F477175

General Info

Members Datasets Scaffolds Average Seq Length
718 629 1436 281

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10009463|Ga0307515_1000946312
Length 295
Sequence MMQQDSVSEGIVPSGPAGSRHAFVTLVTNGDYAIGATALARSIKMTGTEADIVVLHTGGVKQELLNPLAECGCRLVATDLLPLSDGFNERHARKNIHGAAPFTKGRKPDFHSPLDNFCKLRLWQLTEYERCIFIDADALVLKNIDRYFAYPEFSAAPNVYESLADFHRLNSGVFVATPSLQTFEAMLERLDAPDAFWPRTDQTFLQNFFPDWHGLPVTMNMLQYVWFNMPALWDWSSIGVLHYQYEKPWEKDHPKAERLRPLINLWHAFLTGENIPDIADLPHPSLQNLSLPTPG

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
40 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
41 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
42 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
50 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
51 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
52 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
53 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
54 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
91 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
99 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
100 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
101 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
102 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
103 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
170 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
178 2509276019 Ensifer aridi TW10 Isolate Nodule
179 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
180 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
181 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
182 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
183 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
184 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
185 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
186 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
187 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
188 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
189 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
190 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
191 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
192 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
193 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
194 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
195 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
196 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
197 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
198 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
199 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
200 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
201 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
202 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
203 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
204 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
205 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
206 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
207 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
208 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
209 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
210 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
211 2516143018 Ensifer sp. BR816 Isolate Nodule
212 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
213 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
214 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
215 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
216 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
217 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
218 2519899620 Rhizobium sp. Pop5 Isolate Nodule
219 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
220 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
221 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
222 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
223 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
224 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
225 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
226 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
227 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
228 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
229 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
230 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
231 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
232 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
233 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
234 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
235 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
236 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
237 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
238 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
239 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
240 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
241 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
242 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
243 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
244 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
245 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
246 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
247 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
248 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
249 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
250 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
251 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
252 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
253 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
254 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
255 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
256 2643221599 Rhizobium sp. Root708 Isolate Unclassified
257 2643221607 Rhizobium sp. Root73 Isolate Unclassified
258 2643221626 Ensifer sp. Root31 Isolate Unclassified
259 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
260 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
261 2643221659 Ensifer sp. Root127 Isolate Unclassified
262 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
263 2643221688 Rhizobium sp. Root482 Isolate Unclassified
264 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
265 2643221698 Ensifer sp. Root142 Isolate Unclassified
266 2643221723 Ensifer sp. Root278 Isolate Unclassified
267 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
268 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
269 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
270 2718217882 Rhizobium sp. N741 Isolate Nodule
271 2718217927 Rhizobium sp. N324 Isolate Nodule
272 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
273 2718218009 Rhizobium sp. N561 Isolate Nodule
274 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
275 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
276 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
277 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
278 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
279 2718218363 Rhizobium sp. N113 Isolate Nodule
280 2718218365 Rhizobium sp. N731 Isolate Nodule
281 2718218366 Rhizobium sp. N621 Isolate Nodule
282 2718218423 Rhizobium sp. N941 Isolate Nodule
283 2721755514 Rhizobium sp. N6212 Isolate Nodule
284 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
285 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
286 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
287 2721755809 Rhizobium sp. N541 Isolate Nodule
288 2721755810 Rhizobium sp. N871 Isolate Nodule
289 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
290 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
291 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
292 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
293 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
294 2728369365 Rhizobium sp. N1341 Isolate Nodule
295 2728369397 Rhizobium sp. N1314 Isolate Nodule
296 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
297 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
298 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
299 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
300 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
301 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
302 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
303 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
304 2791355256 Rhizobium sp. M10 Isolate Nodule
305 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
306 2791355261 Rhizobium sp. J15 Isolate Nodule
307 2791355262 Rhizobium sp. M1 Isolate Nodule
308 2791355263 Rhizobium chutanense C5 Isolate Nodule
309 2791355264 Rhizobium sp. S9 Isolate Nodule
310 2791355265 Rhizobium sp. H4 Isolate Nodule
311 2791355266 Rhizobium sp. L43 Isolate Nodule
312 2791355267 Rhizobium sp. L18 Isolate Nodule
313 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
314 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
315 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
316 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
317 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
