F477181
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 322 | 1436 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0609856|Ga0395900_0609856_136_804 |
| Length | 217 |
| Sequence | MQSPPATPLRLVMVDDHEMVLHGLVAMLGHFADQVTISGQATTALVAEEEPEVVLCDVRIGRESGLDLCRQITTQYADTKVVLLTVYDDEHYLYQALRVGASGYILKRIDGQELVAHLRRVREGETVIDHALAGRVALSAARLNAGEFWPGAHLGLTQRESEVLELLVSGHSNKGVAAKLVVSEDTVKTHIRGLYRKLGVSDRSGAIAVALREGLFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 186 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 201 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 202 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 206 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 207 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 208 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 209 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 213 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 217 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 223 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 224 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 264 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 298 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 300 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 302 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 303 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 308 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 309 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 310 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 311 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 312 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 313 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 314 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 315 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 316 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 317 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 318 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 319 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 320 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 321 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 322 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.63 |
| Metatranscriptomes | 0 |
| Isolates | 2.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.67 |
| Nodule | 0.14 |
| Rhizoplane | 11.14 |
| Rhizosphere | 65.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0609856 | 3300037418 | Bacteria | 1031 |
| 2 | JGI24737J22298_10017351 | 3300001990 | Bacteria | 2320 |
| 3 | JGI24743J22301_10000706 | 3300001991 | Bacteria | 4125 |
| 4 | JGI24750J21931_1001321 | 3300002070 | Bacteria | 3121 |
| 5 | JGI24738J21930_10004733 | 3300002075 | Bacteria | 3315 |
| 6 | JGI24738J21930_10031264 | 3300002075 | Bacteria | 1086 |
| 7 | JGI24744J21845_10003959 | 3300002077 | Bacteria | 3055 |
| 8 | JGI24744J21845_10005701 | 3300002077 | Bacteria | 2580 |
| 9 | JGI24034J26672_10001252 | 3300002239 | Bacteria | 3331 |
| 10 | JGI24742J22300_10000645 | 3300002244 | Bacteria | 5252 |
| 11 | JGI24742J22300_10009587 | 3300002244 | Bacteria | 1599 |
| 12 | rootH2_10007847 | 3300003320 | Bacteria | 4332 |
| 13 | Ga0055540_1000044 | 3300003792 | Bacteria | 153394 |
| 14 | Ga0055540_1004604 | 3300003792 | Bacteria | 6124 |
| 15 | Ga0055540_1011097 | 3300003792 | Bacteria | 2939 |
| 16 | Ga0070658_10341471 | 3300005327 | Bacteria | 1281 |
| 17 | Ga0070683_100143368 | 3300005329 | Bacteria | 2263 |
| 18 | Ga0070690_100011762 | 3300005330 | Bacteria | 5130 |
| 19 | Ga0070677_10308029 | 3300005333 | Bacteria | 807 |
| 20 | Ga0068869_100395891 | 3300005334 | Bacteria | 1135 |
| 21 | Ga0070666_10089765 | 3300005335 | Bacteria | 2110 |
| 22 | Ga0070666_10239736 | 3300005335 | Bacteria | 1282 |
| 23 | Ga0070666_10421395 | 3300005335 | Bacteria | 961 |
| 24 | Ga0070682_100004933 | 3300005337 | Bacteria | 7408 |
| 25 | Ga0070682_100010131 | 3300005337 | Bacteria | 5344 |
| 26 | Ga0068868_100002812 | 3300005338 | Bacteria | 12059 |
| 27 | Ga0068868_100082181 | 3300005338 | Bacteria | 2583 |
| 28 | Ga0070689_100052956 | 3300005340 | Bacteria | 3140 |
| 29 | Ga0070689_100072816 | 3300005340 | Bacteria | 2686 |
| 30 | Ga0070691_10005230 | 3300005341 | Bacteria | 5894 |
| 31 | Ga0070691_10222286 | 3300005341 | Bacteria | 1001 |
| 32 | Ga0070692_10039242 | 3300005345 | Bacteria | 2417 |
| 33 | Ga0070668_100005941 | 3300005347 | Bacteria | 9049 |
| 34 | Ga0070668_100043134 | 3300005347 | Bacteria | 3459 |
| 35 | Ga0070668_100414938 | 3300005347 | Bacteria | 1152 |
| 36 | Ga0070669_100012086 | 3300005353 | Bacteria | 6128 |
| 37 | Ga0070669_100207659 | 3300005353 | Bacteria | 1544 |
| 38 | Ga0070669_100294549 | 3300005353 | Bacteria | 1304 |
| 39 | Ga0070671_100107568 | 3300005355 | Bacteria | 2342 |
| 40 | Ga0070674_100003739 | 3300005356 | Bacteria | 8583 |
| 41 | Ga0070674_100066583 | 3300005356 | Bacteria | 2531 |
| 42 | Ga0070674_100109314 | 3300005356 | Bacteria | 2027 |
| 43 | Ga0070688_100008640 | 3300005365 | Bacteria | 5543 |
| 44 | Ga0070688_100084050 | 3300005365 | Bacteria | 2067 |
| 45 | Ga0070659_100024813 | 3300005366 | Bacteria | 4599 |
| 46 | Ga0070659_100082462 | 3300005366 | Bacteria | 2569 |
| 47 | Ga0070667_100000074 | 3300005367 | Bacteria | 121299 |
| 48 | Ga0070667_100005546 | 3300005367 | Bacteria | 10529 |
| 49 | Ga0070667_100014115 | 3300005367 | Bacteria | 6601 |
| 50 | Ga0070667_100293555 | 3300005367 | Bacteria | 1462 |
| 51 | Ga0070667_100450152 | 3300005367 | Bacteria | 1176 |
| 52 | Ga0070709_10113631 | 3300005434 | Bacteria | 1824 |
| 53 | Ga0070714_100393188 | 3300005435 | Bacteria | 1309 |
| 54 | Ga0070713_100013669 | 3300005436 | Bacteria | 6000 |
| 55 | Ga0070710_10001139 | 3300005437 | Bacteria | 12601 |
| 56 | Ga0070710_10391999 | 3300005437 | Bacteria | 929 |
| 57 | Ga0070701_10004473 | 3300005438 | Bacteria | 5672 |
| 58 | Ga0070711_100000479 | 3300005439 | Bacteria | 20826 |
| 59 | Ga0070711_100001760 | 3300005439 | Bacteria | 12019 |
| 60 | Ga0070711_100221420 | 3300005439 | Bacteria | 1471 |
| 61 | Ga0070705_100092914 | 3300005440 | Bacteria | 1884 |
| 62 | Ga0070705_100217602 | 3300005440 | Bacteria | 1321 |
| 63 | Ga0070700_100010521 | 3300005441 | Bacteria | 5112 |
| 64 | Ga0070694_100282211 | 3300005444 | Bacteria | 1266 |
| 65 | Ga0070663_100028178 | 3300005455 | Bacteria | 3821 |
| 66 | Ga0070663_100085485 | 3300005455 | Bacteria | 2328 |
| 67 | Ga0070663_100152471 | 3300005455 | Bacteria | 1773 |
| 68 | Ga0070663_100173251 | 3300005455 | Bacteria | 1669 |
| 69 | Ga0070663_100258765 | 3300005455 | Bacteria | 1380 |
| 70 | Ga0070678_100000595 | 3300005456 | Bacteria | 17762 |
| 71 | Ga0070662_100063895 | 3300005457 | Bacteria | 2694 |
| 72 | Ga0068867_100001973 | 3300005459 | Bacteria | 14304 |
| 73 | Ga0068867_100153185 | 3300005459 | Bacteria | 1812 |
| 74 | Ga0070685_10113710 | 3300005466 | Bacteria | 1672 |
| 75 | Ga0070685_10126078 | 3300005466 | Bacteria | 1595 |
| 76 | Ga0070706_100005214 | 3300005467 | Bacteria | 12398 |
| 77 | Ga0070698_100002967 | 3300005471 | Bacteria | 18663 |
| 78 | Ga0070679_100764772 | 3300005530 | Bacteria | 909 |
| 79 | Ga0070684_100045721 | 3300005535 | Bacteria | 3791 |
| 80 | Ga0068853_100013047 | 3300005539 | Bacteria | 6776 |
| 81 | Ga0068853_100027722 | 3300005539 | Bacteria | 4761 |
| 82 | Ga0068853_100087726 | 3300005539 | Bacteria | 2730 |
| 83 | Ga0068853_100188058 | 3300005539 | Bacteria | 1875 |
| 84 | Ga0068853_100748885 | 3300005539 | Bacteria | 934 |
| 85 | Ga0070672_100067670 | 3300005543 | Bacteria | 2830 |
| 86 | Ga0070672_100403508 | 3300005543 | Bacteria | 1172 |
| 87 | Ga0070686_100275487 | 3300005544 | Bacteria | 1239 |
| 88 | Ga0070695_100024200 | 3300005545 | Bacteria | 3739 |
| 89 | Ga0070696_100081372 | 3300005546 | Bacteria | 2295 |
| 90 | Ga0070693_100124355 | 3300005547 | Bacteria | 1604 |
| 91 | Ga0070693_100227826 | 3300005547 | Bacteria | 1225 |
| 92 | Ga0070665_100004155 | 3300005548 | Bacteria | 15236 |
| 93 | Ga0070665_100005707 | 3300005548 | Bacteria | 12778 |
| 94 | Ga0070665_100019535 | 3300005548 | Bacteria | 6802 |
| 95 | Ga0070665_100057570 | 3300005548 | Bacteria | 3896 |
| 96 | Ga0070665_100141611 | 3300005548 | Bacteria | 2408 |
| 97 | Ga0070704_100000666 | 3300005549 | Bacteria | 16615 |
| 98 | Ga0070704_100135752 | 3300005549 | Bacteria | 1913 |
| 99 | Ga0068855_100108707 | 3300005563 | Bacteria | 3185 |
| 100 | Ga0068855_100398404 | 3300005563 | Bacteria | 1509 |
| 101 | Ga0068857_100395612 | 3300005577 | Bacteria | 1285 |
| 102 | Ga0068854_100003429 | 3300005578 | Bacteria | 9883 |
| 103 | Ga0068854_100304584 | 3300005578 | Bacteria | 1290 |
| 104 | Ga0070702_100071437 | 3300005615 | Bacteria | 2051 |
| 105 | Ga0068852_100149584 | 3300005616 | Bacteria | 2170 |
| 106 | Ga0068859_100000567 | 3300005617 | Bacteria | 36774 |
