0105246_100015154 | 270 |
| 574 | 3300011119 | Ga0105246_10172710 | Ga0105246_101727102 | 270 |
| 575 | 3300013296 | Ga0157374_10266386 | Ga0157374_102663862 | 270 |
| 576 | 3300013306 | Ga0163162_10219951 | Ga0163162_102199514 | 270 |
| 577 | 3300025315 | Ga0207697_10060508 | Ga0207697_100605081 | 270 |
| 578 | 3300025898 | Ga0207692_10000318 | Ga0207692_1000031815 | 270 |
| 579 | 3300025900 | Ga0207710_10130873 | Ga0207710_101308731 | 270 |
| 580 | 3300025905 | Ga0207685_10001710 | Ga0207685_100017104 | 270 |
| 581 | 3300025905 | Ga0207685_10049864 | Ga0207685_100498642 | 270 |
| 582 | 3300025906 | Ga0207699_10021869 | Ga0207699_100218692 | 270 |
| 583 | 3300025911 | Ga0207654_10001150 | Ga0207654_100011509 | 270 |
| 584 | 3300025915 | Ga0207693_10027725 | Ga0207693_100277255 | 270 |
| 585 | 3300025916 | Ga0207663_10002625 | Ga0207663_100026256 | 270 |
| 586 | 3300025919 | Ga0207657_10250543 | Ga0207657_102505432 | 270 |
| 587 | 3300025933 | Ga0207706_10125734 | Ga0207706_101257341 | 270 |
| 588 | 3300025939 | Ga0207665_10000311 | Ga0207665_100003119 | 270 |
| 589 | 3300025941 | Ga0207711_10224952 | Ga0207711_102249523 | 270 |
| 590 | 3300025942 | Ga0207689_10014007 | Ga0207689_100140074 | 270 |
| 591 | 3300025945 | Ga0207679_10034372 | Ga0207679_100343723 | 270 |
| 592 | 3300025972 | Ga0207668_10139792 | Ga0207668_101397921 | 270 |
| 593 | 3300025986 | Ga0207658_10030261 | Ga0207658_100302615 | 270 |
| 594 | 3300026023 | Ga0207677_10013899 | Ga0207677_100138994 | 270 |
| 595 | 3300026067 | Ga0207678_10042504 | Ga0207678_100425042 | 270 |
| 596 | 3300026118 | Ga0207675_100154789 | Ga0207675_1001547892 | 270 |
| 597 | 3300026142 | Ga0207698_10459006 | Ga0207698_104590061 | 270 |
| 598 | 3300031730 | Ga0307516_10062981 | Ga0307516_100629813 | 270 |
| 599 | 3300039450 | Ga0436363_0232520 | Ga0436363_0232520_2107_2976 | 270 |
| 600 | 3300044684 | Ga0466966_0205536 | Ga0466966_0205536_29_862 | 270 |
| 601 | 3300048907 | Ga0496104_0543750 | Ga0496104_0543750_158_976 | 270 |
| 602 | 3300048909 | Ga0496106_0017841 | Ga0496106_0017841_226_1044 | 270 |
| 603 | 3300048912 | Ga0496109_0387527 | Ga0496109_0387527_210_1028 | 270 |
| 604 | 3300048915 | Ga0496112_0388751 | Ga0496112_0388751_13_831 | 270 |
| 605 | 3300048924 | Ga0496121_0055828 | Ga0496121_0055828_573_1385 | 270 |
| 606 | 3300049459 | Ga0495678_092178 | Ga0495678_092178_68_883 | 270 |
| 607 | 3300049587 | Ga0501071_0200210 | Ga0501071_0200210_608_1426 | 270 |
| 608 | 3300049592 | Ga0501076_0176722 | Ga0501076_0176722_590_1408 | 270 |
| 609 | 3300050496 | nmdc:mga07m45_189268_c1 | nmdc:mga07m45_189268_c1_90_908 | 270 |
| 610 | 3300053151 | Ga0500604_0027833 | Ga0500604_0027833_122_937 | 270 |