318 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
319 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
320 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
321 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
322 2802429633 Rhizobium anhuiense J3 Isolate Nodule
323 2802429634 Rhizobium anhuiense S10 Isolate Nodule
324 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
325 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
326 2802429637 Rhizobium anhuiense C15 Isolate Nodule
327 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
328 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
329 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
330 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
331 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
332 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
333 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
334 2838048938 Rhizobium pisi 27/80 Isolate Nodule
335 2838061910 Rhizobium phaseoli L15 Isolate Nodule
336 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
337 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
338 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
339 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
340 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
341 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
342 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
343 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
344 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
345 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
346 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
347 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
348 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
349 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
350 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
351 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
352 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
353 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
354 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
355 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
356 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
357 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
358 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
359 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
360 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
361 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
362 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
363 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
364 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
365 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
366 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
367 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
368 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
369 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
370 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
371 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
372 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
373 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
374 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
375 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
376 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
377 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
378 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
379 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
380 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
381 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
382 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
383 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
384 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
385 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
386 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
387 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
388 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
389 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
390 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
391 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
392 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
393 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
394 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
395 2844163670 Ensifer sp. 1H6 Isolate Unclassified
396 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
397 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
398 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
399 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
400 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
401 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
402 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
403 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
404 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
405 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
406 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
407 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
408 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
409 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
410 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
411 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
412 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
413 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
414 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
415 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
416 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
417 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
418 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
419 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
420 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
421 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
422 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
423 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
424 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
425 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
426 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
427 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
428 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
429 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
430 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
431 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
432 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
433 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
434 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
435 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
436 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
437 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
438 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
439 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
440 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
441 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
442 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
443 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
444 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
445 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
446 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
447 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
448 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
449 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
450 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
451 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
452 2933599457 Rhizobium phaseoli M3 Isolate Nodule
453 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
454 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
455 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
456 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
457 2936381700 Rhizobium chutanense C16 Isolate Unclassified
458 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
459 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
460 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
461 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
462 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
463 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
464 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
465 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
466 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
467 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
468 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
469 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
470 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
471 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
472 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
473 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
474 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
475 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
476 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
477 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
478 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
479 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
480 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
481 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
482 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
483 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
484 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
485 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
486 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
487 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
488 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
489 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
490 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
491 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
492 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
493 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
494 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
495 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
496 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
497 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
498 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
499 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
500 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
501 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
502 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
503 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
504 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
505 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
506 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
507 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
508 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
509 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
510 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
511 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
512 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
513 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
514 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
515 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
516 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
517 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
518 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
519 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
520 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
521 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
522 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
523 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
524 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
525 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
526 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
527 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
528 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
529 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
530 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
531 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
532 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
533 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
534 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
535 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
536 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
537 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
538 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
539 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
540 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
541 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
542 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
543 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
544 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
545 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
546 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
547 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
548 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
549 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
550 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
551 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
552 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
553 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
554 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
555 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
556 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
557 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
558 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
559 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
560 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
561 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
562 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
563 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
564 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
565 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
566 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
567 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
568 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
569 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
570 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
571 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
572 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
573 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
574 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
575 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
576 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
577 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
578 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
579 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
580 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
581 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
582 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
583 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
584 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
585 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
586 2996887358 Rhizobium sp. R711 Isolate Nodule
587 2996893221 Rhizobium sp. R635 Isolate Nodule
588 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
589 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
590 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
591 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
592 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
593 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
594 8005258706 Rhizobium sp. R693 Isolate Nodule
595 8005275841 Rhizobium sp. N4311 Isolate Nodule
596 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
597 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
598 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
599 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
600 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
601 8005321885 Rhizobium sp. R72 Isolate Nodule
602 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
603 8005395548 Rhizobium sp. R339 Isolate Nodule
604 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
605 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
606 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
607 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
608 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
609 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
610 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
611 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
612 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
613 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
614 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
615 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
616 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
617 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
618 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
619 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
620 8018176218 Rhizobium sp. N122 Isolate Nodule
621 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
622 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
623 8024501048 Rhizobium sp. H4 Isolate Nodule
624 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
625 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
626 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
627 8056382006 Rhizobium croatiense 13T Isolate Nodule
628 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
629 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.91
Metatranscriptomes 0
Isolates 63.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.18
Nodule 55.43
Rhizoplane 1.67
Rhizosphere 15.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10009463 3300028794 Bacteria 18831
2 JGI24740J21852_10006079 3300001979 Bacteria 5045
3 JGI25155J39150_1000007 3300002704 Bacteria 238857
4 JGI25156J39149_1000066 3300002705 Bacteria 82816
5 JGI25162J39368_1000488 3300002737 Bacteria 30289
6 JGI25162J39368_1002218 3300002737 Bacteria 7985
7 JGI25154J39366_1000035 3300002738 Bacteria 172224
8 JGI25157J39369_1000036 3300002741 Bacteria 133671
9 JGI25152J39213_1009411 3300002773 Bacteria 2324
10 JGI25152J39213_1023396 3300002773 Bacteria 1052
11 JGI25159J45721_1000018 3300002987 Bacteria 132603
12 JGI25159J45721_1000463 3300002987 Bacteria 18770
13 JGI25151J46595_10001277 3300003187 Bacteria 17761
14 JGI25151J46595_10014951 3300003187 Bacteria 3444
15 JGI25165J46597_1000676 3300003214 Bacteria 27457
16 JGI25165J46597_1001184 3300003214 Bacteria 15921
17 JGI25165J46597_1008392 3300003214 Bacteria 1623
18 JGI25153J46596_10006550 3300003215 Bacteria 5871
19 rootH1_10005905 3300003316 Bacteria 3081
20 rootL2_10092145 3300003322 Bacteria 1773
21 JGI25160J50197_1000009 3300003354 Bacteria 282862
22 JGI25160J50197_1000100 3300003354 Bacteria 86646
23 JGI25160J50197_1001130 3300003354 Bacteria 13639
24 JGI25161J50226_1000072 3300003374 Bacteria 86646
25 JGI25161J50226_1000243 3300003374 Bacteria 32857
26 JGI25161J50226_1001812 3300003374 Bacteria 5994
27 Ga0055526_1001175 3300003771 Bacteria 18963
28 Ga0055526_1003037 3300003771 Bacteria 10910
29 Ga0055526_1028431 3300003771 Bacteria 1691
30 Ga0055524_1018143 3300003775 Bacteria 2453
31 Ga0055536_1000099 3300003781 Bacteria 74606
32 Ga0055536_1001952 3300003781 Bacteria 11882
33 Ga0055528_1003216 3300003790 Bacteria 8340
34 Ga0055528_1021390 3300003790 Bacteria 2055
35 Ga0055540_1004189 3300003792 Bacteria 6640
36 Ga0055540_1013492 3300003792 Bacteria 2493
37 Ga0055531_10003297 3300003794 Bacteria 10342
38 Ga0055531_10019675 3300003794 Bacteria 2716
39 Ga0055543_1000078 3300004625 Bacteria 85340
40 Ga0055543_1000090 3300004625 Bacteria 79635
41 Ga0055543_1001074 3300004625 Bacteria 11996
42 Ga0065165_1000020 3300005262 Bacteria 265570
43 Ga0065165_1000623 3300005262 Bacteria 51455
44 Ga0068856_100052982 3300005614 Bacteria 4002
45 Ga0068852_100312392 3300005616 Bacteria 1524
46 Ga0075365_10003910 3300006038 Bacteria 7801
47 Ga0075365_10004045 3300006038 Bacteria 7695
48 Ga0075368_10035394 3300006042 Bacteria 1948
49 Ga0075363_100047328 3300006048 Bacteria 2283
50 Ga0075364_10000330 3300006051 Bacteria 23530
51 Ga0075362_10013667 3300006177 Bacteria 3256
52 Ga0075367_10005763 3300006178 Bacteria 6194
53 Ga0075369_10009245 3300006186 Bacteria 3823
54 Ga0075370_10016622 3300006353 Bacteria 3960
55 Ga0105240_10000019 3300009093 Bacteria 406211
56 Ga0105247_10130340 3300009101 Bacteria 1638
57 Ga0105243_10432698 3300009148 Bacteria 1230
58 Ga0105237_10000734 3300009545 Bacteria 45223
59 Ga0123340_1050364 3300009763 Bacteria 1532
60 Ga0123341_1000014 3300009765 Bacteria 91980
61 Ga0123341_1036040 3300009765 Bacteria 3442
62 Ga0123342_1007767 3300009766 Bacteria 13980
63 Ga0123342_1011573 3300009766 Bacteria 9583
64 Ga0105033_107684 3300009986 Bacteria 936
65 Ga0105239_10000574 3300010375 Bacteria 52563
66 Ga0157373_10238927 3300013100 Bacteria 1284
67 Ga0157370_10000131 3300013104 Bacteria 89805
68 Ga0157369_10429143 3300013105 Bacteria 1370
69 Ga0171463_1006 3300013249 Bacteria 336402
70 Ga0163162_10354356 3300013306 Bacteria 1600
71 Ga0183363_1226 3300015690 Bacteria 10384
72 Ga0214544_1000893 3300021320 Bacteria 58796
73 Ga0214542_1000115 3300021321 Bacteria 109873
74 Ga0214542_1010937 3300021321 Bacteria 12829
75 Ga0214543_1000008 3300021327 Bacteria 385680
76 Ga0214543_1000098 3300021327 Bacteria 109894
77 Ga0228711_1000003 3300022739 Bacteria 258118
78 Ga0228710_1000003 3300022740 Bacteria 262981
79 Ga0209435_100005 3300025206 Bacteria 573745
80 Ga0209436_102544 3300025208 Bacteria 5400
81 Ga0209436_103716 3300025208 Bacteria 3964
82 Ga0209437_100058 3300025233 Bacteria 357279
83 Ga0209437_100313 3300025233 Bacteria 64057
84 Ga0209437_112934 3300025233 Bacteria 1205
85 Ga0209646_1000011 3300025246 Bacteria 573745
86 Ga0209646_1008977 3300025246 Bacteria 1593
87 Ga0209026_1000008 3300025250 Bacteria 573745
88 Ga0209677_100475 3300025253 Bacteria 22964
89 Ga0209148_1004357 3300025254 Bacteria 3512
90 Ga0209759_1000004 3300025256 Bacteria 573745
91 Ga0209129_1003392 3300025258 Bacteria 6988
92 Ga0209233_1000157 3300025261 Bacteria 164269
93 Ga0209233_1000354 3300025261 Bacteria 42911
94 Ga0209233_1006570 3300025261 Bacteria 3738
95 Ga0209673_1000060 3300025273 Bacteria 263602
96 Ga0209673_1000233 3300025273 Bacteria 108504
97 Ga0209673_1001293 3300025273 Bacteria 25567
98 Ga0209130_1000037 3300025284 Bacteria 284019
99 Ga0209130_1000083 3300025284 Bacteria 162582
100 Ga0209676_1000239 3300025292 Bacteria 117696
101 Ga0209676_1004022 3300025292 Bacteria 8468
102 Ga0209025_1000350 3300025294 Bacteria 99649
103 Ga0209025_1000651 3300025294 Bacteria 60813
104 Ga0209025_1033052 3300025294 Bacteria 2401
105 Ga0209564_1000086 3300025295 Bacteria 251385
106 Ga0209564_1000116 3300025295 Bacteria 207889
107 Ga0209564_1000125 3300025295 Bacteria 201709
108 Ga0209758_1000839 3300025297 Bacteria 42882
109 Ga0209758_1001022 3300025297 Bacteria 36959
110 Ga0209758_1003215 3300025297 Bacteria 15224
111 Ga0209050_1000962 3300025298 Bacteria 37160
112 Ga0209256_1000302 3300025299 Bacteria 86634
113 Ga0209256_1001684 3300025299 Bacteria 21424
114 Ga0209256_1001999 3300025299 Bacteria 18246
115 Ga0209256_1005830 3300025299 Bacteria 6856
116 Ga0207426_1000048 3300025302 Bacteria 409127
117 Ga0207426_1000173 3300025302 Bacteria 162697
118 Ga0207426_1000276 3300025302 Bacteria 106148
119 Ga0209051_1000217 3300025303 Bacteria 97218
120 Ga0209051_1001815 3300025303 Bacteria 16899
121 Ga0209051_1003928 3300025303 Bacteria 9472
122 Ga0209051_1004173 3300025303 Bacteria 9029
123 Ga0209051_1025400 3300025303 Bacteria 2412
124 Ga0209257_1001228 3300025304 Bacteria 31886
125 Ga0209257_1002359 3300025304 Bacteria 18962
126 Ga0209257_1003206 3300025304 Bacteria 14477
127 Ga0207695_10000049 3300025913 Bacteria 406233
128 Ga0207671_10000423 3300025914 Bacteria 58526
129 Ga0207640_10067632 3300025981 Bacteria 2392
130 Ga0207702_10036212 3300026078 Bacteria 4127
131 Ga0207698_10048673 3300026142 Bacteria 3220
132 Ga0209281_1000081 3300027111 Bacteria 258084
133 Ga0209281_1000269 3300027111 Bacteria 100505
134 Ga0209371_1003973 3300027312 Bacteria 6754
135 Ga0209282_1000040 3300027666 Bacteria 127969
136 Ga0209813_10013166 3300027866 Bacteria 2202
137 Ga0307515_10000017 3300028794 Bacteria 550465
138 Ga0307515_10054023 3300028794 Bacteria 5908
139 Ga0268256_1004463 3300030500 Bacteria 5790
140 Ga0307513_10000829 3300031456 Bacteria 45184
141 Ga0307513_10033592 3300031456 Bacteria 5765
142 Ga0307408_100145880 3300031548 Bacteria 1863
143 Ga0315914_1000002 3300031967 Bacteria 365357
144 Ga0307414_10039372 3300032004 Bacteria 3183
145 Ga0307414_10114999 3300032004 Bacteria 2057
146 Ga0315913_1000016 3300033430 Bacteria 113410
147 Ga0315915_1000005 3300033464 Bacteria 397591
148 Ga0439436_0034242 3300041404 Bacteria 1469
149 Ga0439438_030189 3300041405 Bacteria 1446
150 Ga0439465_0003197 3300041413 Bacteria 5340
151 Ga0439465_0057795 3300041413 Bacteria 1281
152 Ga0451787_616143 3300041441 Bacteria 2328
153 Ga0451791_0529163 3300041451 Bacteria 1120
154 Ga0451793_1852513 3300041452 Bacteria 1561
155 Ga0451798_0835202 3300041458 Bacteria 1413
156 Ga0451833_0117185 3300041491 Bacteria 3037
157 Ga0451841_1461251 3300041498 Bacteria 1395
158 Ga0451845_0942005 3300041501 Bacteria 1807
159 Ga0451847_0170003 3300041503 Bacteria 5295
160 Ga0451851_0213864 3300041507 Bacteria 1133
161 Ga0451843_0891599 3300041509 Bacteria 1005
162 Ga0451853_1248573 3300041512 Bacteria 998
163 Ga0439449_0004324 3300042007 Bacteria 5487
164 Ga0439449_0070915 3300042007 Bacteria 1284
165 Ga0439462_0006065 3300042015 Bacteria 2994
166 Ga0466966_0047708 3300044684 Bacteria 2730
167 Ga0466963_0006012 3300044694 Bacteria 7153
168 Ga0466970_0002423 3300044765 Bacteria 9013
169 Ga0466957_0006791 3300044842 Bacteria 6467
170 Ga0466958_0028939 3300045836 Bacteria 3287
171 Ga0495617_028766 3300046452 Bacteria 1868
172 Ga0495627_031944 3300046453 Bacteria 1660
173 Ga0495638_0000309 3300046460 Bacteria 62979
174 Ga0495605_0004125 3300046474 Bacteria 8566
175 Ga0495605_0113940 3300046474 Bacteria 1231
176 Ga0495585_0018203 3300046492 Bacteria 4053
177 Ga0495585_0052922 3300046492 Bacteria 2247
178 Ga0495607_0106741 3300046501 Bacteria 1490
179 Ga0495583_0030081 3300046506 Bacteria 2650
180 Ga0495606_0003931 3300046507 Bacteria 15287
181 Ga0495606_0032048 3300046507 Bacteria 3646
182 Ga0495606_0035598 3300046507 Bacteria 3401
183 Ga0495606_0074527 3300046507 Bacteria 2126
184 Ga0495606_0266018 3300046507 Bacteria 944
185 Ga0495610_0085771 3300046512 Bacteria 1436
186 Ga0495616_0060193 3300046513 Bacteria 1866
187 Ga0495620_0095649 3300046515 Bacteria 1188
188 Ga0495631_0006384 3300046518 Bacteria 6092
189 Ga0495631_0054366 3300046518 Bacteria 1746
190 Ga0495632_0013134 3300046519 Bacteria 4742
191 Ga0495632_0014796 3300046519 Bacteria 4400
192 Ga0495648_0025552 3300046524 Bacteria 3996
193 Ga0495654_0000635 3300046530 Bacteria 27690
194 Ga0495609_0027846 3300046538 Bacteria 2581
195 Ga0495609_0040527 3300046538 Bacteria 2096
196 Ga0495633_0061755 3300046558 Bacteria 1754
197 Ga0495656_0061681 3300046615 Bacteria 1638
198 Ga0495656_0103342 3300046615 Bacteria 1321
199 Ga0495668_0004368 3300046616 Bacteria 10085
200 Ga0495611_0031165 3300046648 Bacteria 2346
201 Ga0495625_0004853 3300046660 Bacteria 12545
202 Ga0495625_0040764 3300046660 Bacteria 3383
203 Ga0495625_0095569 3300046660 Bacteria 2048
204 Ga0495670_0049044 3300046691 Bacteria 2112
205 Ga0495670_0094659 3300046691 Bacteria 1532
206 Ga0495649_0127612 3300046694 Bacteria 1343
207 Ga0495660_0054913 3300046810 Bacteria 2157
208 Ga0495660_0067645 3300046810 Bacteria 1902
209 Ga0495636_0020539 3300047318 Bacteria 2662
210 Ga0495672_0021610 3300047320 Bacteria 4195
211 Ga0495687_028543 3300047443 Bacteria 2595
212 Ga0495686_0000852 3300047472 Bacteria 39191
213 Ga0495686_0022338 3300047472 Bacteria 4187
214 Ga0495626_0048516 3300048091 Bacteria 1970
215 Ga0496100_0004221 3300048903 Bacteria 7591
216 Ga0496102_0010032 3300048905 Bacteria 8146
217 Ga0496103_0005927 3300048906 Bacteria 7304
218 Ga0496113_0109812 3300048916 Bacteria 2145
219 Ga0496116_0052634 3300048919 Bacteria 2695
220 Ga0496117_0000926 3300048920 Bacteria 44886
221 Ga0496118_0001977 3300048921 Bacteria 29110
222 Ga0496118_0014498 3300048921 Bacteria 7377
223 Ga0496118_0109939 3300048921 Bacteria 1833
224 Ga0496119_0006763 3300048922 Bacteria 10516
225 Ga0496119_0024898 3300048922 Bacteria 4195
226 Ga0496120_0007775 3300048923 Bacteria 7918
227 Ga0496121_0007187 3300048924 Bacteria 13486
228 Ga0496121_0015540 3300048924 Bacteria 7959
229 Ga0496121_0016496 3300048924 Bacteria 7622
230 Ga0496121_0076163 3300048924 Bacteria 2676
231 Ga0496121_0121886 3300048924 Bacteria 1968
232 Ga0496122_0021216 3300048925 Bacteria 5826
233 Ga0496122_0060045 3300048925 Bacteria 2803
234 Ga0496123_0010699 3300048926 Bacteria 8065
235 Ga0496123_0038923 3300048926 Bacteria 3333
236 Ga0496124_0090914 3300048927 Bacteria 2488
237 Ga0496125_0016120 3300048928 Bacteria 7191
238 Ga0496126_0376977 3300048929 Bacteria 1155
239 Ga0495678_036826 3300049459 Bacteria 1993
240 Ga0501036_0035596 3300049572 Bacteria 4212
241 Ga0501038_0110846 3300049574 Bacteria 2274
242 Ga0501043_0190510 3300049579 Bacteria 1595
243 Ga0501073_0029510 3300049589 Bacteria 3919
244 Ga0501044_0058885 3300049823 Bacteria 3937
245 nmdc:mga03683_5973_c1 3300050489 Bacteria 4144
246 nmdc:mga00v17_346_c2 3300050491 Bacteria 15851
247 nmdc:mga0yw44_48798_c1 3300050492 Bacteria 2553
248 nmdc:mga0k408_84058_c1 3300050493 Bacteria 1867
249 nmdc:mga06z11_258604_c1 3300050494 Bacteria 1027
250 Ga0500578_0027434 3300053086 Bacteria 3656
251 Ga0500578_0106136 3300053086 Bacteria 1774
252 Ga0500557_002432 3300053105 Bacteria 3419
253 Ga0500594_0002400 3300053118 Bacteria 4079
254 Ga0500618_000337 3300053125 Bacteria 33703
255 Ga0500618_000717 3300053125 Bacteria 19091
256 Ga0500618_010367 3300053125 Bacteria 2503
257 Ga0500658_0000832 3300053134 Bacteria 12692
258 Ga0500658_0049855 3300053134 Bacteria 1707
259 Ga0500568_0002138 3300053139 Bacteria 11923
260 Ga0500616_0000677 3300053153 Bacteria 39945
261 Ga0500616_0000980 3300053153 Bacteria 30834
262 Ga0500627_0020080 3300053158 Bacteria 2675
263 Ga0500627_0075330 3300053158 Bacteria 1500
264 Ga0500627_0146306 3300053158 Bacteria 1067
265 Ga0500636_0092910 3300053177 Bacteria 1726
266 2509109737 2508501122 Bacteria 6292184
267 2509379271 2509276019 Bacteria 6802256
268 2509389986 2509276021 Bacteria 7634384
269 2509447777 2509276033 Bacteria 7180565
270 2510134691 2510065019 Bacteria 6903379
271 2510307329 2510065057 Bacteria 6649661
272 2510842564 2510461069 Bacteria 5505000
273 2510896042 2510461076 Bacteria 8618824
274 2511137316 2510917022 Bacteria 6504556
275 2511187196 2510917028 Bacteria 6185411
276 2511502889 2511231052 Bacteria 6974333
277 2512534131 2512047086 Bacteria 6850303
278 2512974034 2512875026 Bacteria 6861065
279 2513573257 2513237084 Bacteria 7231967
280 2513578492 2513237085 Bacteria 7695351
281 2513584109 2513237086 Bacteria 7265287
282 2513600734 2513237088 Bacteria 6927906
283 2513602249 2513237089 Bacteria 6553624
284 2513616995 2513237091 Bacteria 6900273
285 2513631470 2513237093 Bacteria 7545552
286 2513710597 2513237103 Bacteria 7647401
287 2513882008 2513237140 Bacteria 7076289
288 2513905526 2513237143 Bacteria 6664116
289 2513926818 2513237146 Bacteria 7166346
290 2513985479 2513237156 Bacteria 6402557
291 2513997979 2513237159 Bacteria 6810126
292 2514003892 2513237160 Bacteria 6650282
293 2514023420 2513237162 Bacteria 7468464
294 2515113782 2515075009 Bacteria 7288508
295 2515610453 2515154107 Bacteria 6795637
296 2515634645 2515154113 Bacteria 7807172
297 2515645311 2515154114 Bacteria 7848616
298 2515660884 2515154116 Bacteria 7552979
299 2515743504 2515154134 Bacteria 7220242
300 2516205129 2516143018 Bacteria 6951533
301 2516894294 2516653046 Bacteria 6989037
302 2517037393 2516653077 Bacteria 7555578
303 2517077693 2516653085 Bacteria 7346596
304 2517096492 2517093000 Bacteria 7412387
305 2517410588 2517287029 Bacteria 6905599
306 2517570902 2517487022 Bacteria 7227575
307 2520378256 2519899620 Bacteria 6499161
308 2524451760 2524023207 Bacteria 6813453
309 2524462055 2524023209 Bacteria 6679728
310 2530646809 2529292951 Bacteria 6916614
311 2535519584 2534681796 Bacteria 7146037
312 2551674714 2551306084 Bacteria 8942552
313 2551685476 2551306085 Bacteria 7347181
314 2551693774 2551306086 Bacteria 6843938
315 2551699651 2551306087 Bacteria 7351905
316 2551717348 2551306090 Bacteria 7953713
317 2551738973 2551306092 Bacteria 6992595
318 2551741354 2551306093 Bacteria 7064773
319 2558860311 2558860100 Bacteria 8458965
320 2585167900 2582581283 Bacteria 6030556
321 2585204870 2582581294 Bacteria 6626667
322 2585265484 2582581306 Bacteria 6450535
323 2585274144 2582581307 Bacteria 6597605
324 2585280446 2582581308 Bacteria 7413247
325 2585322719 2582581315 Bacteria 7318924
326 2585330838 2582581316 Bacteria 7774528
327 2585388415 2582581865 Bacteria 6644329
328 2585392313 2582581866 Bacteria 6859583
329 2585529603 2585427526 Bacteria 7258840
330 2585532674 2585427527 Bacteria 7273426
331 2585541163 2585427528 Bacteria 6842387
332 2585554310 2585427530 Bacteria 7383882
333 2585560593 2585427531 Bacteria 6992870
334 2585839926 2585427593 Bacteria 7141551
335 2585898803 2585427608 Bacteria 6544331
336 2585903609 2585427609 Bacteria 6667127
337 2587981271 2585428125 Bacteria 6662905
338 2599334840 2599185156 Bacteria 5403036
339 2599420689 2599185170 Bacteria 7295545
340 2600194662 2599185352 Bacteria 7228948
341 2600373772 2600254933 Bacteria 4750527
342 2616295414 2615840624 Bacteria 6557588
343 2616554798 2615840698 Bacteria 7319877
344 2617383479 2617270742 Bacteria 6808054
345 2644006257 2643221599 Bacteria 6292121
346 2644050964 2643221607 Bacteria 6314006
347 2644146686 2643221626 Bacteria 8069654
348 2644205467 2643221636 Bacteria 6583769
349 2644241707 2643221643 Bacteria 5749658
350 2644335903 2643221659 Bacteria 7890716
351 2644483868 2643221686 Bacteria 6310811
352 2644496267 2643221688 Bacteria 5260751
353 2644500325 2643221689 Bacteria 6042950
354 2644546762 2643221698 Bacteria 7756764
355 2644676858 2643221723 Bacteria 7095460
356 2657684088 2657244999 Bacteria 5946535
357 2671112052 2667528174 Bacteria 6435400
358 2692314619 2690316117 Bacteria 6800650
359 2719182462 2718217882 Bacteria 6556348
360 2719387119 2718217927 Bacteria 6972593
361 2719666765 2718217997 Bacteria 6740740
362 2719733181 2718218009 Bacteria 6478651
363 2720493185 2718218199 Bacteria 6740745
364 2720614662 2718218232 Bacteria 6720332
365 2720621435 2718218233 Bacteria 6662049
366 2720632763 2718218235 Bacteria 6630699
367 2720776487 2718218269 Bacteria 6906114
368 2721148575 2718218363 Bacteria 6524337
369 2721159961 2718218365 Bacteria 6274507
370 2721165389 2718218366 Bacteria 6425255
371 2721400754 2718218423 Bacteria 6438183
372 2722841559 2721755514 Bacteria 6424414
373 2723028075 2721755556 Bacteria 6745503
374 2723561706 2721755684 Bacteria 6859907
375 2723568335 2721755685 Bacteria 6704835
376 2724039567 2721755809 Bacteria 6438790
377 2724045937 2721755810 Bacteria 6479005
378 2724091094 2721755819 Bacteria 6906405
379 2724105600 2721755822 Bacteria 6726041
380 2724111426 2721755823 Bacteria 6752556
381 2725947678 2724679232 Bacteria 7646494
382 2730109011 2728369352 Bacteria 6745171
383 2730165697 2728369365 Bacteria 6555560
384 2730299593 2728369397 Bacteria 6274511
385 2739035715 2738541333 Bacteria 7106503
386 2753458718 2751185821 Bacteria 6189929
387 2766065476 2765235942 Bacteria 7445910
388 2778175872 2775507266 Bacteria 7392367
389 2792582651 2791355082 Bacteria 5973319
390 2792622891 2791355091 Bacteria 6135441
391 2792629144 2791355092 Bacteria 6248105
392 2792640501 2791355094 Bacteria 7011481
393 2793293786 2791355256 Bacteria 6798008
394 2793313204 2791355259 Bacteria 7254731
395 2793328132 2791355261 Bacteria 6661293
396 2793333229 2791355262 Bacteria 6774204
397 2793343824 2791355263 Bacteria 6872478
398 2793347232 2791355264 Bacteria 6429314
399 2793356631 2791355265 Bacteria 6539969
400 2793362908 2791355266 Bacteria 7116587
401 2793370065 2791355267 Bacteria 7222458
402 2802718008 2802428858 Bacteria 6636079
403 2802725141 2802428859 Bacteria 6667919
404 2802730735 2802428860 Bacteria 6525526
405 2802738082 2802428861 Bacteria 6534206
406 2802744048 2802428862 Bacteria 6633353
407 2802750927 2802428863 Bacteria 6410669
408 2804753223 2802429268 Bacteria 6094027
409 2805930700 2802429605 Bacteria 6875453
410 2805934173 2802429606 Bacteria 6346811
411 2806044702 2802429633 Bacteria 7341974
412 2806052902 2802429634 Bacteria 7083200
413 2806059202 2802429635 Bacteria 7650140
414 2806068135 2802429636 Bacteria 7597525
415 2806074255 2802429637 Bacteria 7067217
416 2819609744 2818991448 Bacteria 6772224
417 2819639843 2818991453 Bacteria 7181617
418 2838018962 2838016132 Bacteria 6577831
419 2838024438 2838022645 Bacteria 6494267
420 2838032991 2838029111 Bacteria 6603031
421 2838040637 2838035591 Bacteria 7166484
422 2838046395 2838042994 Bacteria 6046894
423 2838051322 2838048938 Bacteria 6044578
424 2838063700 2838061910 Bacteria 6794874
425 2838074271 2838068647 Bacteria 6208656
426 2838077330 2838074704 Bacteria 6785777
427 2838664975 2838661181 Bacteria 7385261
428 2838685106 2838680041 Bacteria 6545511
429 2838691473 2838686498 Bacteria 7807632
430 2838699057 2838694306 Bacteria 6853137
431 2838712538 2838707686 Bacteria 6619912
432 2838733432 2838729681 Bacteria 7400765
433 2838745996 2838742623 Bacteria 7396178
434 2841853708 2841851746 Bacteria 7532261
435 2841868327 2841864319 Bacteria 6742987
436 2842082015 2842077413 Bacteria 6508645
437 2842113591 2842110456 Bacteria 7656360
438 2842122937 2842118031 Bacteria 7033875
439 2842162285 2842156927 Bacteria 6894975
440 2842169841 2842163707 Bacteria 6916235
441 2842185211 2842180545 Bacteria 6888678
442 2842197757 2842192696 Bacteria 6147454
443 2842199981 2842198810 Bacteria 6608673
444 2842208159 2842205361 Bacteria 6340321
445 2842220228 2842217011 Bacteria 7497767
446 2842233698 2842229732 Bacteria 7475766
447 2842242160 2842237096 Bacteria 6620661
448 2842247742 2842243621 Bacteria 7421798
449 2842261990 2842257432 Bacteria 7401195
450 2842266468 2842264693 Bacteria 6472963
451 2842275947 2842271015 Bacteria 7807131
452 2842281832 2842278818 Bacteria 6340002
453 2842288936 2842285085 Bacteria 6011953
454 2842296015 2842291075 Bacteria 7076806
455 2842298554 2842298080 Bacteria 6123127
456 2842308069 2842304105 Bacteria 7023636
457 2842316161 2842311132 Bacteria 6616990
458 2842321548 2842317721 Bacteria 6793725
459 2842344851 2842341865 Bacteria 7003929
460 2842362406 2842357229 Bacteria 6485165
461 2842369370 2842363717 Bacteria 6844742
462 2842377173 2842370503 Bacteria 7038661
463 2842382414 2842377471 Bacteria 7140707
464 2842389815 2842384541 Bacteria 7057858
465 2842398675 2842395702 Bacteria 6780583
466 2842406397 2842402390 Bacteria 6681310
467 2842413176 2842409023 Bacteria 6687331
468 2842419819 2842415677 Bacteria 6596907
469 2842427895 2842422224 Bacteria 6239196
470 2842429787 2842428310 Bacteria 6767288
471 2842436553 2842434925 Bacteria 6502746
472 2842444256 2842441272 Bacteria 6769273
473 2842450883 2842447887 Bacteria 6754142
474 2842464208 2842462802 Bacteria 6588055
475 2842470882 2842469257 Bacteria 6752936
476 2842479724 2842475841 Bacteria 6603183
477 2842483532 2842482326 Bacteria 7212537
478 2842493116 2842489311 Bacteria 6620893
479 2842499314 2842495871 Bacteria 6820686
480 2842506900 2842502639 Bacteria 6604161
481 2842510584 2842509118 Bacteria 6850950
482 2842523083 2842521101 Bacteria 6569494
483 2842925966 2842922631 Bacteria 5824079
484 2844169124 2844163670 Bacteria 7266046
485 2844457647 2844454524 Bacteria 7952546
486 2847420330 2847417321 Bacteria 6913799
487 2848995142 2848992105 Bacteria 6810864
488 2850082209 2850079185 Bacteria 6848280
489 2852391036 2852387548 Bacteria 8025568
490 2854900371 2854896431 Bacteria 5869725
491 2855826930 2855825444 Bacteria 6785811
492 2855842325 2855839649 Bacteria 7135830
493 2855878538 2855872281 Bacteria 6964271
494 2857519058 2857516855 Bacteria 7787325
495 2858803141 2858800743 Bacteria 6603254
496 2899806538 2899803654 Bacteria 5577784
497 2913299739 2913295892 Bacteria 6333755
498 2915980449 2915980308 Bacteria 6624279
499 2915987752 2915986958 Bacteria 6739310
500 2915998997 2915993759 Bacteria 7016183
501 2916006166 2916000859 Bacteria 6865702
502 2916013006 2916007675 Bacteria 6898660
503 2916021542 2916014648 Bacteria 6946486
504 2916026467 2916021584 Bacteria 6854472
505 2916030511 2916028427 Bacteria 6748433
506 2916038415 2916035215 Bacteria 6755766
507 2916044826 2916041962 Bacteria 6820487
508 2916054083 2916048683 Bacteria 6543552
509 2916057483 2916055098 Bacteria 6758838
510 2916067027 2916061851 Bacteria 6737736
511 2916074528 2916068649 Bacteria 6943657
512 2916077378 2916076590 Bacteria 6596108
513 2919173259 2919171160 Bacteria 6499771
514 2919410536 2919408235 Bacteria 6149349
515 2920828602 2920822456 Bacteria 6897201
516 2921202921 2921201388 Bacteria 6926299
517 2921214580 2921208531 Bacteria 6745326
518 2921242589 2921237296 Bacteria 6876710
519 2921250188 2921244191 Bacteria 6568419
520 2921252267 2921250672 Bacteria 6677771
521 2921257546 2921257292 Bacteria 6808382
522 2921270371 2921263974 Bacteria 6864552
523 2921282904 2921282425 Bacteria 6826397
524 2921292590 2921289301 Bacteria 7316391
525 2921300951 2921296804 Bacteria 7176999
526 2924149310 2924144063 Bacteria 6883928
527 2924155460 2924150972 Bacteria 7169444
528 2924163250 2924158325 Bacteria 7188855
529 2924171837 2924165586 Bacteria 7260590
530 2924179322 2924172951 Bacteria 6749356
531 2924186271 2924179722 Bacteria 6843264
532 2924191606 2924186466 Bacteria 6876637
533 2924195003 2924193448 Bacteria 6955718
534 2924201634 2924200457 Bacteria 6757188
535 2924213505 2924207177 Bacteria 6917007
536 2924220826 2924214083 Bacteria 7080103
537 2924225774 2924221636 Bacteria 7113495
538 2924233369 2924228884 Bacteria 6633132
539 2933574518 2933570622 Bacteria 7023390
540 2933589119 2933586486 Bacteria 7667493
541 2933604727 2933599457 Bacteria 5858799
542 2935899881 2935894831 Bacteria 6620579
543 2935907050 2935901341 Bacteria 7341747
544 2936375019 2936367885 Bacteria 7324495
545 2936380710 2936375103 Bacteria 6652732
546 2936382121 2936381700 Bacteria 7006523
547 2936999933 2936996657 Bacteria 6298727
548 2937008214 2937002841 Bacteria 6934057
549 2937010947 2937009748 Bacteria 6746052
550 2937018281 2937016420 Bacteria 6782579
551 2937025764 2937023124 Bacteria 6815156
552 2937033110 2937029754 Bacteria 6424026
553 2937036612 2937036028 Bacteria 6846469
554 2937043319 2937042894 Bacteria 6741576
555 2937055693 2937049772 Bacteria 6757901
556 2937059073 2937056579 Bacteria 7107896
557 2937067455 2937063883 Bacteria 7199456
558 2937074765 2937071275 Bacteria 6984483
559 2937078515 2937078374 Bacteria 6610289
560 2937091345 2937084907 Bacteria 6618516
561 2937092432 2937091812 Bacteria 6979387
562 2937104941 2937098957 Bacteria 7249374
563 2937111736 2937106411 Bacteria 6947143
564 2937115051 2937113482 Bacteria 6505872
565 2937121438 2937119839 Bacteria 6597547
566 2937129428 2937126314 Bacteria 6771275
567 2957377554 2957375807 Bacteria 6425588
568 2957387661 2957382221 Bacteria 6737050
569 2957389894 2957388812 Bacteria 6778072
570 2957397412 2957395598 Bacteria 6822399
571 2957404655 2957402308 Bacteria 6741770
572 2957409123 2957408893 Bacteria 6558585
573 2957416910 2957415311 Bacteria 6991633
574 2957426446 2957422303 Bacteria 7172205
575 2957435744 2957430029 Bacteria 7022557
576 2957437273 2957437181 Bacteria 6568994
577 2957449443 2957443900 Bacteria 6869977
578 2957452323 2957450854 Bacteria 6765715
579 2957458154 2957457609 Bacteria 6967680
580 2957469706 2957464669 Bacteria 6568877
581 2957473601 2957471148 Bacteria 6797643
582 2957480203 2957478035 Bacteria 6756658
583 2957490940 2957484790 Bacteria 6703082
584 2957496279 2957491536 Bacteria 6695180
585 2957499370 2957498199 Bacteria 7126688
586 2957509067 2957505466 Bacteria 7253085
587 2960587727 2960584000 Bacteria 6864594
588 2960591163 2960591022 Bacteria 6622873
589 2960602265 2960597568 Bacteria 6550735
590 2960609609 2960603979 Bacteria 6898737
591 2960614313 2960610863 Bacteria 6691244
592 2960623442 2960617483 Bacteria 6727748
593 2960626892 2960624210 Bacteria 6875384
594 2960636541 2960631154 Bacteria 6732508
595 2960640942 2960637947 Bacteria 7296468
596 2960651539 2960645483 Bacteria 7211087
597 2960653182 2960652885 Bacteria 7083688
598 2960665380 2960660292 Bacteria 7041660
599 2960672549 2960667422 Bacteria 6763020
600 2960676336 2960674078 Bacteria 6609048
601 2960682531 2960680706 Bacteria 6624464
602 2960692461 2960687367 Bacteria 6535474
603 2960696892 2960693952 Bacteria 6749742
604 2964609026 2964607997 Bacteria 7101408
605 2964619741 2964615318 Bacteria 6809089
606 2964628301 2964621998 Bacteria 6834995
607 2964630960 2964628898 Bacteria 7083044
608 2964642678 2964636051 Bacteria 7091832
609 2964644739 2964643177 Bacteria 6820887
610 2964651420 2964649959 Bacteria 6675118
611 2964657694 2964656573 Bacteria 7100150
612 2964666558 2964663802 Bacteria 7019362
613 2964677538 2964670856 Bacteria 6851364
614 2964679085 2964678106 Bacteria 6792020
615 2964687353 2964685014 Bacteria 6839111
616 2964698221 2964691889 Bacteria 6802758
617 2964702627 2964698721 Bacteria 6765331
618 2964705850 2964705432 Bacteria 7114648
619 2964713280 2964712639 Bacteria 6695970
620 2964722449 2964719344 Bacteria 7286602
621 2967670792 2967664464 Bacteria 6948836
622 2967677607 2967671571 Bacteria 7021409
623 2967685294 2967678726 Bacteria 7264382
624 2967690494 2967686174 Bacteria 6678622
625 2967696265 2967693043 Bacteria 6804451
626 2967701420 2967699805 Bacteria 6854538
627 2967713831 2967706974 Bacteria 7186053
628 2967719973 2967714385 Bacteria 7000047
629 2967727775 2967721400 Bacteria 7073753
630 2967732602 2967728569 Bacteria 6641507
631 2967735281 2967735183 Bacteria 6827012
632 2967742545 2967742019 Bacteria 6794534
633 2967752430 2967748971 Bacteria 6733771
634 2967759275 2967755722 Bacteria 6814706
635 2967766860 2967762386 Bacteria 6923502
636 2967770543 2967769361 Bacteria 6587838
637 2967782578 2967775926 Bacteria 6738189
638 2970021364 2970019648 Bacteria 7072033
639 2970028189 2970026789 Bacteria 6785236
640 2970035027 2970033650 Bacteria 7118744
641 2970042486 2970040964 Bacteria 6731123
642 2970053482 2970047711 Bacteria 7088379
643 2970056070 2970054988 Bacteria 6611507
644 2970061903 2970061556 Bacteria 7099761
645 2970074487 2970068827 Bacteria 7123112
646 2970079223 2970076120 Bacteria 6697332
647 2970087805 2970082768 Bacteria 6183754
648 2970089166 2970088815 Bacteria 6933825
649 2970100298 2970095765 Bacteria 6936963
650 2970103781 2970102677 Bacteria 6812532
651 2970115902 2970109326 Bacteria 6863976
652 2970121242 2970116247 Bacteria 6501857
653 2970126045 2970122695 Bacteria 6625855
654 2970130163 2970129317 Bacteria 6806560
655 2970141205 2970136068 Bacteria 7207982
656 2970146517 2970143518 Bacteria 6446480
657 2970151538 2970149975 Bacteria 6779706
658 2970158920 2970156795 Bacteria 7168044
659 2970167024 2970164137 Bacteria 6861252
660 2970173488 2970170962 Bacteria 6876229
661 2970180672 2970177841 Bacteria 6768001
662 2970191538 2970184632 Bacteria 7054431
663 2970196256 2970191845 Bacteria 7032787
664 2977519846 2977516862 Bacteria 6940108
665 2977530633 2977523885 Bacteria 6960446
666 2977534240 2977530762 Bacteria 6951399
667 2977541110 2977537788 Bacteria 6929320
668 2977548096 2977544691 Bacteria 6875412
669 2977552180 2977551784 Bacteria 7125765
670 2977560076 2977558990 Bacteria 6863948
671 2977567268 2977565890 Bacteria 6901543
672 2977574869 2977572785 Bacteria 6763888
673 2977579853 2977579622 Bacteria 6772100
674 2995392996 2995392953 Bacteria 4539380
675 2996890105 2996887358 Bacteria 5795980
676 2996895895 2996893221 Bacteria 5823108
677 3005415635 3005409236 Bacteria 7188837
678 3005418628 3005416602 Bacteria 7064308
679 639649856 639633055 Bacteria 7751309
680 648735944 648276728 Bacteria 6968865
681 8003994864 8003992118 Bacteria 7266902
682 8004002617 8003999396 Bacteria 7063185
683 8005262174 8005258706 Bacteria 6184835
684 8005281846 8005275841 Bacteria 6929066
685 8005288842 8005282627 Bacteria 6675747
686 8005294439 8005289223 Bacteria 6634003
687 8005306823 8005301065 Bacteria 6614431
688 8005310807 8005307578 Bacteria 7395396
689 8005318480 8005314921 Bacteria 7072929
690 8005324632 8005321885 Bacteria 5795980
691 8005378342 8005376324 Bacteria 6590079
692 8005401314 8005395548 Bacteria 6806915
693 8005434268 8005430974 Bacteria 6689030
694 8005464469 8005460587 Bacteria 7157962
695 8005488639 8005484373 Bacteria 6297373
696 8005501513 8005497431 Bacteria 6477605
697 8005558533 8005556819 Bacteria 6908598
698 8005566623 8005563573 Bacteria 7153261
699 8005575088 8005570704 Bacteria 6957481
700 8005622874 8005619151 Bacteria 7030230
701 8005631825 8005626139 Bacteria 6534237
702 8005649106 8005645114 Bacteria 6950293
703 8005672934 8005668836 Bacteria 6953162
704 8005682345 8005682033 Bacteria 6726518
705 8005693480 8005688590 Bacteria 6610080
706 8005700700 8005695170 Bacteria 6912330
707 8018133760 8018127388 Bacteria 7351159
708 8018170067 8018163183 Bacteria 7277977
709 8018178608 8018176218 Bacteria 6896178
710 8023687704 8023680758 Bacteria 7729763
711 8024481633 8024479707 Bacteria 6954785
712 8024506099 8024501048 Bacteria 6427847
713 8046772048 8046767195 Bacteria 7547379
714 8049295835 8049293176 Bacteria 6128433
715 8056381437 8056375014 Bacteria 7006639
716 8056386881 8056382006 Bacteria 6408074
717 8057577542 8057575449 Bacteria 7367519
718 8057876670 8057874678 Bacteria 7494653
719 Ga0307515_10009463
720 JGI24740J21852_10006079
721 JGI25155J39150_1000007
722 JGI25156J39149_1000066
723 JGI25162J39368_1000488
724 JGI25162J39368_1002218
725 JGI25154J39366_1000035
726 JGI25157J39369_1000036
727 JGI25152J39213_1009411
728 JGI25152J39213_1023396
729 JGI25159J45721_1000018
730 JGI25159J45721_1000463
731 JGI25151J46595_10001277
732 JGI25151J46595_10014951
733 JGI25165J46597_1000676
734 JGI25165J46597_1001184
735 JGI25165J46597_1008392
736 JGI25153J46596_10006550
737 rootH1_10005905
738 rootL2_10092145
739 JGI25160J50197_1000009
740 JGI25160J50197_1000100
741 JGI25160J50197_1001130
742 JGI25161J50226_1000072
743 JGI25161J50226_1000243
744 JGI25161J50226_1001812
745 Ga0055526_1001175
746 Ga0055526_1003037
747 Ga0055526_1028431
748 Ga0055524_1018143
749 Ga0055536_1000099
750 Ga0055536_1001952
751 Ga0055528_1003216
752 Ga0055528_1021390
753 Ga0055540_1004189
754 Ga0055540_1013492
755 Ga0055531_10003297
756 Ga0055531_10019675
757 Ga0055543_1000078
758 Ga0055543_1000090
759 Ga0055543_1001074
760 Ga0065165_1000020
761 Ga0065165_1000623
762 Ga0068856_100052982
763 Ga0068852_100312392
764 Ga0075365_10003910
765 Ga0075365_10004045
766 Ga0075368_10035394
767 Ga0075363_100047328
768 Ga0075364_10000330
769 Ga0075362_10013667
770 Ga0075367_10005763
771 Ga0075369_10009245
772 Ga0075370_10016622
773 Ga0105240_10000019
774 Ga0105247_10130340
775 Ga0105243_10432698
776 Ga0105237_10000734
777 Ga0123340_1050364
778 Ga0123341_1000014
779 Ga0123341_1036040
780 Ga0123342_1007767
781 Ga0123342_1011573
782 Ga0105033_107684
783 Ga0105239_10000574
784 Ga0157373_10238927
785 Ga0157370_10000131
786 Ga0157369_10429143
787 Ga0171463_1006
788 Ga0163162_10354356
789 Ga0183363_1226
790 Ga0214544_1000893
791 Ga0214542_1000115
792 Ga0214542_1010937
793 Ga0214543_1000008
794 Ga0214543_1000098
795 Ga0228711_1000003
796 Ga0228710_1000003
797 Ga0209435_100005
798 Ga0209436_102544
799 Ga0209436_103716
800 Ga0209437_100058
801 Ga0209437_100313
802 Ga0209437_112934
803 Ga0209646_1000011
804 Ga0209646_1008977
805 Ga0209026_1000008
806 Ga0209677_100475
807 Ga0209148_1004357
808 Ga0209759_1000004
809 Ga0209129_1003392
810 Ga0209233_1000157
811 Ga0209233_1000354
812 Ga0209233_1006570
813 Ga0209673_1000060
814 Ga0209673_1000233
815 Ga0209673_1001293
816 Ga0209130_1000037
817 Ga0209130_1000083
818 Ga0209676_1000239
819 Ga0209676_1004022
820 Ga0209025_1000350
821 Ga0209025_1000651
822 Ga0209025_1033052
823 Ga0209564_1000086
824 Ga0209564_1000116
825 Ga0209564_1000125
826 Ga0209758_1000839
827 Ga0209758_1001022
828 Ga0209758_1003215
829 Ga0209050_1000962
830 Ga0209256_1000302
831 Ga0209256_1001684
832 Ga0209256_1001999
833 Ga0209256_1005830
834 Ga0207426_1000048
835 Ga0207426_1000173
836 Ga0207426_1000276
837 Ga0209051_1000217
838 Ga0209051_1001815
839 Ga0209051_1003928
840 Ga0209051_1004173
841 Ga0209051_1025400
842 Ga0209257_1001228
843 Ga0209257_1002359
844 Ga0209257_1003206
845 Ga0207695_10000049
846 Ga0207671_10000423
847 Ga0207640_10067632
848 Ga0207702_10036212
849 Ga0207698_10048673
850 Ga0209281_1000081
851 Ga0209281_1000269
852 Ga0209371_1003973
853 Ga0209282_1000040
854 Ga0209813_10013166
855 Ga0307515_10000017
856 Ga0307515_10054023
857 Ga0268256_1004463
858 Ga0307513_10000829
859 Ga0307513_10033592
860 Ga0307408_100145880
861 Ga0315914_1000002
862 Ga0307414_10039372
863 Ga0307414_10114999
864 Ga0315913_1000016
865 Ga0315915_1000005
866 Ga0439436_0034242
867 Ga0439438_030189
868 Ga0439465_0003197
869 Ga0439465_0057795
870 Ga0451787_616143
871 Ga0451791_0529163
872 Ga0451793_1852513
873 Ga0451798_0835202
874 Ga0451833_0117185
875 Ga0451841_1461251
876 Ga0451845_0942005
877 Ga0451847_0170003
878 Ga0451851_0213864
879 Ga0451843_0891599
880 Ga0451853_1248573
881 Ga0439449_0004324
882 Ga0439449_0070915
883 Ga0439462_0006065
884 Ga0466966_0047708
885 Ga0466963_0006012
886 Ga0466970_0002423
887 Ga0466957_0006791
888 Ga0466958_0028939
889 Ga0495617_028766
890 Ga0495627_031944
891 Ga0495638_0000309
892 Ga0495605_0004125
893 Ga0495605_0113940
894 Ga0495585_0018203
895 Ga0495585_0052922
896 Ga0495607_0106741
897 Ga0495583_0030081
898 Ga0495606_0003931
899 Ga0495606_0032048
900 Ga0495606_0035598
901 Ga0495606_0074527
902 Ga0495606_0266018
903 Ga0495610_0085771
904 Ga0495616_0060193
905 Ga0495620_0095649
906 Ga0495631_0006384
907 Ga0495631_0054366
908 Ga0495632_0013134
909 Ga0495632_0014796
910 Ga0495648_0025552
911 Ga0495654_0000635
912 Ga0495609_0027846
913 Ga0495609_0040527
914 Ga0495633_0061755
915 Ga0495656_0061681
916 Ga0495656_0103342
917 Ga0495668_0004368
918 Ga0495611_0031165
919 Ga0495625_0004853
920 Ga0495625_0040764
921 Ga0495625_0095569
922 Ga0495670_0049044
923 Ga0495670_0094659
924 Ga0495649_0127612
925 Ga0495660_0054913
926 Ga0495660_0067645
927 Ga0495636_0020539
928 Ga0495672_0021610
929 Ga0495687_028543
930 Ga0495686_0000852
931 Ga0495686_0022338
932 Ga0495626_0048516
933 Ga0496100_0004221
934 Ga0496102_0010032
935 Ga0496103_0005927
936 Ga0496113_0109812
937 Ga0496116_0052634
938 Ga0496117_0000926
939 Ga0496118_0001977
940 Ga0496118_0014498
941 Ga0496118_0109939
942 Ga0496119_0006763
943 Ga0496119_0024898
944 Ga0496120_0007775
945 Ga0496121_0007187
946 Ga0496121_0015540
947 Ga0496121_0016496
948 Ga0496121_0076163
949 Ga0496121_0121886
950 Ga0496122_0021216
951 Ga0496122_0060045
952 Ga0496123_0010699
953 Ga0496123_0038923
954 Ga0496124_0090914
955 Ga0496125_0016120
956 Ga0496126_0376977
957 Ga0495678_036826
958 Ga0501036_0035596
959 Ga0501038_0110846
960 Ga0501043_0190510
961 Ga0501073_0029510
962 Ga0501044_0058885
963 nmdc:mga03683_5973_c1
964 nmdc:mga00v17_346_c2
965 nmdc:mga0yw44_48798_c1
966 nmdc:mga0k408_84058_c1
967 nmdc:mga06z11_258604_c1
968 Ga0500578_0027434
969 Ga0500578_0106136
970 Ga0500557_002432
971 Ga0500594_0002400
972 Ga0500618_000337
973 Ga0500618_000717
974 Ga0500618_010367
975 Ga0500658_0000832
976 Ga0500658_0049855
977 Ga0500568_0002138
978 Ga0500616_0000677
979 Ga0500616_0000980
980 Ga0500627_0020080
981 Ga0500627_0075330
982 Ga0500627_0146306
983 Ga0500636_0092910
984 2509109737
985 2509379271
986 2509389986
987 2509447777
988 2510134691
989 2510307329
990 2510842564
991 2510896042
992 2511137316
993 2511187196
994 2511502889
995 2512534131
996 2512974034
997 2513573257
998 2513578492
999 2513584109
1000 2513600734
1001 2513602249
1002 2513616995
1003 2513631470
1004 2513710597
1005 2513882008
1006 2513905526
1007 2513926818
1008 2513985479
1009 2513997979
1010 2514003892
1011 2514023420
1012 2515113782
1013 2515610453
1014 2515634645
1015 2515645311
1016 2515660884
1017 2515743504
1018 2516205129
1019 2516894294
1020 2517037393
1021 2517077693
1022 2517096492
1023 2517410588
1024 2517570902
1025 2520378256
1026 2524451760
1027 2524462055
1028 2530646809
1029 2535519584
1030 2551674714
1031 2551685476
1032 2551693774
1033 2551699651
1034 2551717348
1035 2551738973
1036 2551741354
1037 2558860311
1038 2585167900
1039 2585204870
1040 2585265484
1041 2585274144
1042 2585280446
1043 2585322719
1044 2585330838
1045 2585388415
1046 2585392313
1047 2585529603
1048 2585532674
1049 2585541163
1050 2585554310
1051 2585560593
1052 2585839926
1053 2585898803
1054 2585903609
1055 2587981271
1056 2599334840
1057 2599420689
1058 2600194662
1059 2600373772
1060 2616295414
1061 2616554798
1062 2617383479
1063 2644006257
1064 2644050964
1065 2644146686
1066 2644205467
1067 2644241707
1068 2644335903
1069 2644483868
1070 2644496267
1071 2644500325
1072 2644546762
1073 2644676858
1074 2657684088
1075 2671112052
1076 2692314619
1077 2719182462
1078 2719387119
1079 2719666765
1080 2719733181
1081 2720493185
1082 2720614662
1083 2720621435
1084 2720632763
1085 2720776487
1086 2721148575
1087 2721159961
1088 2721165389
1089 2721400754
1090 2722841559
1091 2723028075
1092 2723561706
1093 2723568335
1094 2724039567
1095 2724045937
1096 2724091094
1097 2724105600
1098 2724111426
1099 2725947678
1100 2730109011
1101 2730165697
1102 2730299593
1103 2739035715
1104 2753458718
1105 2766065476
1106 2778175872
1107 2792582651
1108 2792622891
1109 2792629144
1110 2792640501
1111 2793293786
1112 2793313204
1113 2793328132
1114 2793333229
1115 2793343824
1116 2793347232
1117 2793356631
1118 2793362908
1119 2793370065
1120 2802718008
1121 2802725141
1122 2802730735
1123 2802738082
1124 2802744048
1125 2802750927
1126 2804753223
1127 2805930700
1128 2805934173
1129 2806044702
1130 2806052902
1131 2806059202
1132 2806068135
1133 2806074255
1134 2819609744
1135 2819639843
1136 2838018962
1137 2838024438
1138 2838032991
1139 2838040637
1140 2838046395
1141 2838051322
1142 2838063700
1143 2838074271
1144 2838077330
1145 2838664975
1146 2838685106
1147 2838691473
1148 2838699057
1149 2838712538
1150 2838733432
1151 2838745996
1152 2841853708
1153 2841868327
1154 2842082015
1155 2842113591
1156 2842122937
1157 2842162285
1158 2842169841
1159 2842185211
1160 2842197757
1161 2842199981
1162 2842208159
1163 2842220228
1164 2842233698
1165 2842242160
1166 2842247742
1167 2842261990
1168 2842266468
1169 2842275947
1170 2842281832
1171 2842288936
1172 2842296015
1173 2842298554
1174 2842308069
1175 2842316161
1176 2842321548
1177 2842344851
1178 2842362406
1179 2842369370
1180 2842377173
1181 2842382414
1182 2842389815
1183 2842398675
1184 2842406397
1185 2842413176
1186 2842419819
1187 2842427895
1188 2842429787
1189 2842436553
1190 2842444256
1191 2842450883
1192 2842464208
1193 2842470882
1194 2842479724
1195 2842483532
1196 2842493116
1197 2842499314
1198 2842506900
1199 2842510584
1200 2842523083
1201 2842925966
1202 2844169124
1203 2844457647
1204 2847420330
1205 2848995142
1206 2850082209
1207 2852391036
1208 2854900371
1209 2855826930
1210 2855842325
1211 2855878538
1212 2857519058
1213 2858803141
1214 2899806538
1215 2913299739
1216 2915980449
1217 2915987752
1218 2915998997
1219 2916006166
1220 2916013006
1221 2916021542
1222 2916026467
1223 2916030511
1224 2916038415
1225 2916044826
1226 2916054083
1227 2916057483
1228 2916067027
1229 2916074528
1230 2916077378
1231 2919173259
1232 2919410536
1233 2920828602
1234 2921202921
1235 2921214580
1236 2921242589
1237 2921250188
1238 2921252267
1239 2921257546
1240 2921270371
1241 2921282904
1242 2921292590
1243 2921300951
1244 2924149310
1245 2924155460
1246 2924163250
1247 2924171837
1248 2924179322
1249 2924186271
1250 2924191606
1251 2924195003
1252 2924201634
1253 2924213505
1254 2924220826
1255 2924225774
1256 2924233369
1257 2933574518
1258 2933589119
1259 2933604727
1260 2935899881
1261 2935907050
1262 2936375019
1263 2936380710
1264 2936382121
1265 2936999933
1266 2937008214
1267 2937010947
1268 2937018281
1269 2937025764
1270 2937033110
1271 2937036612
1272 2937043319
1273 2937055693
1274 2937059073
1275 2937067455
1276 2937074765
1277 2937078515
1278 2937091345
1279 2937092432
1280 2937104941
1281 2937111736
1282 2937115051
1283 2937121438
1284 2937129428
1285 2957377554
1286 2957387661
1287 2957389894
1288 2957397412
1289 2957404655
1290 2957409123
1291 2957416910
1292 2957426446
1293 2957435744
1294 2957437273
1295 2957449443
1296 2957452323
1297 2957458154
1298 2957469706
1299 2957473601
1300 2957480203
1301 2957490940
1302 2957496279
1303 2957499370
1304 2957509067
1305 2960587727
1306 2960591163
1307 2960602265
1308 2960609609
1309 2960614313
1310 2960623442
1311 2960626892
1312 2960636541
1313 2960640942
1314 2960651539
1315 2960653182
1316 2960665380
1317 2960672549
1318 2960676336
1319 2960682531
1320 2960692461
1321 2960696892
1322 2964609026
1323 2964619741
1324 2964628301
1325 2964630960
1326 2964642678
1327 2964644739
1328 2964651420
1329 2964657694
1330 2964666558
1331 2964677538
1332 2964679085
1333 2964687353
1334 2964698221
1335 2964702627
1336 2964705850
1337 2964713280
1338 2964722449
1339 2967670792
1340 2967677607
1341 2967685294
1342 2967690494
1343 2967696265
1344 2967701420
1345 2967713831
1346 2967719973
1347 2967727775
1348 2967732602
1349 2967735281
1350 2967742545
1351 2967752430
1352 2967759275
1353 2967766860
1354 2967770543
1355 2967782578
1356 2970021364
1357 2970028189
1358 2970035027
1359 2970042486
1360 2970053482
1361 2970056070
1362 2970061903
1363 2970074487
1364 2970079223
1365 2970087805
1366 2970089166
1367 2970100298
1368 2970103781
1369 2970115902
1370 2970121242
1371 2970126045
1372 2970130163
1373 2970141205
1374 2970146517
1375 2970151538
1376 2970158920
1377 2970167024
1378 2970173488
1379 2970180672
1380 2970191538
1381 2970196256
1382 2977519846
1383 2977530633
1384 2977534240
1385 2977541110
1386 2977548096
1387 2977552180
1388 2977560076
1389 2977567268
1390 2977574869
1391 2977579853
1392 2995392996
1393 2996890105
1394 2996895895
1395 3005415635
1396 3005418628
1397 639649856
1398 648735944
1399 8003994864
1400 8004002617
1401 8005262174
1402 8005281846
1403 8005288842
1404 8005294439
1405 8005306823
1406 8005310807
1407 8005318480
1408 8005324632
1409 8005378342
1410 8005401314
1411 8005434268
1412 8005464469
1413 8005488639
1414 8005501513
1415 8005558533
1416 8005566623
1417 8005575088
1418 8005622874
1419 8005631825
1420 8005649106
1421 8005672934
1422 8005682345
1423 8005693480
1424 8005700700
1425 8018133760
1426 8018170067
1427 8018178608
1428 8023687704
1429 8024481633
1430 8024506099
1431 8046772048
1432 8049295835
1433 8056381437
1434 8056386881
1435 8057577542
1436 8057876670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01501

Glyco_transf_8

Glycosyl transferase family 8

23

152

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eql-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp 0.8293 21 271
6eqj-assembly1.cif.gz_A-2 crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant, apo form 0.8141 19 273
6eql-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp 0.8014 21 271
3u2w-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) complexed with manganese and glucose or a glucal species 0.7996 19 273
1ll0-assembly5.cif.gz_J crystal structure of rabbit muscle glycogenin 0.7975 19 273
ID Description Score Start End Superfamily
6eqlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8293 21 271 3.90.550.10
6eqlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8014 21 271 3.90.550.10
af_I1LB22_24_301_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7917 20 273 3.90.550.10
af_G5ECZ5_21_267_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7882 21 274 3.90.550.10
1ll0I00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.785 14 273 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A418SYD7-F1-model_v4 Glycosyl transferase 0.9649 9 286 GO:0016757
AF-A0A222E6E3-F1-model_v4 Glycosyl transferase family 8 0.9628 25 257 GO:0016757
AF-A0A060BY73-F1-model_v4 Glyco_transf_8 0.9599 125 252
AF-A0A4R2PQD3-F1-model_v4 Alpha-N-acetylglucosamine transferase 0.9531 19 288 GO:0016757
AF-A0A5B8L2P2-F1-model_v4 Glycosyl transferase 0.9475 14 288 GO:0016757

Map