| 107 | Ga0068859_100012214 | 3300005617 | Bacteria | 8634 |
| 108 | Ga0068859_100444675 | 3300005617 | Bacteria | 1392 |
| 109 | Ga0068864_100050538 | 3300005618 | Bacteria | 3579 |
| 110 | Ga0068864_100322235 | 3300005618 | Bacteria | 1452 |
| 111 | Ga0068864_100380874 | 3300005618 | Bacteria | 1337 |
| 112 | Ga0068864_100568416 | 3300005618 | Bacteria | 1098 |
| 113 | Ga0068864_100730701 | 3300005618 | Bacteria | 969 |
| 114 | Ga0068866_10001475 | 3300005718 | Bacteria | 10029 |
| 115 | Ga0068866_10007613 | 3300005718 | Bacteria | 4539 |
| 116 | Ga0068861_100029389 | 3300005719 | Bacteria | 4021 |
| 117 | Ga0068861_100279129 | 3300005719 | Bacteria | 1438 |
| 118 | Ga0068851_10024994 | 3300005834 | Bacteria | 2928 |
| 119 | Ga0068863_100001963 | 3300005841 | Bacteria | 20438 |
| 120 | Ga0068863_100002994 | 3300005841 | Bacteria | 16700 |
| 121 | Ga0068863_100150728 | 3300005841 | Bacteria | 2225 |
| 122 | Ga0068858_100015365 | 3300005842 | Bacteria | 7200 |
| 123 | Ga0068858_100092957 | 3300005842 | Bacteria | 2808 |
| 124 | Ga0068860_100000276 | 3300005843 | Bacteria | 74447 |
| 125 | Ga0068860_100011255 | 3300005843 | Bacteria | 8817 |
| 126 | Ga0068862_100000065 | 3300005844 | Bacteria | 124435 |
| 127 | Ga0068862_100099705 | 3300005844 | Bacteria | 2539 |
| 128 | Ga0068862_100980316 | 3300005844 | Bacteria | 835 |
| 129 | Ga0081455_10041314 | 3300005937 | Bacteria | 4057 |
| 130 | Ga0081455_10068507 | 3300005937 | Bacteria | 2953 |
| 131 | Ga0081455_10096638 | 3300005937 | Bacteria | 2382 |
| 132 | Ga0081540_1119944 | 3300005983 | Bacteria | 1093 |
| 133 | Ga0070717_10073663 | 3300006028 | Bacteria | 2854 |
| 134 | Ga0070717_10118701 | 3300006028 | Bacteria | 2264 |
| 135 | Ga0070717_10210554 | 3300006028 | Bacteria | 1706 |
| 136 | Ga0075365_10109707 | 3300006038 | Bacteria | 1896 |
| 137 | Ga0075365_10398454 | 3300006038 | Bacteria | 971 |
| 138 | Ga0075368_10096850 | 3300006042 | Bacteria | 1209 |
| 139 | Ga0075363_100000288 | 3300006048 | Bacteria | 14614 |
| 140 | Ga0075363_100016182 | 3300006048 | Bacteria | 3680 |
| 141 | Ga0075363_100025973 | 3300006048 | Bacteria | 2993 |
| 142 | Ga0075363_100122047 | 3300006048 | Bacteria | 1456 |
| 143 | Ga0075364_10000591 | 3300006051 | Bacteria | 18727 |
| 144 | Ga0075364_10004624 | 3300006051 | Bacteria | 7934 |
| 145 | Ga0075364_10027240 | 3300006051 | Bacteria | 3649 |
| 146 | Ga0075364_10342981 | 3300006051 | Bacteria | 1018 |
| 147 | Ga0070716_100050770 | 3300006173 | Bacteria | 2356 |
| 148 | Ga0070712_100002669 | 3300006175 | Bacteria | 11008 |
| 149 | Ga0070712_100007238 | 3300006175 | Bacteria | 6924 |
| 150 | Ga0070712_100114627 | 3300006175 | Bacteria | 2018 |
| 151 | Ga0075362_10004246 | 3300006177 | Bacteria | 5120 |
| 152 | Ga0075362_10020527 | 3300006177 | Bacteria | 2761 |
| 153 | Ga0075362_10142229 | 3300006177 | Bacteria | 1147 |
| 154 | Ga0075367_10004233 | 3300006178 | Bacteria | 6969 |
| 155 | Ga0075367_10155463 | 3300006178 | Bacteria | 1421 |
| 156 | Ga0075369_10000174 | 3300006186 | Bacteria | 18341 |
| 157 | Ga0075369_10000333 | 3300006186 | Bacteria | 14045 |
| 158 | Ga0075369_10001566 | 3300006186 | Bacteria | 7846 |
| 159 | Ga0075369_10002203 | 3300006186 | Bacteria | 6896 |
| 160 | Ga0075369_10008524 | 3300006186 | Bacteria | 3947 |
| 161 | Ga0075369_10013179 | 3300006186 | Bacteria | 3275 |
| 162 | Ga0075369_10020744 | 3300006186 | Bacteria | 2693 |
| 163 | Ga0075369_10034370 | 3300006186 | Bacteria | 2151 |
| 164 | Ga0075369_10036600 | 3300006186 | Bacteria | 2088 |
| 165 | Ga0075369_10042723 | 3300006186 | Bacteria | 1943 |
| 166 | Ga0075369_10048526 | 3300006186 | Bacteria | 1832 |
| 167 | Ga0075369_10118775 | 3300006186 | Bacteria | 1196 |
| 168 | Ga0075369_10289448 | 3300006186 | Bacteria | 764 |
| 169 | Ga0075366_10322339 | 3300006195 | Bacteria | 947 |
| 170 | Ga0097621_100100697 | 3300006237 | Bacteria | 2431 |
| 171 | Ga0075370_10045146 | 3300006353 | Bacteria | 2492 |
| 172 | Ga0075370_10048459 | 3300006353 | Bacteria | 2407 |
| 173 | Ga0075370_10117729 | 3300006353 | Bacteria | 1545 |
| 174 | Ga0075370_10141055 | 3300006353 | Bacteria | 1409 |
| 175 | Ga0075370_10201464 | 3300006353 | Bacteria | 1174 |
| 176 | Ga0068871_100132570 | 3300006358 | Bacteria | 2114 |
| 177 | Ga0068871_100359902 | 3300006358 | Bacteria | 1289 |
| 178 | Ga0075428_100023896 | 3300006844 | Bacteria | 6763 |
| 179 | Ga0075430_100003713 | 3300006846 | Bacteria | 12831 |
| 180 | Ga0075431_100177920 | 3300006847 | Bacteria | 2184 |
| 181 | Ga0068865_100016530 | 3300006881 | Bacteria | 4724 |
| 182 | Ga0068865_100150829 | 3300006881 | Bacteria | 1763 |
| 183 | Ga0097620_100000567 | 3300006931 | Bacteria | 36774 |
| 184 | Ga0097620_100012214 | 3300006931 | Bacteria | 8634 |
| 185 | Ga0097620_100444628 | 3300006931 | Bacteria | 1392 |
| 186 | Ga0099795_10003237 | 3300007788 | Bacteria | 4006 |
| 187 | Ga0105250_10073552 | 3300009092 | Bacteria | 1382 |
| 188 | Ga0105245_10004418 | 3300009098 | Bacteria | 12440 |
| 189 | Ga0105245_10187753 | 3300009098 | Bacteria | 1978 |
| 190 | Ga0105245_10247155 | 3300009098 | Bacteria | 1732 |
| 191 | Ga0105247_10000017 | 3300009101 | Bacteria | 260438 |
| 192 | Ga0105247_10002837 | 3300009101 | Bacteria | 11562 |
| 193 | Ga0105247_10103865 | 3300009101 | Bacteria | 1820 |
| 194 | Ga0105247_10158216 | 3300009101 | Bacteria | 1498 |
| 195 | Ga0114129_10089982 | 3300009147 | Bacteria | 4255 |
| 196 | Ga0105243_10005087 | 3300009148 | Bacteria | 10316 |
| 197 | Ga0105243_10018750 | 3300009148 | Bacteria | 5241 |
| 198 | Ga0105243_10151180 | 3300009148 | Bacteria | 1992 |
| 199 | Ga0105243_10422207 | 3300009148 | Bacteria | 1244 |
| 200 | Ga0105241_10020983 | 3300009174 | Bacteria | 4828 |
| 201 | Ga0105242_10001113 | 3300009176 | Bacteria | 21179 |
| 202 | Ga0105242_10029712 | 3300009176 | Bacteria | 4359 |
| 203 | Ga0105248_10000194 | 3300009177 | Bacteria | 70286 |
| 204 | Ga0105248_10003348 | 3300009177 | Bacteria | 17817 |
| 205 | Ga0105248_10019251 | 3300009177 | Bacteria | 7553 |
| 206 | Ga0105237_10003695 | 3300009545 | Bacteria | 18037 |
| 207 | Ga0105237_10057089 | 3300009545 | Bacteria | 3907 |
| 208 | Ga0105237_10134668 | 3300009545 | Bacteria | 2465 |
| 209 | Ga0105238_10089712 | 3300009551 | Bacteria | 3061 |
| 210 | Ga0105238_10216295 | 3300009551 | Bacteria | 1892 |
| 211 | Ga0105249_10000096 | 3300009553 | Bacteria | 121083 |
| 212 | Ga0105249_10001976 | 3300009553 | Bacteria | 17791 |
| 213 | Ga0105249_10160009 | 3300009553 | Bacteria | 2175 |
| 214 | Ga0105032_102023 | 3300009979 | Bacteria | 1833 |
| 215 | Ga0105239_10009981 | 3300010375 | Bacteria | 10657 |
| 216 | Ga0105239_10010576 | 3300010375 | Bacteria | 10315 |
| 217 | Ga0105239_10126490 | 3300010375 | Bacteria | 2841 |
| 218 | Ga0105239_10141106 | 3300010375 | Bacteria | 2685 |
| 219 | Ga0105239_10515987 | 3300010375 | Bacteria | 1359 |
| 220 | Ga0105246_10019937 | 3300011119 | Bacteria | 4296 |
| 221 | Ga0105246_10250843 | 3300011119 | Bacteria | 1404 |
| 222 | Ga0105246_10327228 | 3300011119 | Bacteria | 1248 |
| 223 | Ga0157369_10353423 | 3300013105 | Bacteria | 1526 |
| 224 | Ga0157374_10132704 | 3300013296 | Bacteria | 2411 |
| 225 | Ga0157374_10183972 | 3300013296 | Bacteria | 2042 |
| 226 | Ga0157378_10006478 | 3300013297 | Bacteria | 10239 |
| 227 | Ga0157378_10233861 | 3300013297 | Bacteria | 1752 |
| 228 | Ga0163162_10005025 | 3300013306 | Bacteria | 12742 |
| 229 | Ga0163162_10016373 | 3300013306 | Bacteria | 7247 |
| 230 | Ga0163162_10322630 | 3300013306 | Bacteria | 1677 |
| 231 | Ga0157372_10007458 | 3300013307 | Bacteria | 11634 |
| 232 | Ga0157375_10014077 | 3300013308 | Bacteria | 7132 |
| 233 | Ga0157375_10565307 | 3300013308 | Bacteria | 1298 |
| 234 | Ga0163163_10613719 | 3300014325 | Bacteria | 1151 |
| 235 | Ga0157380_10000771 | 3300014326 | Bacteria | 20026 |
| 236 | Ga0157377_10248506 | 3300014745 | Bacteria | 1152 |
| 237 | Ga0157379_10006231 | 3300014968 | Bacteria | 10271 |
| 238 | Ga0157379_10066922 | 3300014968 | Bacteria | 3212 |
| 239 | Ga0157379_10219308 | 3300014968 | Bacteria | 1723 |
| 240 | Ga0157376_10335131 | 3300014969 | Bacteria | 1443 |
| 241 | Ga0163161_10002358 | 3300017792 | Bacteria | 13536 |
| 242 | Ga0163161_10324756 | 3300017792 | Bacteria | 1217 |
| 243 | Ga0213873_10000038 | 3300021358 | Bacteria | 33361 |
| 244 | Ga0213876_10028698 | 3300021384 | Bacteria | 2934 |
| 245 | Ga0213876_10055427 | 3300021384 | Bacteria | 2093 |
| 246 | Ga0213875_10000221 | 3300021388 | Bacteria | 57905 |
| 247 | Ga0213875_10005568 | 3300021388 | Bacteria | 6739 |
| 248 | Ga0213875_10026048 | 3300021388 | Bacteria | 2784 |
| 249 | Ga0213875_10038185 | 3300021388 | Bacteria | 2263 |
| 250 | Ga0209051_1000051 | 3300025303 | Bacteria | 283620 |
| 251 | Ga0209051_1001135 | 3300025303 | Bacteria | 24362 |
| 252 | Ga0209051_1001817 | 3300025303 | Bacteria | 16890 |
| 253 | Ga0209051_1005060 | 3300025303 | Bacteria | 7845 |
| 254 | Ga0209051_1021362 | 3300025303 | Bacteria | 2759 |
| 255 | Ga0207656_10035805 | 3300025321 | Bacteria | 2080 |
| 256 | Ga0207692_10113223 | 3300025898 | Bacteria | 1508 |
| 257 | Ga0207692_10135001 | 3300025898 | Bacteria | 1398 |
| 258 | Ga0207642_10000124 | 3300025899 | Bacteria | 21177 |
| 259 | Ga0207710_10000033 | 3300025900 | Bacteria | 260531 |
| 260 | Ga0207710_10020186 | 3300025900 | Bacteria | 2848 |
| 261 | Ga0207710_10076557 | 3300025900 | Bacteria | 1544 |
| 262 | Ga0207688_10002685 | 3300025901 | Bacteria | 9627 |
| 263 | Ga0207688_10010477 | 3300025901 | Bacteria | 5044 |
| 264 | Ga0207688_10162469 | 3300025901 | Bacteria | 1325 |
| 265 | Ga0207680_10064428 | 3300025903 | Bacteria | 2247 |
| 266 | Ga0207680_10406204 | 3300025903 | Bacteria | 963 |
| 267 | Ga0207647_10114642 | 3300025904 | Bacteria | 1592 |
| 268 | Ga0207647_10160814 | 3300025904 | Bacteria | 1310 |
| 269 | Ga0207685_10009785 | 3300025905 | Bacteria | 2800 |
| 270 | Ga0207685_10169387 | 3300025905 | Bacteria | 1004 |
| 271 | Ga0207699_10147306 | 3300025906 | Bacteria | 1554 |
| 272 | Ga0207699_10172634 | 3300025906 | Bacteria | 1447 |
| 273 | Ga0207645_10012184 | 3300025907 | Bacteria | 5839 |
| 274 | Ga0207705_10308731 | 3300025909 | Bacteria | 1214 |
| 275 | Ga0207684_10024027 | 3300025910 | Bacteria | 5200 |
| 276 | Ga0207671_10052330 | 3300025914 | Bacteria | 3026 |
| 277 | Ga0207671_10179486 | 3300025914 | Bacteria | 1647 |
| 278 | Ga0207693_10001826 | 3300025915 | Bacteria | 18674 |
| 279 | Ga0207693_10002737 | 3300025915 | Bacteria | 15258 |
| 280 | Ga0207663_10045487 | 3300025916 | Bacteria | 2700 |
| 281 | Ga0207662_10057602 | 3300025918 | Bacteria | 2323 |
| 282 | Ga0207657_10130362 | 3300025919 | Bacteria | 2061 |
| 283 | Ga0207652_10137439 | 3300025921 | Bacteria | 2183 |
| 284 | Ga0207646_10174525 | 3300025922 | Bacteria | 1941 |
| 285 | Ga0207681_10000849 | 3300025923 | Bacteria | 20076 |
| 286 | Ga0207681_10150685 | 3300025923 | Bacteria | 1742 |
| 287 | Ga0207681_10349725 | 3300025923 | Bacteria | 1183 |
| 288 | Ga0207687_10010419 | 3300025927 | Bacteria | 6075 |
| 289 | Ga0207687_10179027 | 3300025927 | Bacteria | 1641 |
| 290 | Ga0207687_10194310 | 3300025927 | Bacteria | 1582 |
| 291 | Ga0207700_10110539 | 3300025928 | Bacteria | 2210 |
| 292 | Ga0207664_10059924 | 3300025929 | Bacteria | 3033 |
| 293 | Ga0207664_10226189 | 3300025929 | Bacteria | 1625 |
| 294 | Ga0207664_10300802 | 3300025929 | Bacteria | 1411 |
| 295 | Ga0207664_10321252 | 3300025929 | Bacteria | 1366 |
| 296 | Ga0207664_10326770 | 3300025929 | Bacteria | 1354 |
| 297 | Ga0207644_10002040 | 3300025931 | Bacteria | 13075 |
| 298 | Ga0207644_10077123 | 3300025931 | Bacteria | 2453 |
| 299 | Ga0207644_10459048 | 3300025931 | Bacteria | 1047 |
| 300 | Ga0207690_10075037 | 3300025932 | Bacteria | 2344 |
| 301 | Ga0207690_10701268 | 3300025932 | Bacteria | 832 |
| 302 | Ga0207690_10859480 | 3300025932 | Bacteria | 751 |
| 303 | Ga0207706_10112691 | 3300025933 | Bacteria | 2393 |
| 304 | Ga0207709_10013600 | 3300025935 | Bacteria | 4490 |
| 305 | Ga0207670_10006196 | 3300025936 | Bacteria | 6620 |
| 306 | Ga0207670_10046367 | 3300025936 | Bacteria | 2887 |
| 307 | Ga0207669_10018039 | 3300025937 | Bacteria | 3636 |
| 308 | Ga0207669_10046129 | 3300025937 | Bacteria | 2573 |
| 309 | Ga0207704_10000291 | 3300025938 | Bacteria | 23769 |
| 310 | Ga0207665_10011867 | 3300025939 | Bacteria | 5721 |
| 311 | Ga0207665_10029835 | 3300025939 | Bacteria | 3604 |
| 312 | Ga0207691_10069745 | 3300025940 | Bacteria | 3175 |
| 313 | Ga0207691_10422044 | 3300025940 | Bacteria | 1137 |
| 314 | Ga0207711_10000169 | 3300025941 | Bacteria | 70227 |
| 315 | Ga0207711_10027770 | 3300025941 | Bacteria | 4756 |
| 316 | Ga0207711_10053624 | 3300025941 | Bacteria | 3458 |
| 317 | Ga0207711_10113240 | 3300025941 | Bacteria | 2415 |
| 318 | Ga0207689_10034774 | 3300025942 | Bacteria | 4184 |
| 319 | Ga0207689_10235673 | 3300025942 | Bacteria | 1513 |
| 320 | Ga0207661_10311455 | 3300025944 | Bacteria | 1413 |
| 321 | Ga0207667_10163989 | 3300025949 | Bacteria | 2285 |
| 322 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 323 | Ga0207712_10014365 | 3300025961 | Bacteria | 5094 |
| 324 | Ga0207712_10120297 | 3300025961 | Bacteria | 1986 |
| 325 | Ga0207668_10076093 | 3300025972 | Bacteria | 2415 |
| 326 | Ga0207668_10077003 | 3300025972 | Bacteria | 2403 |
| 327 | Ga0207668_10101294 | 3300025972 | Bacteria | 2140 |
| 328 | Ga0207668_10930932 | 3300025972 | Bacteria | 774 |
| 329 | Ga0207640_10007670 | 3300025981 | Bacteria | 5962 |
| 330 | Ga0207640_10164672 | 3300025981 | Bacteria | 1645 |
| 331 | Ga0207658_10000321 | 3300025986 | Bacteria | 48316 |
| 332 | Ga0207658_10002978 | 3300025986 | Bacteria | 12110 |
| 333 | Ga0207658_10024173 | 3300025986 | Bacteria | 4248 |
| 334 | Ga0207658_10169047 | 3300025986 | Bacteria | 1799 |
| 335 | Ga0207658_10192238 | 3300025986 | Bacteria | 1697 |
| 336 | Ga0207658_10255424 | 3300025986 | Bacteria | 1491 |
| 337 | Ga0207677_10005597 | 3300026023 | Bacteria | 6826 |
| 338 | Ga0207703_10027480 | 3300026035 | Bacteria | 4481 |
| 339 | Ga0207703_10549731 | 3300026035 | Bacteria | 1089 |
| 340 | Ga0207703_10843456 | 3300026035 | Bacteria | 876 |
| 341 | Ga0207678_10008103 | 3300026067 | Bacteria | 9266 |
| 342 | Ga0207678_10018663 | 3300026067 | Bacteria | 6089 |
| 343 | Ga0207678_10038498 | 3300026067 | Bacteria | 4155 |
| 344 | Ga0207678_10100697 | 3300026067 | Bacteria | 2468 |
| 345 | Ga0207678_10209133 | 3300026067 | Bacteria | 1669 |
| 346 | Ga0207708_10002264 | 3300026075 | Bacteria | 14185 |
| 347 | Ga0207708_10024779 | 3300026075 | Bacteria | 4539 |
| 348 | Ga0207641_10001342 | 3300026088 | Bacteria | 24372 |
| 349 | Ga0207641_10005082 | 3300026088 | Bacteria | 11277 |
| 350 | Ga0207641_10165747 | 3300026088 | Bacteria | 2012 |
| 351 | Ga0207648_10002008 | 3300026089 | Bacteria | 22201 |
| 352 | Ga0207676_10042274 | 3300026095 | Bacteria | 3505 |
| 353 | Ga0207676_10261453 | 3300026095 | Bacteria | 1563 |
| 354 | Ga0207676_10302924 | 3300026095 | Bacteria | 1460 |
| 355 | Ga0207676_10351881 | 3300026095 | Bacteria | 1362 |
| 356 | Ga0207676_10770159 | 3300026095 | Bacteria | 937 |
| 357 | Ga0207674_10078136 | 3300026116 | Bacteria | 3315 |
| 358 | Ga0207675_100003453 | 3300026118 | Bacteria | 15445 |
| 359 | Ga0207675_100105439 | 3300026118 | Bacteria | 2657 |
| 360 | Ga0207675_100132073 | 3300026118 | Bacteria | 2368 |
| 361 | Ga0207675_100703811 | 3300026118 | Bacteria | 1019 |
| 362 | Ga0207683_10003523 | 3300026121 | Bacteria | 13651 |
| 363 | Ga0207683_10082669 | 3300026121 | Bacteria | 2853 |
| 364 | Ga0207683_10093099 | 3300026121 | Bacteria | 2685 |
| 365 | Ga0207683_10479874 | 3300026121 | Bacteria | 1147 |
| 366 | Ga0207698_10490636 | 3300026142 | Bacteria | 1193 |
| 367 | Ga0209813_10009588 | 3300027866 | Bacteria | 2482 |
| 368 | Ga0268266_10002162 | 3300028379 | Bacteria | 21575 |
| 369 | Ga0268266_10014326 | 3300028379 | Bacteria | 6818 |
| 370 | Ga0268266_10051711 | 3300028379 | Bacteria | 3527 |
| 371 | Ga0268266_10063446 | 3300028379 | Bacteria | 3189 |
| 372 | Ga0268266_10072953 | 3300028379 | Bacteria | 2978 |
| 373 | Ga0268266_10108442 | 3300028379 | Bacteria | 2457 |
| 374 | Ga0268265_10000022 | 3300028380 | Bacteria | 270788 |
| 375 | Ga0268265_10113828 | 3300028380 | Bacteria | 2214 |
| 376 | Ga0268265_11081860 | 3300028380 | Bacteria | 795 |
| 377 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 378 | Ga0268264_10002955 | 3300028381 | Bacteria | 14764 |
| 379 | Ga0265327_10005197 | 3300031251 | Bacteria | 11000 |
| 380 | Ga0307513_10566709 | 3300031456 | Bacteria | 847 |
| 381 | Ga0307509_10080875 | 3300031507 | Bacteria | 3359 |
| 382 | Ga0307413_10123549 | 3300031824 | Bacteria | 1758 |
| 383 | Ga0307410_10281340 | 3300031852 | Bacteria | 1305 |
| 384 | Ga0307409_100174129 | 3300031995 | Bacteria | 1897 |
| 385 | Ga0307409_100213604 | 3300031995 | Bacteria | 1736 |
| 386 | Ga0307409_100708557 | 3300031995 | Bacteria | 1007 |
| 387 | Ga0307416_100019535 | 3300032002 | Bacteria | 4807 |
| 388 | Ga0307411_10247877 | 3300032005 | Bacteria | 1399 |
| 389 | Ga0307415_100033139 | 3300032126 | Bacteria | 3351 |
| 390 | Ga0316583_10087685 | 3300032133 | Bacteria | 1086 |
| 391 | Ga0373948_0017955 | 3300034817 | Bacteria | 1324 |
| 392 | Ga0373932_0012097 | 3300035112 | Bacteria | 2121 |
| 393 | Ga0373939_0180308 | 3300035114 | Bacteria | 787 |
| 394 | Ga0373941_0050039 | 3300035115 | Bacteria | 1325 |
| 395 | Ga0373960_0148312 | 3300035121 | Bacteria | 799 |
| 396 | Ga0373942_0011297 | 3300035207 | Bacteria | 2116 |
| 397 | Ga0373962_0029125 | 3300035242 | Bacteria | 1503 |
| 398 | Ga0373931_0036011 | 3300035691 | Bacteria | 2577 |
| 399 | Ga0316582_0446940 | 3300036647 | Bacteria | 891 |
| 400 | Ga0316584_0105339 | 3300036712 | Bacteria | 2110 |
| 401 | Ga0373925_0000465 | 3300037068 | Bacteria | 40706 |