| 611 | 3300060353 | Ga0501082_0258657 | Ga0501082_0258657_96_914 | 270 |
| 612 | 3300003659 | JGI25404J52841_10009491 | JGI25404J52841_100094914 | 271 |
| 613 | 3300005983 | Ga0081540_1001897 | Ga0081540_10018973 | 271 |
| 614 | 3300035724 | Ga0373933_0037509 | Ga0373933_0037509_1001_1816 | 271 |
| 615 | 3300036401 | Ga0373937_0503138 | Ga0373937_0503138_223_1068 | 271 |
| 616 | 3300046533 | Ga0495640_0014622 | Ga0495640_0014622_5097_5912 | 271 |
| 617 | 3300046559 | Ga0495667_0010331 | Ga0495667_0010331_3523_4338 | 271 |
| 618 | 3300047471 | Ga0495684_0049442 | Ga0495684_0049442_799_1614 | 271 |
| 619 | 3300047673 | Ga0495593_0049272 | Ga0495593_0049272_709_1524 | 271 |
| 620 | 3300053094 | Ga0500566_0007323 | Ga0500566_0007323_3781_4596 | 271 |
| 621 | 3300053102 | Ga0500554_030255 | Ga0500554_030255_251_1066 | 271 |
| 622 | 3300053119 | Ga0500595_000651 | Ga0500595_000651_5326_6141 | 271 |
| 623 | 3300053178 | Ga0500637_0000502 | Ga0500637_0000502_11315_12130 | 271 |
| 624 | 3300055283 | Ga0500661_000333 | Ga0500661_000333_1120_1935 | 271 |
| 625 | iso_pu_bacteria | 8019678201 | 8019679798 | 271 |
| 626 | 3300003203 | JGI25406J46586_10001591 | JGI25406J46586_100015913 | 272 |
| 627 | 3300003203 | JGI25406J46586_10003138 | JGI25406J46586_100031386 | 272 |
| 628 | 3300005336 | Ga0070680_100011830 | Ga0070680_1000118303 | 272 |
| 629 | 3300005339 | Ga0070660_100099635 | Ga0070660_1000996352 | 272 |
| 630 | 3300005458 | Ga0070681_10221653 | Ga0070681_102216533 | 272 |
| 631 | 3300005471 | Ga0070698_100013516 | Ga0070698_10001351611 | 272 |
| 632 | 3300005535 | Ga0070684_100191857 | Ga0070684_1001918572 | 272 |
| 633 | 3300005539 | Ga0068853_100132298 | Ga0068853_1001322983 | 272 |
| 634 | 3300005539 | Ga0068853_100262303 | Ga0068853_1002623032 | 272 |
| 635 | 3300005563 | Ga0068855_100031717 | Ga0068855_1000317173 | 272 |
| 636 | 3300005577 | Ga0068857_100176731 | Ga0068857_1001767312 | 272 |
| 637 | 3300005616 | Ga0068852_100524486 | Ga0068852_1005244862 | 272 |
| 638 | 3300005937 | Ga0081455_10042301 | Ga0081455_100423015 | 272 |
| 639 | 3300005985 | Ga0081539_10000945 | Ga0081539_1000094521 | 272 |
| 640 | 3300006028 | Ga0070717_10019413 | Ga0070717_100194132 | 272 |
| 641 | 3300006038 | Ga0075365_10008873 | Ga0075365_100088733 | 272 |
| 642 | 3300006051 | Ga0075364_10007096 | Ga0075364_100070963 | 272 |
| 643 | 3300006177 | Ga0075362_10014038 | Ga0075362_100140381 | 272 |
| 644 | 3300006178 | Ga0075367_10008803 | Ga0075367_100088033 | 272 |
| 645 | 3300006871 | Ga0075434_100205515 | Ga0075434_1002055152 | 272 |
| 646 | 3300009093 | Ga0105240_10031852 | Ga0105240_100318526 | 272 |
| 647 | 3300009093 | Ga0105240_10125673 | Ga0105240_101256732 | 272 |