| 402 | Ga0395898_0014341 | 3300037466 | Bacteria | 8145 |
| 403 | Ga0395898_0950810 | 3300037466 | Bacteria | 796 |
| 404 | Ga0436364_0109597 | 3300037853 | Bacteria | 56310 |
| 405 | Ga0436364_0166911 | 3300037853 | Bacteria | 14228 |
| 406 | Ga0436364_0674082 | 3300037853 | Bacteria | 2694 |
| 407 | Ga0395901_0033443 | 3300038443 | Bacteria | 5309 |
| 408 | Ga0400485_05417 | 3300038735 | Bacteria | 29589 |
| 409 | Ga0400488_13710 | 3300038741 | Bacteria | 2490 |
| 410 | Ga0400486_22540 | 3300038742 | Bacteria | 84879 |
| 411 | Ga0436365_0889838 | 3300039437 | Bacteria | 6711 |
| 412 | Ga0436365_1189683 | 3300039437 | Bacteria | 5254 |
| 413 | Ga0436365_1842056 | 3300039437 | Bacteria | 4812 |
| 414 | Ga0436363_0792619 | 3300039450 | Bacteria | 1024 |
| 415 | Ga0436363_0952188 | 3300039450 | Bacteria | 1272 |
| 416 | Ga0436362_1280188 | 3300039453 | Bacteria | 53853 |
| 417 | Ga0439461_0000185 | 3300041410 | Bacteria | 8524 |
| 418 | Ga0439466_0005710 | 3300041411 | Bacteria | 4744 |
| 419 | Ga0439465_0000060 | 3300041413 | Bacteria | 23285 |
| 420 | Ga0439465_0105929 | 3300041413 | Bacteria | 974 |
| 421 | Ga0451791_0149111 | 3300041451 | Bacteria | 884 |
| 422 | Ga0451793_0748559 | 3300041452 | Bacteria | 1366 |
| 423 | Ga0451841_0274634 | 3300041498 | Bacteria | 1010 |
| 424 | Ga0439442_026321 | 3300042002 | Bacteria | 1211 |
| 425 | Ga0439445_0006212 | 3300042004 | Bacteria | 2743 |
| 426 | Ga0439445_0025196 | 3300042004 | Bacteria | 1516 |
| 427 | Ga0439434_0008822 | 3300042435 | Bacteria | 2963 |
| 428 | Ga0439434_0013038 | 3300042435 | Bacteria | 2465 |
| 429 | Ga0439435_0069657 | 3300042436 | Bacteria | 1040 |
| 430 | Ga0466972_0004246 | 3300044658 | Bacteria | 7163 |
| 431 | Ga0466972_0006240 | 3300044658 | Bacteria | 5987 |
| 432 | Ga0466972_0023859 | 3300044658 | Bacteria | 3039 |
| 433 | Ga0466972_0059377 | 3300044658 | Bacteria | 1836 |
| 434 | Ga0466965_0022927 | 3300044683 | Bacteria | 3012 |
| 435 | Ga0466965_0065468 | 3300044683 | Bacteria | 1821 |
| 436 | Ga0466965_0071980 | 3300044683 | Bacteria | 1739 |
| 437 | Ga0466965_0084113 | 3300044683 | Bacteria | 1611 |
| 438 | Ga0466965_0095009 | 3300044683 | Bacteria | 1520 |
| 439 | Ga0466966_0007032 | 3300044684 | Bacteria | 7451 |
| 440 | Ga0466966_0025400 | 3300044684 | Bacteria | 3870 |
| 441 | Ga0466966_0066122 | 3300044684 | Bacteria | 2272 |
| 442 | Ga0466961_0003256 | 3300044693 | Bacteria | 10107 |
| 443 | Ga0466961_0030169 | 3300044693 | Bacteria | 3485 |
| 444 | Ga0466961_0033442 | 3300044693 | Bacteria | 3303 |
| 445 | Ga0466961_0099398 | 3300044693 | Bacteria | 1834 |
| 446 | Ga0466963_0032537 | 3300044694 | Bacteria | 3378 |
| 447 | Ga0466963_0037680 | 3300044694 | Bacteria | 3159 |
| 448 | Ga0466963_0059594 | 3300044694 | Bacteria | 2548 |
| 449 | Ga0466964_0037327 | 3300044706 | Bacteria | 1951 |
| 450 | Ga0466971_0031618 | 3300044719 | Bacteria | 2370 |
| 451 | Ga0466971_0039657 | 3300044719 | Bacteria | 2113 |
| 452 | Ga0466968_0000412 | 3300044735 | Bacteria | 14204 |
| 453 | Ga0466968_0000969 | 3300044735 | Bacteria | 10088 |
| 454 | Ga0466968_0015951 | 3300044735 | Bacteria | 2985 |
| 455 | Ga0466968_0016051 | 3300044735 | Bacteria | 2976 |
| 456 | Ga0466968_0021901 | 3300044735 | Bacteria | 2592 |
| 457 | Ga0466968_0064974 | 3300044735 | Bacteria | 1579 |
| 458 | Ga0466970_0005005 | 3300044765 | Bacteria | 6547 |
| 459 | Ga0466970_0046555 | 3300044765 | Bacteria | 2310 |
| 460 | Ga0466970_0122320 | 3300044765 | Bacteria | 1426 |
| 461 | Ga0466970_0145544 | 3300044765 | Bacteria | 1307 |
| 462 | Ga0466970_0150283 | 3300044765 | Bacteria | 1285 |
| 463 | Ga0466957_0017432 | 3300044842 | Bacteria | 4206 |
| 464 | Ga0466957_0020345 | 3300044842 | Bacteria | 3904 |
| 465 | Ga0466957_0075154 | 3300044842 | Bacteria | 2096 |
| 466 | Ga0466957_0128597 | 3300044842 | Bacteria | 1620 |
| 467 | Ga0466960_0000298 | 3300044901 | Bacteria | 17254 |
| 468 | Ga0466960_0009724 | 3300044901 | Bacteria | 3976 |
| 469 | Ga0466960_0010966 | 3300044901 | Bacteria | 3774 |
| 470 | Ga0466960_0014887 | 3300044901 | Bacteria | 3342 |
| 471 | Ga0466959_0006453 | 3300045049 | Bacteria | 8122 |
| 472 | Ga0466959_0056319 | 3300045049 | Bacteria | 2868 |
| 473 | Ga0466959_0131775 | 3300045049 | Bacteria | 1771 |
| 474 | Ga0466959_0347532 | 3300045049 | Bacteria | 1011 |
| 475 | Ga0466959_0378031 | 3300045049 | Bacteria | 964 |
| 476 | Ga0466958_0001933 | 3300045836 | Bacteria | 10158 |
| 477 | Ga0466958_0016366 | 3300045836 | Bacteria | 4270 |
| 478 | Ga0466958_0024402 | 3300045836 | Bacteria | 3558 |
| 479 | Ga0466958_0025549 | 3300045836 | Bacteria | 3483 |
| 480 | Ga0466958_0037553 | 3300045836 | Bacteria | 2902 |
| 481 | Ga0466967_0040189 | 3300045976 | Bacteria | 4026 |
| 482 | Ga0466967_0045901 | 3300045976 | Bacteria | 3800 |
| 483 | Ga0466967_0082166 | 3300045976 | Bacteria | 2911 |
| 484 | Ga0466967_0093003 | 3300045976 | Bacteria | 2743 |
| 485 | Ga0466967_0108128 | 3300045976 | Bacteria | 2551 |
| 486 | Ga0466967_0171487 | 3300045976 | Bacteria | 2042 |
| 487 | Ga0466967_0176449 | 3300045976 | Bacteria | 2013 |
| 488 | Ga0466967_0525753 | 3300045976 | Bacteria | 1163 |
| 489 | Ga0495638_0006500 | 3300046460 | Bacteria | 8500 |
| 490 | Ga0495648_0008720 | 3300046524 | Bacteria | 7942 |
| 491 | Ga0495654_0091874 | 3300046530 | Bacteria | 1407 |
| 492 | Ga0495668_0011318 | 3300046616 | Bacteria | 5350 |
| 493 | Ga0495668_0218701 | 3300046616 | Bacteria | 1043 |
| 494 | Ga0495625_0095070 | 3300046660 | Bacteria | 2055 |
| 495 | Ga0495625_0117736 | 3300046660 | Bacteria | 1811 |
| 496 | Ga0495671_0130130 | 3300046692 | Bacteria | 1227 |
| 497 | Ga0495672_0002584 | 3300047320 | Bacteria | 16441 |
| 498 | Ga0495672_0003747 | 3300047320 | Bacteria | 12818 |
| 499 | Ga0495672_0008946 | 3300047320 | Bacteria | 7314 |
| 500 | Ga0495672_0088508 | 3300047320 | Bacteria | 1706 |
| 501 | Ga0495672_0150771 | 3300047320 | Bacteria | 1206 |
| 502 | Ga0495683_0183445 | 3300047323 | Bacteria | 954 |
| 503 | Ga0495673_0012229 | 3300047469 | Bacteria | 4566 |
| 504 | Ga0495673_0019428 | 3300047469 | Bacteria | 3403 |
| 505 | Ga0495686_0015968 | 3300047472 | Bacteria | 5104 |
| 506 | Ga0495593_0010595 | 3300047673 | Bacteria | 5318 |
| 507 | Ga0496100_0000109 | 3300048903 | Bacteria | 47454 |
| 508 | Ga0496100_0005227 | 3300048903 | Bacteria | 6972 |
| 509 | Ga0496100_0008249 | 3300048903 | Bacteria | 5804 |
| 510 | Ga0496100_0044977 | 3300048903 | Bacteria | 2831 |
| 511 | Ga0496100_0190600 | 3300048903 | Bacteria | 1488 |
| 512 | Ga0496100_0214984 | 3300048903 | Bacteria | 1408 |
| 513 | Ga0496100_0259073 | 3300048903 | Bacteria | 1289 |
| 514 | Ga0496101_0000020 | 3300048904 | Bacteria | 218859 |
| 515 | Ga0496101_0000075 | 3300048904 | Bacteria | 112785 |
| 516 | Ga0496101_0000310 | 3300048904 | Bacteria | 33833 |
| 517 | Ga0496101_0001332 | 3300048904 | Bacteria | 14794 |
| 518 | Ga0496101_0002044 | 3300048904 | Bacteria | 12282 |
| 519 | Ga0496101_0020525 | 3300048904 | Bacteria | 4525 |
| 520 | Ga0496101_0030708 | 3300048904 | Bacteria | 3771 |
| 521 | Ga0496101_0045216 | 3300048904 | Bacteria | 3153 |
| 522 | Ga0496101_0055704 | 3300048904 | Bacteria | 2857 |
| 523 | Ga0496101_0066568 | 3300048904 | Bacteria | 2628 |
| 524 | Ga0496101_0557816 | 3300048904 | Bacteria | 906 |
| 525 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 526 | Ga0496102_0004064 | 3300048905 | Bacteria | 12406 |
| 527 | Ga0496102_0004363 | 3300048905 | Bacteria | 11952 |
| 528 | Ga0496102_0004756 | 3300048905 | Bacteria | 11489 |
| 529 | Ga0496102_0012877 | 3300048905 | Bacteria | 7240 |
| 530 | Ga0496102_0026778 | 3300048905 | Bacteria | 5147 |
| 531 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 532 | Ga0496103_0000093 | 3300048906 | Bacteria | 100010 |
| 533 | Ga0496103_0000512 | 3300048906 | Bacteria | 31958 |
| 534 | Ga0496103_0051048 | 3300048906 | Bacteria | 2559 |
| 535 | Ga0496103_0185782 | 3300048906 | Bacteria | 1336 |
| 536 | Ga0496104_0004308 | 3300048907 | Bacteria | 12375 |
| 537 | Ga0496104_0036280 | 3300048907 | Bacteria | 4609 |
| 538 | Ga0496105_0075358 | 3300048908 | Bacteria | 2786 |
| 539 | Ga0496105_0323700 | 3300048908 | Bacteria | 1235 |
| 540 | Ga0496106_0002847 | 3300048909 | Bacteria | 12845 |
| 541 | Ga0496106_0058826 | 3300048909 | Bacteria | 2911 |
| 542 | Ga0496106_0059545 | 3300048909 | Bacteria | 2893 |
| 543 | Ga0496106_0143147 | 3300048909 | Bacteria | 1881 |
| 544 | Ga0496106_0192127 | 3300048909 | Bacteria | 1623 |
| 545 | Ga0496107_0005122 | 3300048910 | Bacteria | 8940 |
| 546 | Ga0496107_0005597 | 3300048910 | Bacteria | 8604 |
| 547 | Ga0496107_0028961 | 3300048910 | Bacteria | 3938 |
| 548 | Ga0496107_0119159 | 3300048910 | Bacteria | 1944 |
| 549 | Ga0496107_0251667 | 3300048910 | Bacteria | 1314 |
| 550 | Ga0496108_0000222 | 3300048911 | Bacteria | 50962 |
| 551 | Ga0496108_0000405 | 3300048911 | Bacteria | 35593 |
| 552 | Ga0496108_0038421 | 3300048911 | Bacteria | 3988 |
| 553 | Ga0496108_0456742 | 3300048911 | Bacteria | 1116 |
| 554 | Ga0496108_0654519 | 3300048911 | Bacteria | 913 |
| 555 | Ga0496109_0002338 | 3300048912 | Bacteria | 15809 |
| 556 | Ga0496109_0024536 | 3300048912 | Bacteria | 5362 |
| 557 | Ga0496109_0080408 | 3300048912 | Bacteria | 3003 |
| 558 | Ga0496109_0121178 | 3300048912 | Bacteria | 2437 |
| 559 | Ga0496109_0236798 | 3300048912 | Bacteria | 1717 |
| 560 | Ga0496109_0238853 | 3300048912 | Bacteria | 1710 |
| 561 | Ga0496109_0597939 | 3300048912 | Bacteria | 1039 |
| 562 | Ga0496110_0019778 | 3300048913 | Bacteria | 5672 |
| 563 | Ga0496110_0129575 | 3300048913 | Bacteria | 2277 |
| 564 | Ga0496110_0537552 | 3300048913 | Bacteria | 1063 |
| 565 | Ga0496110_0542860 | 3300048913 | Bacteria | 1057 |
| 566 | Ga0496110_0631846 | 3300048913 | Bacteria | 970 |
| 567 | Ga0496111_0008829 | 3300048914 | Bacteria | 6697 |
| 568 | Ga0496111_0169898 | 3300048914 | Bacteria | 1620 |
| 569 | Ga0496111_0228855 | 3300048914 | Bacteria | 1381 |
| 570 | Ga0496112_0025991 | 3300048915 | Bacteria | 5627 |
| 571 | Ga0496112_0054350 | 3300048915 | Bacteria | 3934 |
| 572 | Ga0496112_0301215 | 3300048915 | Bacteria | 1548 |
| 573 | Ga0496112_0617058 | 3300048915 | Bacteria | 1016 |
| 574 | Ga0496113_0001800 | 3300048916 | Bacteria | 12155 |
| 575 | Ga0496113_0109697 | 3300048916 | Bacteria | 2146 |
| 576 | Ga0496113_0115102 | 3300048916 | Bacteria | 2097 |
| 577 | Ga0496113_0330911 | 3300048916 | Bacteria | 1221 |
| 578 | Ga0496113_0674587 | 3300048916 | Bacteria | 826 |
| 579 | Ga0496114_0000181 | 3300048917 | Bacteria | 45025 |
| 580 | Ga0496114_0011672 | 3300048917 | Bacteria | 7026 |
| 581 | Ga0496114_0043138 | 3300048917 | Bacteria | 3740 |
| 582 | Ga0496115_0005302 | 3300048918 | Bacteria | 9378 |
| 583 | Ga0496115_0009311 | 3300048918 | Bacteria | 7298 |
| 584 | Ga0496115_0037126 | 3300048918 | Bacteria | 3861 |
| 585 | Ga0496116_0000071 | 3300048919 | Bacteria | 244521 |
| 586 | Ga0496116_0004420 | 3300048919 | Bacteria | 13422 |
| 587 | Ga0496116_0015952 | 3300048919 | Bacteria | 5907 |
| 588 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 589 | Ga0496117_0000711 | 3300048920 | Bacteria | 52638 |
| 590 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 591 | Ga0496118_0000488 | 3300048921 | Bacteria | 65611 |
| 592 | Ga0496118_0068619 | 3300048921 | Bacteria | 2573 |
| 593 | Ga0496119_0000266 | 3300048922 | Bacteria | 74075 |
| 594 | Ga0496119_0002301 | 3300048922 | Bacteria | 21118 |
| 595 | Ga0496119_0002624 | 3300048922 | Bacteria | 19518 |
| 596 | Ga0496119_0120032 | 3300048922 | Bacteria | 1446 |
| 597 | Ga0496120_0000235 | 3300048923 | Bacteria | 94653 |
| 598 | Ga0496120_0001188 | 3300048923 | Bacteria | 33095 |
| 599 | Ga0496120_0034101 | 3300048923 | Bacteria | 3053 |
| 600 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 601 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 602 | Ga0496121_0006826 | 3300048924 | Bacteria | 13964 |
| 603 | Ga0496122_0000312 | 3300048925 | Bacteria | 107109 |
| 604 | Ga0496122_0012626 | 3300048925 | Bacteria | 8377 |
| 605 | Ga0496122_0017076 | 3300048925 | Bacteria | 6810 |
| 606 | Ga0496122_0312790 | 3300048925 | Bacteria | 840 |
| 607 | Ga0496123_0003426 | 3300048926 | Bacteria | 17817 |
| 608 | Ga0496123_0019484 | 3300048926 | Bacteria | 5345 |
| 609 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 610 | Ga0496124_0008699 | 3300048927 | Bacteria | 10555 |
| 611 | Ga0496124_0211984 | 3300048927 | Bacteria | 1465 |
| 612 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 613 | Ga0496125_0055291 | 3300048928 | Bacteria | 3235 |
| 614 | Ga0496125_0160805 | 3300048928 | Bacteria | 1526 |
| 615 | Ga0496126_0000011 | 3300048929 | Bacteria | 744275 |
| 616 | Ga0496126_0003151 | 3300048929 | Bacteria | 21253 |
| 617 | Ga0496126_0004196 | 3300048929 | Bacteria | 17363 |
| 618 | Ga0496126_0021074 | 3300048929 | Bacteria | 6375 |
| 619 | Ga0496126_0029729 | 3300048929 | Bacteria | 5187 |
| 620 | Ga0496126_0212040 | 3300048929 | Bacteria | 1630 |
| 621 | Ga0496126_0494612 | 3300048929 | Bacteria | 978 |
| 622 | Ga0501032_0000469 | 3300049569 | Bacteria | 32526 |
| 623 | Ga0501032_0038979 | 3300049569 | Bacteria | 3234 |
| 624 | Ga0501034_0009642 | 3300049571 | Bacteria | 10098 |
| 625 | Ga0501034_0011897 | 3300049571 | Bacteria | 9002 |
| 626 | Ga0501036_0016952 | 3300049572 | Bacteria | 6086 |
| 627 | Ga0501037_0000234 | 3300049573 | Bacteria | 47815 |
| 628 | Ga0501038_0000365 | 3300049574 | Bacteria | 39105 |
| 629 | Ga0501039_0000113 | 3300049575 | Bacteria | 54895 |
| 630 | Ga0501039_0586768 | 3300049575 | Bacteria | 874 |
| 631 | Ga0501043_0000082 | 3300049579 | Bacteria | 84442 |
| 632 | Ga0501043_0141367 | 3300049579 | Bacteria | 1885 |
| 633 | Ga0501043_0259167 | 3300049579 | Bacteria | 1338 |
| 634 | Ga0501047_0008566 | 3300049581 | Bacteria | 9652 |
| 635 | Ga0501047_0567756 | 3300049581 | Bacteria | 958 |
| 636 | Ga0501048_0232310 | 3300049582 | Bacteria | 1309 |
| 637 | Ga0501067_0226201 | 3300049583 | Bacteria | 1041 |
| 638 | Ga0501070_0001505 | 3300049586 | Bacteria | 20787 |
| 639 | Ga0501071_0319850 | 3300049587 | Bacteria | 1178 |
| 640 | Ga0501072_0127722 | 3300049588 | Bacteria | 2026 |
| 641 | Ga0501073_0144970 | 3300049589 | Bacteria | 1645 |
| 642 | Ga0501076_0103222 | 3300049592 | Bacteria | 2300 |
| 643 | Ga0501080_0029877 | 3300049742 | Bacteria | 5073 |
| 644 | Ga0501035_0009531 | 3300049822 | Bacteria | 9030 |
| 645 | Ga0501044_0003845 | 3300049823 | Bacteria | 16843 |
| 646 | Ga0501044_0008670 | 3300049823 | Bacteria | 11134 |
| 647 | Ga0501044_0013412 | 3300049823 | Bacteria | 8862 |
| 648 | nmdc:mga03683_135079_c1 | 3300050489 | Bacteria | 1106 |
| 649 | nmdc:mga03683_30607_c1 | 3300050489 | Bacteria | 2154 |
| 650 | nmdc:mga03n38_1202_c1 | 3300050490 | Bacteria | 7246 |
| 651 | nmdc:mga03n38_21750_c1 | 3300050490 | Bacteria | 2585 |
| 652 | nmdc:mga03n38_293550_c1 | 3300050490 | Bacteria | 871 |
| 653 | nmdc:mga03n38_37775_c1 | 3300050490 | Bacteria | 2085 |
| 654 | nmdc:mga03n38_435_c1 | 3300050490 | Bacteria | 10412 |
| 655 | nmdc:mga03n38_76454_c1 | 3300050490 | Bacteria | 1562 |
| 656 | nmdc:mga00v17_140178_c1 | 3300050491 | Bacteria | 1550 |
| 657 | nmdc:mga00v17_142939_c1 | 3300050491 | Bacteria | 1535 |
| 658 | nmdc:mga00v17_265643_c1 | 3300050491 | Bacteria | 1113 |
| 659 | nmdc:mga00v17_4868_c1 | 3300050491 | Bacteria | 7037 |
| 660 | nmdc:mga00v17_5302_c1 | 3300050491 | Bacteria | 6794 |
| 661 | nmdc:mga00v17_5879_c1 | 3300050491 | Bacteria | 6479 |
| 662 | nmdc:mga00v17_6485_c1 | 3300050491 | Bacteria | 6210 |
| 663 | nmdc:mga0yw44_27834_c1 | 3300050492 | Bacteria | 3243 |
| 664 | nmdc:mga0yw44_512_c1 | 3300050492 | Bacteria | 13855 |
| 665 | nmdc:mga0k408_327613_c1 | 3300050493 | Bacteria | 914 |
| 666 | nmdc:mga06z11_108728_c1 | 3300050494 | Bacteria | 1532 |
| 667 | nmdc:mga06z11_43756_c1 | 3300050494 | Bacteria | 2255 |
| 668 | nmdc:mga04h51_6791_c1 | 3300050495 | Bacteria | 2988 |
| 669 | nmdc:mga07m45_115305_c1 | 3300050496 | Bacteria | 1549 |
| 670 | nmdc:mga07m45_13773_c1 | 3300050496 | Bacteria | 4295 |
| 671 | nmdc:mga07m45_1418_c1 | 3300050496 | Bacteria | 10985 |
| 672 | nmdc:mga07m45_169682_c1 | 3300050496 | Bacteria | 1268 |
| 673 | nmdc:mga07m45_250642_c1 | 3300050496 | Bacteria | 1030 |
| 674 | nmdc:mga07m45_29031_c1 | 3300050496 | Bacteria | 3055 |
| 675 | nmdc:mga07m45_343084_c1 | 3300050496 | Bacteria | 868 |
| 676 | nmdc:mga05p37_28521_c1 | 3300050507 | Bacteria | 6806 |
| 677 | nmdc:mga0qj67_23517_c1 | 3300050509 | Bacteria | 4742 |
| 678 | nmdc:mga0qj67_267627_c1 | 3300050509 | Bacteria | 1386 |
| 679 | nmdc:mga0sz30_11295_c1 | 3300050516 | Bacteria | 3445 |
| 680 | nmdc:mga0sz30_148938_c1 | 3300050516 | Bacteria | 1035 |
| 681 | nmdc:mga0sz30_2088_c1 | 3300050516 | Bacteria | 7140 |
| 682 | nmdc:mga0sz30_29181_c1 | 3300050516 | Bacteria | 2272 |
| 683 | nmdc:mga0sz30_7358_c1 | 3300050516 | Bacteria | 4125 |
| 684 | nmdc:mga0sz30_7673_c1 | 3300050516 | Bacteria | 4051 |
| 685 | nmdc:mga0sz30_89784_c1 | 3300050516 | Bacteria | 1336 |
| 686 | Ga0500635_0043582 | 3300053080 | Bacteria | 1510 |
| 687 | Ga0495655_0031366 | 3300053083 | Bacteria | 1292 |
| 688 | Ga0500643_001890 | 3300053087 | Bacteria | 11384 |
| 689 | Ga0500643_004512 | 3300053087 | Bacteria | 6263 |
| 690 | Ga0500643_010251 | 3300053087 | Bacteria | 3503 |
| 691 | Ga0500556_0008054 | 3300053104 | Bacteria | 3032 |
| 692 | Ga0500642_0056149 | 3300053130 | Bacteria | 1754 |
| 693 | Ga0500652_033856 | 3300053131 | Bacteria | 2021 |
| 694 | Ga0500616_0003117 | 3300053153 | Bacteria | 12957 |
| 695 | Ga0500616_0094853 | 3300053153 | Bacteria | 1469 |
| 696 | Ga0500616_0126342 | 3300053153 | Bacteria | 1214 |
| 697 | Ga0500627_0047935 | 3300053158 | Bacteria | 1855 |
| 698 | Ga0500645_000075 | 3300053730 | Bacteria | 78736 |
| 699 | Ga0466962_0034873 | 3300061719 | Bacteria | 2410 |
| 700 | Ga0466962_0120602 | 3300061719 | Bacteria | 1265 |
| 701 | Ga0530510_0269726 | 3300061734 | Bacteria | 1270 |
| 702 | 2644490050 | 2643221687 | Bacteria | 6500351 |
| 703 | 2644512940 | 2643221692 | Bacteria | 7282860 |
| 704 | 2644635722 | 2643221715 | Bacteria | 6671032 |
| 705 | 2738664285 | 2738541264 | Bacteria | 5935393 |
| 706 | 2739143420 | 2738541356 | Bacteria | 5935017 |
| 707 | 2842136803 | 2842134933 | Bacteria | 5847019 |
| 708 | 2866552148 | 2866552031 | Bacteria | 5824618 |
| 709 | 2870787103 | 2870782633 | Bacteria | 9624083 |
| 710 | 2902793009 | 2902792274 | Bacteria | 7270173 |
| 711 | 2902797430 | 2902792274 | Bacteria | 7270173 |
| 712 | 2902801812 | 2902799365 | Bacteria | 5419524 |
| 713 | 2902812392 | 2902810491 | Bacteria | 6794147 |
| 714 | 2902813672 | 2902810491 | Bacteria | 6794147 |
| 715 | 2902841682 | 2902837492 | Bacteria | 6697721 |
| 716 | 2929213803 | 2929212328 | Bacteria | 7708288 |
| 717 | 2939589092 | 2939582691 | Bacteria | 7088898 |
| 718 | 3003001325 | 3002998708 | Bacteria | 11715108 |
| 719 | Ga0395900_0609856 | |||
| 720 | JGI24737J22298_10017351 | |||
| 721 | JGI24743J22301_10000706 | |||
| 722 | JGI24750J21931_1001321 | |||
| 723 | JGI24738J21930_10004733 | |||
| 724 | JGI24738J21930_10031264 | |||
| 725 | JGI24744J21845_10003959 | |||
| 726 | JGI24744J21845_10005701 | |||
| 727 | JGI24034J26672_10001252 | |||
| 728 | JGI24742J22300_10000645 | |||
| 729 | JGI24742J22300_10009587 | |||
| 730 | rootH2_10007847 | |||
| 731 | Ga0055540_1000044 | |||
| 732 | Ga0055540_1004604 | |||
| 733 | Ga0055540_1011097 | |||
| 734 | Ga0070658_10341471 | |||
| 735 | Ga0070683_100143368 | |||
| 736 | Ga0070690_100011762 | |||
| 737 | Ga0070677_10308029 | |||
| 738 | Ga0068869_100395891 | |||
| 739 | Ga0070666_10089765 | |||
| 740 | Ga0070666_10239736 | |||
| 741 | Ga0070666_10421395 | |||
| 742 | Ga0070682_100004933 | |||
| 743 | Ga0070682_100010131 | |||
| 744 | Ga0068868_100002812 | |||
| 745 | Ga0068868_100082181 | |||
| 746 | Ga0070689_100052956 | |||
| 747 | Ga0070689_100072816 | |||
| 748 | Ga0070691_10005230 | |||
| 749 | Ga0070691_10222286 | |||
| 750 | Ga0070692_10039242 | |||
| 751 | Ga0070668_100005941 | |||
| 752 | Ga0070668_100043134 | |||
| 753 | Ga0070668_100414938 | |||
| 754 | Ga0070669_100012086 | |||
| 755 | Ga0070669_100207659 | |||
| 756 | Ga0070669_100294549 | |||
| 757 | Ga0070671_100107568 | |||
| 758 | Ga0070674_100003739 | |||
| 759 | Ga0070674_100066583 | |||
| 760 | Ga0070674_100109314 | |||
| 761 | Ga0070688_100008640 | |||
| 762 | Ga0070688_100084050 | |||
| 763 | Ga0070659_100024813 | |||
| 764 | Ga0070659_100082462 | |||
| 765 | Ga0070667_100000074 | |||
| 766 | Ga0070667_100005546 | |||
| 767 | Ga0070667_100014115 | |||
| 768 | Ga0070667_100293555 | |||
| 769 | Ga0070667_100450152 | |||
| 770 | Ga0070709_10113631 | |||
| 771 | Ga0070714_100393188 | |||
| 772 | Ga0070713_100013669 | |||
| 773 | Ga0070710_10001139 | |||
| 774 | Ga0070710_10391999 | |||
| 775 | Ga0070701_10004473 | |||
| 776 | Ga0070711_100000479 | |||
| 777 | Ga0070711_100001760 | |||
| 778 | Ga0070711_100221420 | |||
| 779 | Ga0070705_100092914 | |||
| 780 | Ga0070705_100217602 | |||
| 781 | Ga0070700_100010521 | |||
| 782 | Ga0070694_100282211 | |||
| 783 | Ga0070663_100028178 | |||
| 784 | Ga0070663_100085485 | |||
| 785 | Ga0070663_100152471 | |||
| 786 | Ga0070663_100173251 | |||
| 787 | Ga0070663_100258765 | |||
| 788 | Ga0070678_100000595 | |||
| 789 | Ga0070662_100063895 | |||
| 790 | Ga0068867_100001973 | |||
| 791 | Ga0068867_100153185 | |||
| 792 | Ga0070685_10113710 | |||
| 793 | Ga0070685_10126078 | |||
| 794 | Ga0070706_100005214 | |||
| 795 | Ga0070698_100002967 | |||
| 796 | Ga0070679_100764772 | |||
| 797 | Ga0070684_100045721 | |||
| 798 | Ga0068853_100013047 | |||
| 799 | Ga0068853_100027722 | |||
| 800 | Ga0068853_100087726 | |||
| 801 | Ga0068853_100188058 | |||
| 802 | Ga0068853_100748885 | |||
| 803 | Ga0070672_100067670 | |||
| 804 | Ga0070672_100403508 | |||
| 805 | Ga0070686_100275487 | |||
| 806 | Ga0070695_100024200 | |||
| 807 | Ga0070696_100081372 | |||
| 808 | Ga0070693_100124355 | |||
| 809 | Ga0070693_100227826 | |||
| 810 | Ga0070665_100004155 | |||
| 811 | Ga0070665_100005707 | |||
| 812 | Ga0070665_100019535 | |||
| 813 | Ga0070665_100057570 | |||
| 814 | Ga0070665_100141611 | |||
| 815 | Ga0070704_100000666 | |||
| 816 | Ga0070704_100135752 | |||
| 817 | Ga0068855_100108707 | |||
| 818 | Ga0068855_100398404 | |||
| 819 | Ga0068857_100395612 | |||
| 820 | Ga0068854_100003429 | |||
| 821 | Ga0068854_100304584 | |||
| 822 | Ga0070702_100071437 | |||
| 823 | Ga0068852_100149584 | |||
| 824 | Ga0068859_100000567 | |||
| 825 | Ga0068859_100012214 | |||
| 826 | Ga0068859_100444675 | |||
| 827 | Ga0068864_100050538 | |||
| 828 | Ga0068864_100322235 | |||
| 829 | Ga0068864_100380874 | |||
| 830 | Ga0068864_100568416 | |||
| 831 | Ga0068864_100730701 | |||
| 832 | Ga0068866_10001475 | |||
| 833 | Ga0068866_10007613 | |||
| 834 | Ga0068861_100029389 | |||
| 835 | Ga0068861_100279129 | |||
| 836 | Ga0068851_10024994 | |||
| 837 | Ga0068863_100001963 | |||
| 838 | Ga0068863_100002994 | |||
| 839 | Ga0068863_100150728 | |||
| 840 | Ga0068858_100015365 | |||
| 841 | Ga0068858_100092957 | |||
| 842 | Ga0068860_100000276 | |||
| 843 | Ga0068860_100011255 | |||
| 844 | Ga0068862_100000065 | |||
| 845 | Ga0068862_100099705 | |||
| 846 | Ga0068862_100980316 | |||
| 847 | Ga0081455_10041314 | |||
| 848 | Ga0081455_10068507 | |||
| 849 | Ga0081455_10096638 | |||
| 850 | Ga0081540_1119944 | |||
| 851 | Ga0070717_10073663 | |||
| 852 | Ga0070717_10118701 | |||
| 853 | Ga0070717_10210554 | |||
| 854 | Ga0075365_10109707 | |||
| 855 | Ga0075365_10398454 | |||
| 856 | Ga0075368_10096850 | |||
| 857 | Ga0075363_100000288 | |||
| 858 | Ga0075363_100016182 | |||
| 859 | Ga0075363_100025973 | |||
| 860 | Ga0075363_100122047 | |||
| 861 | Ga0075364_10000591 | |||
| 862 | Ga0075364_10004624 | |||
| 863 | Ga0075364_10027240 | |||
| 864 | Ga0075364_10342981 | |||
| 865 | Ga0070716_100050770 | |||
| 866 | Ga0070712_100002669 | |||
| 867 | Ga0070712_100007238 | |||
| 868 | Ga0070712_100114627 | |||
| 869 | Ga0075362_10004246 | |||
| 870 | Ga0075362_10020527 | |||
| 871 | Ga0075362_10142229 | |||
| 872 | Ga0075367_10004233 | |||
| 873 | Ga0075367_10155463 | |||
| 874 | Ga0075369_10000174 | |||
| 875 | Ga0075369_10000333 | |||
| 876 | Ga0075369_10001566 | |||
| 877 | Ga0075369_10002203 | |||
| 878 | Ga0075369_10008524 | |||
| 879 | Ga0075369_10013179 | |||
| 880 | Ga0075369_10020744 | |||
| 881 | Ga0075369_10034370 | |||
| 882 | Ga0075369_10036600 | |||
| 883 | Ga0075369_10042723 | |||
| 884 | Ga0075369_10048526 | |||
| 885 | Ga0075369_10118775 | |||
| 886 | Ga0075369_10289448 | |||
| 887 | Ga0075366_10322339 | |||
| 888 | Ga0097621_100100697 | |||
| 889 | Ga0075370_10045146 | |||
| 890 | Ga0075370_10048459 | |||
| 891 | Ga0075370_10117729 | |||
| 892 | Ga0075370_10141055 | |||
| 893 | Ga0075370_10201464 | |||
| 894 | Ga0068871_100132570 | |||
| 895 | Ga0068871_100359902 | |||
| 896 | Ga0075428_100023896 | |||
| 897 | Ga0075430_100003713 | |||
| 898 | Ga0075431_100177920 | |||
| 899 | Ga0068865_100016530 | |||
| 900 | Ga0068865_100150829 | |||
| 901 | Ga0097620_100000567 | |||
| 902 | Ga0097620_100012214 | |||
| 903 | Ga0097620_100444628 | |||
| 904 | Ga0099795_10003237 | |||
| 905 | Ga0105250_10073552 | |||
| 906 | Ga0105245_10004418 | |||
| 907 | Ga0105245_10187753 | |||
| 908 | Ga0105245_10247155 | |||
| 909 | Ga0105247_10000017 | |||
| 910 | Ga0105247_10002837 | |||
| 911 | Ga0105247_10103865 | |||
| 912 | Ga0105247_10158216 | |||
| 913 | Ga0114129_10089982 | |||
| 914 | Ga0105243_10005087 | |||
| 915 | Ga0105243_10018750 | |||
| 916 | Ga0105243_10151180 | |||
| 917 | Ga0105243_10422207 | |||
| 918 | Ga0105241_10020983 | |||
| 919 | Ga0105242_10001113 | |||
| 920 | Ga0105242_10029712 | |||
| 921 | Ga0105248_10000194 | |||
| 922 | Ga0105248_10003348 | |||
| 923 | Ga0105248_10019251 | |||
| 924 | Ga0105237_10003695 | |||
| 925 | Ga0105237_10057089 | |||
| 926 | Ga0105237_10134668 | |||
| 927 | Ga0105238_10089712 | |||
| 928 | Ga0105238_10216295 | |||
| 929 | Ga0105249_10000096 | |||
| 930 | Ga0105249_10001976 | |||
| 931 | Ga0105249_10160009 | |||
| 932 | Ga0105032_102023 | |||
| 933 | Ga0105239_10009981 | |||
| 934 | Ga0105239_10010576 | |||
| 935 | Ga0105239_10126490 | |||
| 936 | Ga0105239_10141106 | |||
| 937 | Ga0105239_10515987 | |||
| 938 | Ga0105246_10019937 | |||
| 939 | Ga0105246_10250843 | |||
| 940 | Ga0105246_10327228 | |||
| 941 | Ga0157369_10353423 | |||
| 942 | Ga0157374_10132704 | |||
| 943 | Ga0157374_10183972 | |||
| 944 | Ga0157378_10006478 | |||
| 945 | Ga0157378_10233861 | |||
| 946 | Ga0163162_10005025 | |||
| 947 | Ga0163162_10016373 | |||
| 948 | Ga0163162_10322630 | |||
| 949 | Ga0157372_10007458 | |||
| 950 | Ga0157375_10014077 | |||
| 951 | Ga0157375_10565307 | |||
| 952 | Ga0163163_10613719 | |||
| 953 | Ga0157380_10000771 | |||
| 954 | Ga0157377_10248506 | |||
| 955 | Ga0157379_10006231 | |||
| 956 | Ga0157379_10066922 | |||
| 957 | Ga0157379_10219308 | |||
| 958 | Ga0157376_10335131 | |||
| 959 | Ga0163161_10002358 | |||
| 960 | Ga0163161_10324756 | |||
| 961 | Ga0213873_10000038 | |||
| 962 | Ga0213876_10028698 | |||
| 963 | Ga0213876_10055427 | |||
| 964 | Ga0213875_10000221 | |||
| 965 | Ga0213875_10005568 | |||
| 966 | Ga0213875_10026048 | |||
| 967 | Ga0213875_10038185 | |||
| 968 | Ga0209051_1000051 | |||
| 969 | Ga0209051_1001135 | |||
| 970 | Ga0209051_1001817 | |||
| 971 | Ga0209051_1005060 | |||
| 972 | Ga0209051_1021362 | |||
| 973 | Ga0207656_10035805 | |||
| 974 | Ga0207692_10113223 | |||
| 975 | Ga0207692_10135001 | |||
| 976 | Ga0207642_10000124 | |||
| 977 | Ga0207710_10000033 | |||
| 978 | Ga0207710_10020186 | |||
| 979 | Ga0207710_10076557 | |||
| 980 | Ga0207688_10002685 | |||
| 981 | Ga0207688_10010477 | |||
| 982 | Ga0207688_10162469 | |||
| 983 | Ga0207680_10064428 | |||
| 984 | Ga0207680_10406204 | |||
| 985 | Ga0207647_10114642 | |||
| 986 | Ga0207647_10160814 | |||
| 987 | Ga0207685_10009785 | |||
| 988 | Ga0207685_10169387 | |||
| 989 | Ga0207699_10147306 | |||
| 990 | Ga0207699_10172634 | |||
| 991 | Ga0207645_10012184 | |||
| 992 | Ga0207705_10308731 | |||
| 993 | Ga0207684_10024027 | |||
| 994 | Ga0207671_10052330 | |||
| 995 | Ga0207671_10179486 | |||
| 996 | Ga0207693_10001826 | |||
| 997 | Ga0207693_10002737 | |||
| 998 | Ga0207663_10045487 | |||
| 999 | Ga0207662_10057602 | |||
| 1000 | Ga0207657_10130362 | |||
| 1001 | Ga0207652_10137439 | |||
| 1002 | Ga0207646_10174525 | |||
| 1003 | Ga0207681_10000849 | |||
| 1004 | Ga0207681_10150685 | |||
| 1005 | Ga0207681_10349725 | |||
| 1006 | Ga0207687_10010419 | |||
| 1007 | Ga0207687_10179027 | |||
| 1008 | Ga0207687_10194310 | |||
| 1009 | Ga0207700_10110539 | |||
| 1010 | Ga0207664_10059924 | |||
| 1011 | Ga0207664_10226189 | |||
| 1012 | Ga0207664_10300802 | |||
| 1013 | Ga0207664_10321252 | |||
| 1014 | Ga0207664_10326770 | |||
| 1015 | Ga0207644_10002040 | |||
| 1016 | Ga0207644_10077123 | |||
| 1017 | Ga0207644_10459048 | |||
| 1018 | Ga0207690_10075037 | |||
| 1019 | Ga0207690_10701268 | |||
| 1020 | Ga0207690_10859480 | |||
| 1021 | Ga0207706_10112691 | |||
| 1022 | Ga0207709_10013600 | |||
| 1023 | Ga0207670_10006196 | |||
| 1024 | Ga0207670_10046367 | |||
| 1025 | Ga0207669_10018039 | |||
| 1026 | Ga0207669_10046129 | |||
| 1027 | Ga0207704_10000291 | |||
| 1028 | Ga0207665_10011867 | |||
| 1029 | Ga0207665_10029835 | |||
| 1030 | Ga0207691_10069745 | |||
| 1031 | Ga0207691_10422044 | |||
| 1032 | Ga0207711_10000169 | |||
| 1033 | Ga0207711_10027770 | |||
| 1034 | Ga0207711_10053624 | |||
| 1035 | Ga0207711_10113240 | |||
| 1036 | Ga0207689_10034774 | |||
| 1037 | Ga0207689_10235673 | |||
| 1038 | Ga0207661_10311455 | |||
| 1039 | Ga0207667_10163989 | |||
| 1040 | Ga0207712_10000005 | |||
| 1041 | Ga0207712_10014365 | |||
| 1042 | Ga0207712_10120297 | |||
| 1043 | Ga0207668_10076093 | |||
| 1044 | Ga0207668_10077003 | |||
| 1045 | Ga0207668_10101294 | |||
| 1046 | Ga0207668_10930932 | |||
| 1047 | Ga0207640_10007670 | |||
| 1048 | Ga0207640_10164672 | |||
| 1049 | Ga0207658_10000321 | |||
| 1050 | Ga0207658_10002978 | |||
| 1051 | Ga0207658_10024173 | |||
| 1052 | Ga0207658_10169047 | |||
| 1053 | Ga0207658_10192238 | |||
| 1054 | Ga0207658_10255424 | |||
| 1055 | Ga0207677_10005597 | |||
| 1056 | Ga0207703_10027480 | |||
| 1057 | Ga0207703_10549731 | |||
| 1058 | Ga0207703_10843456 | |||
| 1059 | Ga0207678_10008103 | |||
| 1060 | Ga0207678_10018663 | |||
| 1061 | Ga0207678_10038498 | |||
| 1062 | Ga0207678_10100697 | |||
| 1063 | Ga0207678_10209133 | |||
| 1064 | Ga0207708_10002264 | |||
| 1065 | Ga0207708_10024779 | |||
| 1066 | Ga0207641_10001342 | |||
| 1067 | Ga0207641_10005082 | |||
| 1068 | Ga0207641_10165747 | |||
| 1069 | Ga0207648_10002008 | |||
| 1070 | Ga0207676_10042274 | |||
| 1071 | Ga0207676_10261453 | |||
| 1072 | Ga0207676_10302924 | |||
| 1073 | Ga0207676_10351881 | |||
| 1074 | Ga0207676_10770159 | |||
| 1075 | Ga0207674_10078136 | |||
| 1076 | Ga0207675_100003453 | |||
| 1077 | Ga0207675_100105439 | |||
| 1078 | Ga0207675_100132073 | |||
| 1079 | Ga0207675_100703811 | |||
| 1080 | Ga0207683_10003523 | |||
| 1081 | Ga0207683_10082669 | |||
| 1082 | Ga0207683_10093099 | |||
| 1083 | Ga0207683_10479874 | |||
| 1084 | Ga0207698_10490636 | |||
| 1085 | Ga0209813_10009588 | |||
| 1086 | Ga0268266_10002162 | |||
| 1087 | Ga0268266_10014326 | |||
| 1088 | Ga0268266_10051711 | |||
| 1089 | Ga0268266_10063446 | |||
| 1090 | Ga0268266_10072953 | |||
| 1091 | Ga0268266_10108442 | |||
| 1092 | Ga0268265_10000022 | |||
| 1093 | Ga0268265_10113828 | |||
| 1094 | Ga0268265_11081860 | |||
| 1095 | Ga0268264_10000005 | |||
| 1096 | Ga0268264_10002955 | |||
| 1097 | Ga0265327_10005197 | |||
| 1098 | Ga0307513_10566709 | |||
| 1099 | Ga0307509_10080875 | |||
| 1100 | Ga0307413_10123549 | |||
| 1101 | Ga0307410_10281340 | |||
| 1102 | Ga0307409_100174129 | |||
| 1103 | Ga0307409_100213604 | |||
| 1104 | Ga0307409_100708557 | |||
| 1105 | Ga0307416_100019535 | |||
| 1106 | Ga0307411_10247877 | |||
| 1107 | Ga0307415_100033139 | |||
| 1108 | Ga0316583_10087685 | |||
| 1109 | Ga0373948_0017955 | |||
| 1110 | Ga0373932_0012097 | |||
| 1111 | Ga0373939_0180308 | |||
| 1112 | Ga0373941_0050039 | |||
| 1113 | Ga0373960_0148312 | |||
| 1114 | Ga0373942_0011297 | |||
| 1115 | Ga0373962_0029125 | |||
| 1116 | Ga0373931_0036011 | |||
| 1117 | Ga0316582_0446940 | |||
| 1118 | Ga0316584_0105339 | |||
| 1119 | Ga0373925_0000465 | |||
| 1120 | Ga0395898_0014341 | |||
| 1121 | Ga0395898_0950810 | |||
| 1122 | Ga0436364_0109597 | |||
| 1123 | Ga0436364_0166911 | |||
| 1124 | Ga0436364_0674082 | |||
| 1125 | Ga0395901_0033443 | |||
| 1126 | Ga0400485_05417 | |||
| 1127 | Ga0400488_13710 | |||
| 1128 | Ga0400486_22540 | |||
| 1129 | Ga0436365_0889838 | |||
| 1130 | Ga0436365_1189683 | |||
| 1131 | Ga0436365_1842056 | |||
| 1132 | Ga0436363_0792619 | |||
| 1133 | Ga0436363_0952188 | |||
| 1134 | Ga0436362_1280188 | |||
| 1135 | Ga0439461_0000185 | |||
| 1136 | Ga0439466_0005710 | |||
| 1137 | Ga0439465_0000060 | |||
| 1138 | Ga0439465_0105929 | |||
| 1139 | Ga0451791_0149111 | |||
| 1140 | Ga0451793_0748559 | |||
| 1141 | Ga0451841_0274634 | |||
| 1142 | Ga0439442_026321 | |||
| 1143 | Ga0439445_0006212 | |||
| 1144 | Ga0439445_0025196 | |||
| 1145 | Ga0439434_0008822 | |||
| 1146 | Ga0439434_0013038 | |||
| 1147 | Ga0439435_0069657 | |||
| 1148 | Ga0466972_0004246 | |||
| 1149 | Ga0466972_0006240 | |||
| 1150 | Ga0466972_0023859 | |||
| 1151 | Ga0466972_0059377 | |||
| 1152 | Ga0466965_0022927 | |||
| 1153 | Ga0466965_0065468 | |||
| 1154 | Ga0466965_0071980 | |||
| 1155 | Ga0466965_0084113 | |||
| 1156 | Ga0466965_0095009 | |||
| 1157 | Ga0466966_0007032 | |||
| 1158 | Ga0466966_0025400 | |||
| 1159 | Ga0466966_0066122 | |||
| 1160 | Ga0466961_0003256 | |||
| 1161 | Ga0466961_0030169 | |||
| 1162 | Ga0466961_0033442 | |||
| 1163 | Ga0466961_0099398 | |||
| 1164 | Ga0466963_0032537 | |||
| 1165 | Ga0466963_0037680 | |||
| 1166 | Ga0466963_0059594 | |||
| 1167 | Ga0466964_0037327 | |||
| 1168 | Ga0466971_0031618 | |||
| 1169 | Ga0466971_0039657 | |||
| 1170 | Ga0466968_0000412 | |||
| 1171 | Ga0466968_0000969 | |||
| 1172 | Ga0466968_0015951 | |||
| 1173 | Ga0466968_0016051 | |||
| 1174 | Ga0466968_0021901 | |||
| 1175 | Ga0466968_0064974 | |||
| 1176 | Ga0466970_0005005 | |||
| 1177 | Ga0466970_0046555 | |||
| 1178 | Ga0466970_0122320 | |||
| 1179 | Ga0466970_0145544 | |||
| 1180 | Ga0466970_0150283 | |||
| 1181 | Ga0466957_0017432 | |||
| 1182 | Ga0466957_0020345 | |||
| 1183 | Ga0466957_0075154 | |||
| 1184 | Ga0466957_0128597 | |||
| 1185 | Ga0466960_0000298 | |||
| 1186 | Ga0466960_0009724 | |||
| 1187 | Ga0466960_0010966 | |||
| 1188 | Ga0466960_0014887 | |||
| 1189 | Ga0466959_0006453 | |||
| 1190 | Ga0466959_0056319 | |||
| 1191 | Ga0466959_0131775 | |||
| 1192 | Ga0466959_0347532 | |||
| 1193 | Ga0466959_0378031 | |||
| 1194 | Ga0466958_0001933 | |||
| 1195 | Ga0466958_0016366 | |||
| 1196 | Ga0466958_0024402 | |||
| 1197 | Ga0466958_0025549 | |||
| 1198 | Ga0466958_0037553 | |||
| 1199 | Ga0466967_0040189 | |||
| 1200 | Ga0466967_0045901 | |||
| 1201 | Ga0466967_0082166 | |||
| 1202 | Ga0466967_0093003 | |||
| 1203 | Ga0466967_0108128 | |||
| 1204 | Ga0466967_0171487 | |||
| 1205 | Ga0466967_0176449 | |||
| 1206 | Ga0466967_0525753 | |||
| 1207 | Ga0495638_0006500 | |||
| 1208 | Ga0495648_0008720 | |||
| 1209 | Ga0495654_0091874 | |||
| 1210 | Ga0495668_0011318 | |||
| 1211 | Ga0495668_0218701 | |||
| 1212 | Ga0495625_0095070 | |||
| 1213 | Ga0495625_0117736 | |||
| 1214 | Ga0495671_0130130 | |||
| 1215 | Ga0495672_0002584 | |||
| 1216 | Ga0495672_0003747 | |||
| 1217 | Ga0495672_0008946 | |||
| 1218 | Ga0495672_0088508 | |||
| 1219 | Ga0495672_0150771 | |||
| 1220 | Ga0495683_0183445 | |||
| 1221 | Ga0495673_0012229 | |||
| 1222 | Ga0495673_0019428 | |||
| 1223 | Ga0495686_0015968 | |||
| 1224 | Ga0495593_0010595 | |||
| 1225 | Ga0496100_0000109 | |||
| 1226 | Ga0496100_0005227 | |||
| 1227 | Ga0496100_0008249 | |||
| 1228 | Ga0496100_0044977 | |||
| 1229 | Ga0496100_0190600 | |||
| 1230 | Ga0496100_0214984 | |||
| 1231 | Ga0496100_0259073 | |||
| 1232 | Ga0496101_0000020 | |||
| 1233 | Ga0496101_0000075 | |||
| 1234 | Ga0496101_0000310 | |||
| 1235 | Ga0496101_0001332 | |||
| 1236 | Ga0496101_0002044 | |||
| 1237 | Ga0496101_0020525 | |||
| 1238 | Ga0496101_0030708 | |||
| 1239 | Ga0496101_0045216 | |||
| 1240 | Ga0496101_0055704 | |||
| 1241 | Ga0496101_0066568 | |||
| 1242 | Ga0496101_0557816 | |||
| 1243 | Ga0496102_0000003 | |||
| 1244 | Ga0496102_0004064 | |||
| 1245 | Ga0496102_0004363 | |||
| 1246 | Ga0496102_0004756 | |||
| 1247 | Ga0496102_0012877 | |||
| 1248 | Ga0496102_0026778 | |||
| 1249 | Ga0496103_0000014 | |||
| 1250 | Ga0496103_0000093 | |||
| 1251 | Ga0496103_0000512 | |||
| 1252 | Ga0496103_0051048 | |||
| 1253 | Ga0496103_0185782 | |||
| 1254 | Ga0496104_0004308 | |||
| 1255 | Ga0496104_0036280 | |||
| 1256 | Ga0496105_0075358 | |||
| 1257 | Ga0496105_0323700 | |||
| 1258 | Ga0496106_0002847 | |||
| 1259 | Ga0496106_0058826 | |||
| 1260 | Ga0496106_0059545 | |||
| 1261 | Ga0496106_0143147 | |||
| 1262 | Ga0496106_0192127 | |||
| 1263 | Ga0496107_0005122 | |||
| 1264 | Ga0496107_0005597 | |||
| 1265 | Ga0496107_0028961 | |||
| 1266 | Ga0496107_0119159 | |||
| 1267 | Ga0496107_0251667 | |||
| 1268 | Ga0496108_0000222 | |||
| 1269 | Ga0496108_0000405 | |||
| 1270 | Ga0496108_0038421 | |||
| 1271 | Ga0496108_0456742 | |||
| 1272 | Ga0496108_0654519 | |||
| 1273 | Ga0496109_0002338 | |||
| 1274 | Ga0496109_0024536 | |||
| 1275 | Ga0496109_0080408 | |||
| 1276 | Ga0496109_0121178 | |||
| 1277 | Ga0496109_0236798 | |||
| 1278 | Ga0496109_0238853 | |||
| 1279 | Ga0496109_0597939 | |||
| 1280 | Ga0496110_0019778 | |||
| 1281 | Ga0496110_0129575 | |||
| 1282 | Ga0496110_0537552 | |||
| 1283 | Ga0496110_0542860 | |||
| 1284 | Ga0496110_0631846 | |||
| 1285 | Ga0496111_0008829 | |||
| 1286 | Ga0496111_0169898 | |||
| 1287 | Ga0496111_0228855 | |||
| 1288 | Ga0496112_0025991 | |||
| 1289 | Ga0496112_0054350 | |||
| 1290 | Ga0496112_0301215 | |||
| 1291 | Ga0496112_0617058 | |||
| 1292 | Ga0496113_0001800 | |||
| 1293 | Ga0496113_0109697 | |||
| 1294 | Ga0496113_0115102 | |||
| 1295 | Ga0496113_0330911 | |||
| 1296 | Ga0496113_0674587 | |||
| 1297 | Ga0496114_0000181 | |||
| 1298 | Ga0496114_0011672 | |||
| 1299 | Ga0496114_0043138 | |||
| 1300 | Ga0496115_0005302 | |||
| 1301 | Ga0496115_0009311 | |||
| 1302 | Ga0496115_0037126 | |||
| 1303 | Ga0496116_0000071 | |||
| 1304 | Ga0496116_0004420 | |||
| 1305 | Ga0496116_0015952 | |||
| 1306 | Ga0496117_0000003 | |||
| 1307 | Ga0496117_0000711 | |||
| 1308 | Ga0496118_0000001 | |||
| 1309 | Ga0496118_0000488 | |||
| 1310 | Ga0496118_0068619 | |||
| 1311 | Ga0496119_0000266 | |||
| 1312 | Ga0496119_0002301 | |||
| 1313 | Ga0496119_0002624 | |||
| 1314 | Ga0496119_0120032 | |||
| 1315 | Ga0496120_0000235 | |||
| 1316 | Ga0496120_0001188 | |||
| 1317 | Ga0496120_0034101 | |||
| 1318 | Ga0496121_0000002 | |||
| 1319 | Ga0496121_0000019 | |||
| 1320 | Ga0496121_0006826 | |||
| 1321 | Ga0496122_0000312 | |||
| 1322 | Ga0496122_0012626 | |||
| 1323 | Ga0496122_0017076 | |||
| 1324 | Ga0496122_0312790 | |||
| 1325 | Ga0496123_0003426 | |||
| 1326 | Ga0496123_0019484 | |||
| 1327 | Ga0496124_0000002 | |||
| 1328 | Ga0496124_0008699 | |||
| 1329 | Ga0496124_0211984 | |||
| 1330 | Ga0496125_0000002 | |||
| 1331 | Ga0496125_0055291 | |||
| 1332 | Ga0496125_0160805 | |||
| 1333 | Ga0496126_0000011 | |||
| 1334 | Ga0496126_0003151 | |||
| 1335 | Ga0496126_0004196 | |||
| 1336 | Ga0496126_0021074 | |||
| 1337 | Ga0496126_0029729 | |||
| 1338 | Ga0496126_0212040 | |||
| 1339 | Ga0496126_0494612 | |||
| 1340 | Ga0501032_0000469 | |||
| 1341 | Ga0501032_0038979 | |||
| 1342 | Ga0501034_0009642 | |||
| 1343 | Ga0501034_0011897 | |||
| 1344 | Ga0501036_0016952 | |||
| 1345 | Ga0501037_0000234 | |||
| 1346 | Ga0501038_0000365 | |||
| 1347 | Ga0501039_0000113 | |||
| 1348 | Ga0501039_0586768 | |||
| 1349 | Ga0501043_0000082 | |||
| 1350 | Ga0501043_0141367 | |||
| 1351 | Ga0501043_0259167 | |||
| 1352 | Ga0501047_0008566 | |||
| 1353 | Ga0501047_0567756 | |||
| 1354 | Ga0501048_0232310 | |||
| 1355 | Ga0501067_0226201 | |||
| 1356 | Ga0501070_0001505 | |||
| 1357 | Ga0501071_0319850 | |||
| 1358 | Ga0501072_0127722 | |||
| 1359 | Ga0501073_0144970 | |||
| 1360 | Ga0501076_0103222 | |||
| 1361 | Ga0501080_0029877 | |||
| 1362 | Ga0501035_0009531 | |||
| 1363 | Ga0501044_0003845 | |||
| 1364 | Ga0501044_0008670 | |||
| 1365 | Ga0501044_0013412 | |||
| 1366 | nmdc:mga03683_135079_c1 | |||
| 1367 | nmdc:mga03683_30607_c1 | |||
| 1368 | nmdc:mga03n38_1202_c1 | |||
| 1369 | nmdc:mga03n38_21750_c1 | |||
| 1370 | nmdc:mga03n38_293550_c1 | |||
| 1371 | nmdc:mga03n38_37775_c1 | |||
| 1372 | nmdc:mga03n38_435_c1 | |||
| 1373 | nmdc:mga03n38_76454_c1 | |||
| 1374 | nmdc:mga00v17_140178_c1 | |||
| 1375 | nmdc:mga00v17_142939_c1 | |||
| 1376 | nmdc:mga00v17_265643_c1 | |||
| 1377 | nmdc:mga00v17_4868_c1 | |||
| 1378 | nmdc:mga00v17_5302_c1 | |||
| 1379 | nmdc:mga00v17_5879_c1 | |||
| 1380 | nmdc:mga00v17_6485_c1 | |||
| 1381 | nmdc:mga0yw44_27834_c1 | |||
| 1382 | nmdc:mga0yw44_512_c1 | |||
| 1383 | nmdc:mga0k408_327613_c1 | |||
| 1384 | nmdc:mga06z11_108728_c1 | |||
| 1385 | nmdc:mga06z11_43756_c1 | |||
| 1386 | nmdc:mga04h51_6791_c1 | |||
| 1387 | nmdc:mga07m45_115305_c1 | |||
| 1388 | nmdc:mga07m45_13773_c1 | |||
| 1389 | nmdc:mga07m45_1418_c1 | |||
| 1390 | nmdc:mga07m45_169682_c1 | |||
| 1391 | nmdc:mga07m45_250642_c1 | |||
| 1392 | nmdc:mga07m45_29031_c1 | |||
| 1393 | nmdc:mga07m45_343084_c1 | |||
| 1394 | nmdc:mga05p37_28521_c1 | |||
| 1395 | nmdc:mga0qj67_23517_c1 | |||
| 1396 | nmdc:mga0qj67_267627_c1 | |||
| 1397 | nmdc:mga0sz30_11295_c1 | |||
| 1398 | nmdc:mga0sz30_148938_c1 | |||
| 1399 | nmdc:mga0sz30_2088_c1 | |||
| 1400 | nmdc:mga0sz30_29181_c1 | |||
| 1401 | nmdc:mga0sz30_7358_c1 | |||
| 1402 | nmdc:mga0sz30_7673_c1 | |||
| 1403 | nmdc:mga0sz30_89784_c1 | |||
| 1404 | Ga0500635_0043582 | |||
| 1405 | Ga0495655_0031366 | |||
| 1406 | Ga0500643_001890 | |||
| 1407 | Ga0500643_004512 | |||
| 1408 | Ga0500643_010251 | |||
| 1409 | Ga0500556_0008054 | |||
| 1410 | Ga0500642_0056149 | |||
| 1411 | Ga0500652_033856 | |||
| 1412 | Ga0500616_0003117 | |||
| 1413 | Ga0500616_0094853 | |||
| 1414 | Ga0500616_0126342 | |||
| 1415 | Ga0500627_0047935 | |||
| 1416 | Ga0500645_000075 | |||
| 1417 | Ga0466962_0034873 | |||
| 1418 | Ga0466962_0120602 | |||
| 1419 | Ga0530510_0269726 | |||
| 1420 | 2644490050 | |||
| 1421 | 2644512940 | |||
| 1422 | 2644635722 | |||
| 1423 | 2738664285 | |||
| 1424 | 2739143420 | |||
| 1425 | 2842136803 | |||
| 1426 | 2866552148 | |||
| 1427 | 2870787103 | |||
| 1428 | 2902793009 | |||
| 1429 | 2902797430 | |||
| 1430 | 2902801812 | |||
| 1431 | 2902812392 | |||
| 1432 | 2902813672 | |||
| 1433 | 2902841682 | |||
| 1434 | 2929213803 | |||
| 1435 | 2939589092 | |||
| 1436 | 3003001325 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x1k-assembly1.cif.gz_B | crystal structure of the flagellar expression regulator degu from listeria monocytogenes | 0.9923 | 189 | 247 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9883 | 189 | 247 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9882 | 189 | 247 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.986 | 189 | 247 |
| 6kju-assembly1.cif.gz_A | huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors | 0.9857 | 189 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9945 | 189 | 245 | 1.10.10.10 |
| 4hyeB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9785 | 189 | 247 | 1.10.10.10 |
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9763 | 189 | 243 | 1.10.10.10 |
| 3qp6A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9719 | 189 | 245 | 1.10.10.10 |
| 3cloA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9603 | 189 | 243 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7A5F5-F1-model_v4 | Two-component system response regulator | 0.9612 | 62 | 158 |
GO:0000160
|
| AF-B6DCI9-F1-model_v4 | GacA | 0.9583 | 69 | 159 |
GO:0000160
|
| AF-A0A7W0GWP8-F1-model_v4 | Response regulator transcription factor | 0.9575 | 36 | 157 |
GO:0000160
|
| AF-A0A2M7A5F5-F1-model_v4 | Two-component system response regulator | 0.9424 | 62 | 158 |
GO:0000160
|
| AF-A0A847YI07-F1-model_v4 | Response regulator | 0.9388 | 35 | 155 |
GO:0000160
GO:0006935 |