| 648 | 3300009545 | Ga0105237_10014161 | Ga0105237_100141618 | 272 |
| 649 | 3300010375 | Ga0105239_10192370 | Ga0105239_101923701 | 272 |
| 650 | 3300013104 | Ga0157370_10013630 | Ga0157370_100136307 | 272 |
| 651 | 3300013104 | Ga0157370_10083372 | Ga0157370_100833724 | 272 |
| 652 | 3300013105 | Ga0157369_10026130 | Ga0157369_100261302 | 272 |
| 653 | 3300025910 | Ga0207684_10037545 | Ga0207684_100375456 | 272 |
| 654 | 3300025912 | Ga0207707_10003222 | Ga0207707_1000322213 | 272 |
| 655 | 3300025913 | Ga0207695_10063666 | Ga0207695_100636663 | 272 |
| 656 | 3300025913 | Ga0207695_10074630 | Ga0207695_100746301 | 272 |
| 657 | 3300025914 | Ga0207671_10164947 | Ga0207671_101649472 | 272 |
| 658 | 3300025917 | Ga0207660_10038528 | Ga0207660_100385283 | 272 |
| 659 | 3300025917 | Ga0207660_10084511 | Ga0207660_100845111 | 272 |
| 660 | 3300025919 | Ga0207657_10064333 | Ga0207657_100643332 | 272 |
| 661 | 3300025921 | Ga0207652_10008142 | Ga0207652_100081425 | 272 |
| 662 | 3300025921 | Ga0207652_10026854 | Ga0207652_100268543 | 272 |
| 663 | 3300025924 | Ga0207694_10221557 | Ga0207694_102215571 | 272 |
| 664 | 3300025932 | Ga0207690_10531007 | Ga0207690_105310071 | 272 |
| 665 | 3300025949 | Ga0207667_10037454 | Ga0207667_100374542 | 272 |
| 666 | 3300026041 | Ga0207639_10456198 | Ga0207639_104561981 | 272 |
| 667 | 3300026116 | Ga0207674_10056763 | Ga0207674_100567632 | 272 |
| 668 | 3300027671 | Ga0209588_1002751 | Ga0209588_10027518 | 272 |
| 669 | 3300033544 | Ga0316215_1000880 | Ga0316215_10008804 | 272 |
| 670 | 3300035089 | Ga0373944_0048648 | Ga0373944_0048648_309_1130 | 272 |
| 671 | 3300035113 | Ga0373936_0108395 | Ga0373936_0108395_168_986 | 272 |
| 672 | 3300035116 | Ga0373945_0064938 | Ga0373945_0064938_430_1248 | 272 |
| 673 | 3300035170 | Ga0373943_0005471 | Ga0373943_0005471_4807_5625 | 272 |
| 674 | 3300035172 | Ga0373955_0009368 | Ga0373955_0009368_2479_3297 | 272 |
| 675 | 3300035692 | Ga0373935_0010393 | Ga0373935_0010393_852_1670 | 272 |
| 676 | 3300035695 | Ga0373927_0000515 | Ga0373927_0000515_19262_20080 | 272 |
| 677 | 3300035725 | Ga0373947_0011552 | Ga0373947_0011552_2293_3111 | 272 |
| 678 | 3300037068 | Ga0373925_0001116 | Ga0373925_0001116_8048_8866 | 272 |
| 679 | 3300046454 | Ga0495592_0032474 | Ga0495592_0032474_1923_2741 | 272 |
| 680 | 3300046455 | Ga0495603_0000156 | Ga0495603_0000156_5292_6110 | 272 |
| 681 | 3300046459 | Ga0495629_0000297 | Ga0495629_0000297_39883_40701 | 272 |
| 682 | 3300046461 | Ga0495641_0003323 | Ga0495641_0003323_7366_8184 | 272 |
| 683 | 3300046462 | Ga0495651_0205242 | Ga0495651_0205242_49_867 | 272 |
| 684 | 3300046472 | Ga0495580_0004927 | Ga0495580_0004927_1201_2019 | 272 |
| 685 | 3300046473 | Ga0495582_0000087 | Ga0495582_0000087_6827_7645 | 272 |
| 686 | 3300046475 | Ga0495639_0003735 | Ga0495639_0003735_4784_5602 | 272 |
| 687 | 3300046476 | Ga0495662_0001853 | Ga0495662_0001853_4511_5329 | 272 |
| 688 | 3300046477 | Ga0495664_0036389 | Ga0495664_0036389_661_1479 | 272 |
| 689 | 3300046499 | Ga0495594_0000722 | Ga0495594_0000722_11465_12283 | 272 |
| 690 | 3300046514 | Ga0495618_0077691 | Ga0495618_0077691_264_1082 | 272 |
| 691 | 3300046516 | Ga0495628_0061710 | Ga0495628_0061710_715_1533 | 272 |
| 692 | 3300046517 | Ga0495630_0004575 | Ga0495630_0004575_4632_5450 | 272 |
| 693 | 3300046529 | Ga0495652_0048579 | Ga0495652_0048579_1276_2094 | 272 |
| 694 | 3300046531 | Ga0495665_0000117 | Ga0495665_0000117_9463_10281 | 272 |
| 695 | 3300046535 | Ga0495586_0208382 | Ga0495586_0208382_181_999 | 272 |
| 696 | 3300046559 | Ga0495667_0292051 | Ga0495667_0292051_76_894 | 272 |
| 697 | 3300046642 | Ga0495634_0005647 | Ga0495634_0005647_4102_4920 | 272 |
| 698 | 3300046648 | Ga0495611_0120783 | Ga0495611_0120783_349_1167 | 272 |
| 699 | 3300046663 | Ga0495635_0007694 | Ga0495635_0007694_3163_3981 | 272 |
| 700 | 3300046680 | Ga0495646_0019514 | Ga0495646_0019514_1896_2714 | 272 |
| 701 | 3300046681 | Ga0495647_0000849 | Ga0495647_0000849_4115_4933 | 272 |
| 702 | 3300046683 | Ga0495658_0000331 | Ga0495658_0000331_1019_1837 | 272 |
| 703 | 3300046689 | Ga0495613_0008600 | Ga0495613_0008600_5683_6501 | 272 |
| 704 | 3300046690 | Ga0495624_0001012 | Ga0495624_0001012_8191_9009 | 272 |
| 705 | 3300047315 | Ga0495581_0000543 | Ga0495581_0000543_4431_5249 | 272 |
| 706 | 3300047319 | Ga0495674_0000177 | Ga0495674_0000177_39891_40709 | 272 |
| 707 | 3300047321 | Ga0495676_0052488 | Ga0495676_0052488_1144_1962 | 272 |
| 708 | 3300047469 | Ga0495673_0007095 | Ga0495673_0007095_124_942 | 272 |
| 709 | 3300047471 | Ga0495684_0015566 | Ga0495684_0015566_2656_3474 | 272 |
| 710 | 3300047673 | Ga0495593_0000156 | Ga0495593_0000156_5384_6202 | 272 |
| 711 | 3300048089 | Ga0495614_0086117 | Ga0495614_0086117_211_1029 | 272 |
| 712 | 3300050489 | nmdc:mga03683_55123_c1 | nmdc:mga03683_55123_c1_107_925 | 272 |
| 713 | 3300050490 | nmdc:mga03n38_152974_c1 | nmdc:mga03n38_152974_c1_171_989 | 272 |
| 714 | 3300050492 | nmdc:mga0yw44_34705_c1 | nmdc:mga0yw44_34705_c1_604_1422 | 272 |
| 715 | 3300050494 | nmdc:mga06z11_10611_c1 | nmdc:mga06z11_10611_c1_3006_3824 | 272 |
| 716 | 3300050512 | nmdc:mga0n895_220181_c1 | nmdc:mga0n895_220181_c1_840_1658 | 272 |
| 717 | 3300053077 | Ga0495601_0140802 | Ga0495601_0140802_170_988 | 272 |
| 718 | 3300053085 | Ga0495619_0264354 | Ga0495619_0264354_270_1088 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar