F477181

General Info

Members Datasets Scaffolds Average Seq Length
718 322 1436 222

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0609856|Ga0395900_0609856_136_804
Length 217
Sequence MQSPPATPLRLVMVDDHEMVLHGLVAMLGHFADQVTISGQATTALVAEEEPEVVLCDVRIGRESGLDLCRQITTQYADTKVVLLTVYDDEHYLYQALRVGASGYILKRIDGQELVAHLRRVREGETVIDHALAGRVALSAARLNAGEFWPGAHLGLTQRESEVLELLVSGHSNKGVAAKLVVSEDTVKTHIRGLYRKLGVSDRSGAIAVALREGLFR

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
201 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
202 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
298 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
302 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
308 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
309 2643221692 Nocardia sp. Root136 Isolate Unclassified
310 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
311 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
312 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
313 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
314 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
315 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
316 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
317 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
318 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
319 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
320 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
321 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
322 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.67
Nodule 0.14
Rhizoplane 11.14
Rhizosphere 65.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0609856 3300037418 Bacteria 1031
2 JGI24737J22298_10017351 3300001990 Bacteria 2320
3 JGI24743J22301_10000706 3300001991 Bacteria 4125
4 JGI24750J21931_1001321 3300002070 Bacteria 3121
5 JGI24738J21930_10004733 3300002075 Bacteria 3315
6 JGI24738J21930_10031264 3300002075 Bacteria 1086
7 JGI24744J21845_10003959 3300002077 Bacteria 3055
8 JGI24744J21845_10005701 3300002077 Bacteria 2580
9 JGI24034J26672_10001252 3300002239 Bacteria 3331
10 JGI24742J22300_10000645 3300002244 Bacteria 5252
11 JGI24742J22300_10009587 3300002244 Bacteria 1599
12 rootH2_10007847 3300003320 Bacteria 4332
13 Ga0055540_1000044 3300003792 Bacteria 153394
14 Ga0055540_1004604 3300003792 Bacteria 6124
15 Ga0055540_1011097 3300003792 Bacteria 2939
16 Ga0070658_10341471 3300005327 Bacteria 1281
17 Ga0070683_100143368 3300005329 Bacteria 2263
18 Ga0070690_100011762 3300005330 Bacteria 5130
19 Ga0070677_10308029 3300005333 Bacteria 807
20 Ga0068869_100395891 3300005334 Bacteria 1135
21 Ga0070666_10089765 3300005335 Bacteria 2110
22 Ga0070666_10239736 3300005335 Bacteria 1282
23 Ga0070666_10421395 3300005335 Bacteria 961
24 Ga0070682_100004933 3300005337 Bacteria 7408
25 Ga0070682_100010131 3300005337 Bacteria 5344
26 Ga0068868_100002812 3300005338 Bacteria 12059
27 Ga0068868_100082181 3300005338 Bacteria 2583
28 Ga0070689_100052956 3300005340 Bacteria 3140
29 Ga0070689_100072816 3300005340 Bacteria 2686
30 Ga0070691_10005230 3300005341 Bacteria 5894
31 Ga0070691_10222286 3300005341 Bacteria 1001
32 Ga0070692_10039242 3300005345 Bacteria 2417
33 Ga0070668_100005941 3300005347 Bacteria 9049
34 Ga0070668_100043134 3300005347 Bacteria 3459
35 Ga0070668_100414938 3300005347 Bacteria 1152
36 Ga0070669_100012086 3300005353 Bacteria 6128
37 Ga0070669_100207659 3300005353 Bacteria 1544
38 Ga0070669_100294549 3300005353 Bacteria 1304
39 Ga0070671_100107568 3300005355 Bacteria 2342
40 Ga0070674_100003739 3300005356 Bacteria 8583
41 Ga0070674_100066583 3300005356 Bacteria 2531
42 Ga0070674_100109314 3300005356 Bacteria 2027
43 Ga0070688_100008640 3300005365 Bacteria 5543
44 Ga0070688_100084050 3300005365 Bacteria 2067
45 Ga0070659_100024813 3300005366 Bacteria 4599
46 Ga0070659_100082462 3300005366 Bacteria 2569
47 Ga0070667_100000074 3300005367 Bacteria 121299
48 Ga0070667_100005546 3300005367 Bacteria 10529
49 Ga0070667_100014115 3300005367 Bacteria 6601
50 Ga0070667_100293555 3300005367 Bacteria 1462
51 Ga0070667_100450152 3300005367 Bacteria 1176
52 Ga0070709_10113631 3300005434 Bacteria 1824
53 Ga0070714_100393188 3300005435 Bacteria 1309
54 Ga0070713_100013669 3300005436 Bacteria 6000
55 Ga0070710_10001139 3300005437 Bacteria 12601
56 Ga0070710_10391999 3300005437 Bacteria 929
57 Ga0070701_10004473 3300005438 Bacteria 5672
58 Ga0070711_100000479 3300005439 Bacteria 20826
59 Ga0070711_100001760 3300005439 Bacteria 12019
60 Ga0070711_100221420 3300005439 Bacteria 1471
61 Ga0070705_100092914 3300005440 Bacteria 1884
62 Ga0070705_100217602 3300005440 Bacteria 1321
63 Ga0070700_100010521 3300005441 Bacteria 5112
64 Ga0070694_100282211 3300005444 Bacteria 1266
65 Ga0070663_100028178 3300005455 Bacteria 3821
66 Ga0070663_100085485 3300005455 Bacteria 2328
67 Ga0070663_100152471 3300005455 Bacteria 1773
68 Ga0070663_100173251 3300005455 Bacteria 1669
69 Ga0070663_100258765 3300005455 Bacteria 1380
70 Ga0070678_100000595 3300005456 Bacteria 17762
71 Ga0070662_100063895 3300005457 Bacteria 2694
72 Ga0068867_100001973 3300005459 Bacteria 14304
73 Ga0068867_100153185 3300005459 Bacteria 1812
74 Ga0070685_10113710 3300005466 Bacteria 1672
75 Ga0070685_10126078 3300005466 Bacteria 1595
76 Ga0070706_100005214 3300005467 Bacteria 12398
77 Ga0070698_100002967 3300005471 Bacteria 18663
78 Ga0070679_100764772 3300005530 Bacteria 909
79 Ga0070684_100045721 3300005535 Bacteria 3791
80 Ga0068853_100013047 3300005539 Bacteria 6776
81 Ga0068853_100027722 3300005539 Bacteria 4761
82 Ga0068853_100087726 3300005539 Bacteria 2730
83 Ga0068853_100188058 3300005539 Bacteria 1875
84 Ga0068853_100748885 3300005539 Bacteria 934
85 Ga0070672_100067670 3300005543 Bacteria 2830
86 Ga0070672_100403508 3300005543 Bacteria 1172
87 Ga0070686_100275487 3300005544 Bacteria 1239
88 Ga0070695_100024200 3300005545 Bacteria 3739
89 Ga0070696_100081372 3300005546 Bacteria 2295
90 Ga0070693_100124355 3300005547 Bacteria 1604
91 Ga0070693_100227826 3300005547 Bacteria 1225
92 Ga0070665_100004155 3300005548 Bacteria 15236
93 Ga0070665_100005707 3300005548 Bacteria 12778
94 Ga0070665_100019535 3300005548 Bacteria 6802
95 Ga0070665_100057570 3300005548 Bacteria 3896
96 Ga0070665_100141611 3300005548 Bacteria 2408
97 Ga0070704_100000666 3300005549 Bacteria 16615
98 Ga0070704_100135752 3300005549 Bacteria 1913
99 Ga0068855_100108707 3300005563 Bacteria 3185
100 Ga0068855_100398404 3300005563 Bacteria 1509
101 Ga0068857_100395612 3300005577 Bacteria 1285
102 Ga0068854_100003429 3300005578 Bacteria 9883
103 Ga0068854_100304584 3300005578 Bacteria 1290
104 Ga0070702_100071437 3300005615 Bacteria 2051
105 Ga0068852_100149584 3300005616 Bacteria 2170
106 Ga0068859_100000567 3300005617 Bacteria 36774
107 Ga0068859_100012214 3300005617 Bacteria 8634
108 Ga0068859_100444675 3300005617 Bacteria 1392
109 Ga0068864_100050538 3300005618 Bacteria 3579
110 Ga0068864_100322235 3300005618 Bacteria 1452
111 Ga0068864_100380874 3300005618 Bacteria 1337
112 Ga0068864_100568416 3300005618 Bacteria 1098
113 Ga0068864_100730701 3300005618 Bacteria 969
114 Ga0068866_10001475 3300005718 Bacteria 10029
115 Ga0068866_10007613 3300005718 Bacteria 4539
116 Ga0068861_100029389 3300005719 Bacteria 4021
117 Ga0068861_100279129 3300005719 Bacteria 1438
118 Ga0068851_10024994 3300005834 Bacteria 2928
119 Ga0068863_100001963 3300005841 Bacteria 20438
120 Ga0068863_100002994 3300005841 Bacteria 16700
121 Ga0068863_100150728 3300005841 Bacteria 2225
122 Ga0068858_100015365 3300005842 Bacteria 7200
123 Ga0068858_100092957 3300005842 Bacteria 2808
124 Ga0068860_100000276 3300005843 Bacteria 74447
125 Ga0068860_100011255 3300005843 Bacteria 8817
126 Ga0068862_100000065 3300005844 Bacteria 124435
127 Ga0068862_100099705 3300005844 Bacteria 2539
128 Ga0068862_100980316 3300005844 Bacteria 835
129 Ga0081455_10041314 3300005937 Bacteria 4057
130 Ga0081455_10068507 3300005937 Bacteria 2953
131 Ga0081455_10096638 3300005937 Bacteria 2382
132 Ga0081540_1119944 3300005983 Bacteria 1093
133 Ga0070717_10073663 3300006028 Bacteria 2854
134 Ga0070717_10118701 3300006028 Bacteria 2264
135 Ga0070717_10210554 3300006028 Bacteria 1706
136 Ga0075365_10109707 3300006038 Bacteria 1896
137 Ga0075365_10398454 3300006038 Bacteria 971
138 Ga0075368_10096850 3300006042 Bacteria 1209
139 Ga0075363_100000288 3300006048 Bacteria 14614
140 Ga0075363_100016182 3300006048 Bacteria 3680
141 Ga0075363_100025973 3300006048 Bacteria 2993
142 Ga0075363_100122047 3300006048 Bacteria 1456
143 Ga0075364_10000591 3300006051 Bacteria 18727
144 Ga0075364_10004624 3300006051 Bacteria 7934
145 Ga0075364_10027240 3300006051 Bacteria 3649
146 Ga0075364_10342981 3300006051 Bacteria 1018
147 Ga0070716_100050770 3300006173 Bacteria 2356
148 Ga0070712_100002669 3300006175 Bacteria 11008
149 Ga0070712_100007238 3300006175 Bacteria 6924
150 Ga0070712_100114627 3300006175 Bacteria 2018
151 Ga0075362_10004246 3300006177 Bacteria 5120
152 Ga0075362_10020527 3300006177 Bacteria 2761
153 Ga0075362_10142229 3300006177 Bacteria 1147
154 Ga0075367_10004233 3300006178 Bacteria 6969
155 Ga0075367_10155463 3300006178 Bacteria 1421
156 Ga0075369_10000174 3300006186 Bacteria 18341
157 Ga0075369_10000333 3300006186 Bacteria 14045
158 Ga0075369_10001566 3300006186 Bacteria 7846
159 Ga0075369_10002203 3300006186 Bacteria 6896
160 Ga0075369_10008524 3300006186 Bacteria 3947
161 Ga0075369_10013179 3300006186 Bacteria 3275
162 Ga0075369_10020744 3300006186 Bacteria 2693
163 Ga0075369_10034370 3300006186 Bacteria 2151
164 Ga0075369_10036600 3300006186 Bacteria 2088
165 Ga0075369_10042723 3300006186 Bacteria 1943
166 Ga0075369_10048526 3300006186 Bacteria 1832
167 Ga0075369_10118775 3300006186 Bacteria 1196
168 Ga0075369_10289448 3300006186 Bacteria 764
169 Ga0075366_10322339 3300006195 Bacteria 947
170 Ga0097621_100100697 3300006237 Bacteria 2431
171 Ga0075370_10045146 3300006353 Bacteria 2492
172 Ga0075370_10048459 3300006353 Bacteria 2407
173 Ga0075370_10117729 3300006353 Bacteria 1545
174 Ga0075370_10141055 3300006353 Bacteria 1409
175 Ga0075370_10201464 3300006353 Bacteria 1174
176 Ga0068871_100132570 3300006358 Bacteria 2114
177 Ga0068871_100359902 3300006358 Bacteria 1289
178 Ga0075428_100023896 3300006844 Bacteria 6763
179 Ga0075430_100003713 3300006846 Bacteria 12831
180 Ga0075431_100177920 3300006847 Bacteria 2184
181 Ga0068865_100016530 3300006881 Bacteria 4724
182 Ga0068865_100150829 3300006881 Bacteria 1763
183 Ga0097620_100000567 3300006931 Bacteria 36774
184 Ga0097620_100012214 3300006931 Bacteria 8634
185 Ga0097620_100444628 3300006931 Bacteria 1392
186 Ga0099795_10003237 3300007788 Bacteria 4006
187 Ga0105250_10073552 3300009092 Bacteria 1382
188 Ga0105245_10004418 3300009098 Bacteria 12440
189 Ga0105245_10187753 3300009098 Bacteria 1978
190 Ga0105245_10247155 3300009098 Bacteria 1732
191 Ga0105247_10000017 3300009101 Bacteria 260438
192 Ga0105247_10002837 3300009101 Bacteria 11562
193 Ga0105247_10103865 3300009101 Bacteria 1820
194 Ga0105247_10158216 3300009101 Bacteria 1498
195 Ga0114129_10089982 3300009147 Bacteria 4255
196 Ga0105243_10005087 3300009148 Bacteria 10316
197 Ga0105243_10018750 3300009148 Bacteria 5241
198 Ga0105243_10151180 3300009148 Bacteria 1992
199 Ga0105243_10422207 3300009148 Bacteria 1244
200 Ga0105241_10020983 3300009174 Bacteria 4828
201 Ga0105242_10001113 3300009176 Bacteria 21179
202 Ga0105242_10029712 3300009176 Bacteria 4359
203 Ga0105248_10000194 3300009177 Bacteria 70286
204 Ga0105248_10003348 3300009177 Bacteria 17817
205 Ga0105248_10019251 3300009177 Bacteria 7553
206 Ga0105237_10003695 3300009545 Bacteria 18037
207 Ga0105237_10057089 3300009545 Bacteria 3907
208 Ga0105237_10134668 3300009545 Bacteria 2465
209 Ga0105238_10089712 3300009551 Bacteria 3061
210 Ga0105238_10216295 3300009551 Bacteria 1892
211 Ga0105249_10000096 3300009553 Bacteria 121083
212 Ga0105249_10001976 3300009553 Bacteria 17791
213 Ga0105249_10160009 3300009553 Bacteria 2175
214 Ga0105032_102023 3300009979 Bacteria 1833
215 Ga0105239_10009981 3300010375 Bacteria 10657
216 Ga0105239_10010576 3300010375 Bacteria 10315
217 Ga0105239_10126490 3300010375 Bacteria 2841
218 Ga0105239_10141106 3300010375 Bacteria 2685
219 Ga0105239_10515987 3300010375 Bacteria 1359
220 Ga0105246_10019937 3300011119 Bacteria 4296
221 Ga0105246_10250843 3300011119 Bacteria 1404
222 Ga0105246_10327228 3300011119 Bacteria 1248
223 Ga0157369_10353423 3300013105 Bacteria 1526
224 Ga0157374_10132704 3300013296 Bacteria 2411
225 Ga0157374_10183972 3300013296 Bacteria 2042
226 Ga0157378_10006478 3300013297 Bacteria 10239
227 Ga0157378_10233861 3300013297 Bacteria 1752
228 Ga0163162_10005025 3300013306 Bacteria 12742
229 Ga0163162_10016373 3300013306 Bacteria 7247
230 Ga0163162_10322630 3300013306 Bacteria 1677
231 Ga0157372_10007458 3300013307 Bacteria 11634
232 Ga0157375_10014077 3300013308 Bacteria 7132
233 Ga0157375_10565307 3300013308 Bacteria 1298
234 Ga0163163_10613719 3300014325 Bacteria 1151
235 Ga0157380_10000771 3300014326 Bacteria 20026
236 Ga0157377_10248506 3300014745 Bacteria 1152
237 Ga0157379_10006231 3300014968 Bacteria 10271
238 Ga0157379_10066922 3300014968 Bacteria 3212
239 Ga0157379_10219308 3300014968 Bacteria 1723
240 Ga0157376_10335131 3300014969 Bacteria 1443
241 Ga0163161_10002358 3300017792 Bacteria 13536
242 Ga0163161_10324756 3300017792 Bacteria 1217
243 Ga0213873_10000038 3300021358 Bacteria 33361
244 Ga0213876_10028698 3300021384 Bacteria 2934
245 Ga0213876_10055427 3300021384 Bacteria 2093
246 Ga0213875_10000221 3300021388 Bacteria 57905
247 Ga0213875_10005568 3300021388 Bacteria 6739
248 Ga0213875_10026048 3300021388 Bacteria 2784
249 Ga0213875_10038185 3300021388 Bacteria 2263
250 Ga0209051_1000051 3300025303 Bacteria 283620
251 Ga0209051_1001135 3300025303 Bacteria 24362
252 Ga0209051_1001817 3300025303 Bacteria 16890
253 Ga0209051_1005060 3300025303 Bacteria 7845
254 Ga0209051_1021362 3300025303 Bacteria 2759
255 Ga0207656_10035805 3300025321 Bacteria 2080
256 Ga0207692_10113223 3300025898 Bacteria 1508
257 Ga0207692_10135001 3300025898 Bacteria 1398
258 Ga0207642_10000124 3300025899 Bacteria 21177
259 Ga0207710_10000033 3300025900 Bacteria 260531
260 Ga0207710_10020186 3300025900 Bacteria 2848
261 Ga0207710_10076557 3300025900 Bacteria 1544
262 Ga0207688_10002685 3300025901 Bacteria 9627
263 Ga0207688_10010477 3300025901 Bacteria 5044
264 Ga0207688_10162469 3300025901 Bacteria 1325
265 Ga0207680_10064428 3300025903 Bacteria 2247
266 Ga0207680_10406204 3300025903 Bacteria 963
267 Ga0207647_10114642 3300025904 Bacteria 1592
268 Ga0207647_10160814 3300025904 Bacteria 1310
269 Ga0207685_10009785 3300025905 Bacteria 2800
270 Ga0207685_10169387 3300025905 Bacteria 1004
271 Ga0207699_10147306 3300025906 Bacteria 1554
272 Ga0207699_10172634 3300025906 Bacteria 1447
273 Ga0207645_10012184 3300025907 Bacteria 5839
274 Ga0207705_10308731 3300025909 Bacteria 1214
275 Ga0207684_10024027 3300025910 Bacteria 5200
276 Ga0207671_10052330 3300025914 Bacteria 3026
277 Ga0207671_10179486 3300025914 Bacteria 1647
278 Ga0207693_10001826 3300025915 Bacteria 18674
279 Ga0207693_10002737 3300025915 Bacteria 15258
280 Ga0207663_10045487 3300025916 Bacteria 2700
281 Ga0207662_10057602 3300025918 Bacteria 2323
282 Ga0207657_10130362 3300025919 Bacteria 2061
283 Ga0207652_10137439 3300025921 Bacteria 2183
284 Ga0207646_10174525 3300025922 Bacteria 1941
285 Ga0207681_10000849 3300025923 Bacteria 20076
286 Ga0207681_10150685 3300025923 Bacteria 1742
287 Ga0207681_10349725 3300025923 Bacteria 1183
288 Ga0207687_10010419 3300025927 Bacteria 6075
289 Ga0207687_10179027 3300025927 Bacteria 1641
290 Ga0207687_10194310 3300025927 Bacteria 1582
291 Ga0207700_10110539 3300025928 Bacteria 2210
292 Ga0207664_10059924 3300025929 Bacteria 3033
293 Ga0207664_10226189 3300025929 Bacteria 1625
294 Ga0207664_10300802 3300025929 Bacteria 1411
295 Ga0207664_10321252 3300025929 Bacteria 1366
296 Ga0207664_10326770 3300025929 Bacteria 1354
297 Ga0207644_10002040 3300025931 Bacteria 13075
298 Ga0207644_10077123 3300025931 Bacteria 2453
299 Ga0207644_10459048 3300025931 Bacteria 1047
300 Ga0207690_10075037 3300025932 Bacteria 2344
301 Ga0207690_10701268 3300025932 Bacteria 832
302 Ga0207690_10859480 3300025932 Bacteria 751
303 Ga0207706_10112691 3300025933 Bacteria 2393
304 Ga0207709_10013600 3300025935 Bacteria 4490
305 Ga0207670_10006196 3300025936 Bacteria 6620
306 Ga0207670_10046367 3300025936 Bacteria 2887
307 Ga0207669_10018039 3300025937 Bacteria 3636
308 Ga0207669_10046129 3300025937 Bacteria 2573
309 Ga0207704_10000291 3300025938 Bacteria 23769
310 Ga0207665_10011867 3300025939 Bacteria 5721
311 Ga0207665_10029835 3300025939 Bacteria 3604
312 Ga0207691_10069745 3300025940 Bacteria 3175
313 Ga0207691_10422044 3300025940 Bacteria 1137
314 Ga0207711_10000169 3300025941 Bacteria 70227
315 Ga0207711_10027770 3300025941 Bacteria 4756
316 Ga0207711_10053624 3300025941 Bacteria 3458
317 Ga0207711_10113240 3300025941 Bacteria 2415
318 Ga0207689_10034774 3300025942 Bacteria 4184
319 Ga0207689_10235673 3300025942 Bacteria 1513
320 Ga0207661_10311455 3300025944 Bacteria 1413
321 Ga0207667_10163989 3300025949 Bacteria 2285
322 Ga0207712_10000005 3300025961 Bacteria 608697
323 Ga0207712_10014365 3300025961 Bacteria 5094
324 Ga0207712_10120297 3300025961 Bacteria 1986
325 Ga0207668_10076093 3300025972 Bacteria 2415
326 Ga0207668_10077003 3300025972 Bacteria 2403
327 Ga0207668_10101294 3300025972 Bacteria 2140
328 Ga0207668_10930932 3300025972 Bacteria 774
329 Ga0207640_10007670 3300025981 Bacteria 5962
330 Ga0207640_10164672 3300025981 Bacteria 1645
331 Ga0207658_10000321 3300025986 Bacteria 48316
332 Ga0207658_10002978 3300025986 Bacteria 12110
333 Ga0207658_10024173 3300025986 Bacteria 4248
334 Ga0207658_10169047 3300025986 Bacteria 1799
335 Ga0207658_10192238 3300025986 Bacteria 1697
336 Ga0207658_10255424 3300025986 Bacteria 1491
337 Ga0207677_10005597 3300026023 Bacteria 6826
338 Ga0207703_10027480 3300026035 Bacteria 4481
339 Ga0207703_10549731 3300026035 Bacteria 1089
340 Ga0207703_10843456 3300026035 Bacteria 876
341 Ga0207678_10008103 3300026067 Bacteria 9266
342 Ga0207678_10018663 3300026067 Bacteria 6089
343 Ga0207678_10038498 3300026067 Bacteria 4155
344 Ga0207678_10100697 3300026067 Bacteria 2468
345 Ga0207678_10209133 3300026067 Bacteria 1669
346 Ga0207708_10002264 3300026075 Bacteria 14185
347 Ga0207708_10024779 3300026075 Bacteria 4539
348 Ga0207641_10001342 3300026088 Bacteria 24372
349 Ga0207641_10005082 3300026088 Bacteria 11277
350 Ga0207641_10165747 3300026088 Bacteria 2012
351 Ga0207648_10002008 3300026089 Bacteria 22201
352 Ga0207676_10042274 3300026095 Bacteria 3505
353 Ga0207676_10261453 3300026095 Bacteria 1563
354 Ga0207676_10302924 3300026095 Bacteria 1460
355 Ga0207676_10351881 3300026095 Bacteria 1362
356 Ga0207676_10770159 3300026095 Bacteria 937
357 Ga0207674_10078136 3300026116 Bacteria 3315
358 Ga0207675_100003453 3300026118 Bacteria 15445
359 Ga0207675_100105439 3300026118 Bacteria 2657
360 Ga0207675_100132073 3300026118 Bacteria 2368
361 Ga0207675_100703811 3300026118 Bacteria 1019
362 Ga0207683_10003523 3300026121 Bacteria 13651
363 Ga0207683_10082669 3300026121 Bacteria 2853
364 Ga0207683_10093099 3300026121 Bacteria 2685
365 Ga0207683_10479874 3300026121 Bacteria 1147
366 Ga0207698_10490636 3300026142 Bacteria 1193
367 Ga0209813_10009588 3300027866 Bacteria 2482
368 Ga0268266_10002162 3300028379 Bacteria 21575
369 Ga0268266_10014326 3300028379 Bacteria 6818
370 Ga0268266_10051711 3300028379 Bacteria 3527
371 Ga0268266_10063446 3300028379 Bacteria 3189
372 Ga0268266_10072953 3300028379 Bacteria 2978
373 Ga0268266_10108442 3300028379 Bacteria 2457
374 Ga0268265_10000022 3300028380 Bacteria 270788
375 Ga0268265_10113828 3300028380 Bacteria 2214
376 Ga0268265_11081860 3300028380 Bacteria 795
377 Ga0268264_10000005 3300028381 Bacteria 934972
378 Ga0268264_10002955 3300028381 Bacteria 14764
379 Ga0265327_10005197 3300031251 Bacteria 11000
380 Ga0307513_10566709 3300031456 Bacteria 847
381 Ga0307509_10080875 3300031507 Bacteria 3359
382 Ga0307413_10123549 3300031824 Bacteria 1758
383 Ga0307410_10281340 3300031852 Bacteria 1305
384 Ga0307409_100174129 3300031995 Bacteria 1897
385 Ga0307409_100213604 3300031995 Bacteria 1736
386 Ga0307409_100708557 3300031995 Bacteria 1007
387 Ga0307416_100019535 3300032002 Bacteria 4807
388 Ga0307411_10247877 3300032005 Bacteria 1399
389 Ga0307415_100033139 3300032126 Bacteria 3351
390 Ga0316583_10087685 3300032133 Bacteria 1086
391 Ga0373948_0017955 3300034817 Bacteria 1324
392 Ga0373932_0012097 3300035112 Bacteria 2121
393 Ga0373939_0180308 3300035114 Bacteria 787
394 Ga0373941_0050039 3300035115 Bacteria 1325
395 Ga0373960_0148312 3300035121 Bacteria 799
396 Ga0373942_0011297 3300035207 Bacteria 2116
397 Ga0373962_0029125 3300035242 Bacteria 1503
398 Ga0373931_0036011 3300035691 Bacteria 2577
399 Ga0316582_0446940 3300036647 Bacteria 891
400 Ga0316584_0105339 3300036712 Bacteria 2110
401 Ga0373925_0000465 3300037068 Bacteria 40706
402 Ga0395898_0014341 3300037466 Bacteria 8145
403 Ga0395898_0950810 3300037466 Bacteria 796
404 Ga0436364_0109597 3300037853 Bacteria 56310
405 Ga0436364_0166911 3300037853 Bacteria 14228
406 Ga0436364_0674082 3300037853 Bacteria 2694
407 Ga0395901_0033443 3300038443 Bacteria 5309
408 Ga0400485_05417 3300038735 Bacteria 29589
409 Ga0400488_13710 3300038741 Bacteria 2490
410 Ga0400486_22540 3300038742 Bacteria 84879
411 Ga0436365_0889838 3300039437 Bacteria 6711
412 Ga0436365_1189683 3300039437 Bacteria 5254
413 Ga0436365_1842056 3300039437 Bacteria 4812
414 Ga0436363_0792619 3300039450 Bacteria 1024
415 Ga0436363_0952188 3300039450 Bacteria 1272
416 Ga0436362_1280188 3300039453 Bacteria 53853
417 Ga0439461_0000185 3300041410 Bacteria 8524
418 Ga0439466_0005710 3300041411 Bacteria 4744
419 Ga0439465_0000060 3300041413 Bacteria 23285
420 Ga0439465_0105929 3300041413 Bacteria 974
421 Ga0451791_0149111 3300041451 Bacteria 884
422 Ga0451793_0748559 3300041452 Bacteria 1366
423 Ga0451841_0274634 3300041498 Bacteria 1010
424 Ga0439442_026321 3300042002 Bacteria 1211
425 Ga0439445_0006212 3300042004 Bacteria 2743
426 Ga0439445_0025196 3300042004 Bacteria 1516
427 Ga0439434_0008822 3300042435 Bacteria 2963
428 Ga0439434_0013038 3300042435 Bacteria 2465
429 Ga0439435_0069657 3300042436 Bacteria 1040
430 Ga0466972_0004246 3300044658 Bacteria 7163
431 Ga0466972_0006240 3300044658 Bacteria 5987
432 Ga0466972_0023859 3300044658 Bacteria 3039
433 Ga0466972_0059377 3300044658 Bacteria 1836
434 Ga0466965_0022927 3300044683 Bacteria 3012
435 Ga0466965_0065468 3300044683 Bacteria 1821
436 Ga0466965_0071980 3300044683 Bacteria 1739
437 Ga0466965_0084113 3300044683 Bacteria 1611
438 Ga0466965_0095009 3300044683 Bacteria 1520
439 Ga0466966_0007032 3300044684 Bacteria 7451
440 Ga0466966_0025400 3300044684 Bacteria 3870
441 Ga0466966_0066122 3300044684 Bacteria 2272
442 Ga0466961_0003256 3300044693 Bacteria 10107
443 Ga0466961_0030169 3300044693 Bacteria 3485
444 Ga0466961_0033442 3300044693 Bacteria 3303
445 Ga0466961_0099398 3300044693 Bacteria 1834
446 Ga0466963_0032537 3300044694 Bacteria 3378
447 Ga0466963_0037680 3300044694 Bacteria 3159
448 Ga0466963_0059594 3300044694 Bacteria 2548
449 Ga0466964_0037327 3300044706 Bacteria 1951
450 Ga0466971_0031618 3300044719 Bacteria 2370
451 Ga0466971_0039657 3300044719 Bacteria 2113
452 Ga0466968_0000412 3300044735 Bacteria 14204
453 Ga0466968_0000969 3300044735 Bacteria 10088
454 Ga0466968_0015951 3300044735 Bacteria 2985
455 Ga0466968_0016051 3300044735 Bacteria 2976
456 Ga0466968_0021901 3300044735 Bacteria 2592
457 Ga0466968_0064974 3300044735 Bacteria 1579
458 Ga0466970_0005005 3300044765 Bacteria 6547
459 Ga0466970_0046555 3300044765 Bacteria 2310
460 Ga0466970_0122320 3300044765 Bacteria 1426
461 Ga0466970_0145544 3300044765 Bacteria 1307
462 Ga0466970_0150283 3300044765 Bacteria 1285
463 Ga0466957_0017432 3300044842 Bacteria 4206
464 Ga0466957_0020345 3300044842 Bacteria 3904
465 Ga0466957_0075154 3300044842 Bacteria 2096
466 Ga0466957_0128597 3300044842 Bacteria 1620
467 Ga0466960_0000298 3300044901 Bacteria 17254
468 Ga0466960_0009724 3300044901 Bacteria 3976
469 Ga0466960_0010966 3300044901 Bacteria 3774
470 Ga0466960_0014887 3300044901 Bacteria 3342
471 Ga0466959_0006453 3300045049 Bacteria 8122
472 Ga0466959_0056319 3300045049 Bacteria 2868
473 Ga0466959_0131775 3300045049 Bacteria 1771
474 Ga0466959_0347532 3300045049 Bacteria 1011
475 Ga0466959_0378031 3300045049 Bacteria 964
476 Ga0466958_0001933 3300045836 Bacteria 10158
477 Ga0466958_0016366 3300045836 Bacteria 4270
478 Ga0466958_0024402 3300045836 Bacteria 3558
479 Ga0466958_0025549 3300045836 Bacteria 3483
480 Ga0466958_0037553 3300045836 Bacteria 2902
481 Ga0466967_0040189 3300045976 Bacteria 4026
482 Ga0466967_0045901 3300045976 Bacteria 3800
483 Ga0466967_0082166 3300045976 Bacteria 2911
484 Ga0466967_0093003 3300045976 Bacteria 2743
485 Ga0466967_0108128 3300045976 Bacteria 2551
486 Ga0466967_0171487 3300045976 Bacteria 2042
487 Ga0466967_0176449 3300045976 Bacteria 2013
488 Ga0466967_0525753 3300045976 Bacteria 1163
489 Ga0495638_0006500 3300046460 Bacteria 8500
490 Ga0495648_0008720 3300046524 Bacteria 7942
491 Ga0495654_0091874 3300046530 Bacteria 1407
492 Ga0495668_0011318 3300046616 Bacteria 5350
493 Ga0495668_0218701 3300046616 Bacteria 1043
494 Ga0495625_0095070 3300046660 Bacteria 2055
495 Ga0495625_0117736 3300046660 Bacteria 1811
496 Ga0495671_0130130 3300046692 Bacteria 1227
497 Ga0495672_0002584 3300047320 Bacteria 16441
498 Ga0495672_0003747 3300047320 Bacteria 12818
499 Ga0495672_0008946 3300047320 Bacteria 7314
500 Ga0495672_0088508 3300047320 Bacteria 1706
501 Ga0495672_0150771 3300047320 Bacteria 1206
502 Ga0495683_0183445 3300047323 Bacteria 954
503 Ga0495673_0012229 3300047469 Bacteria 4566
504 Ga0495673_0019428 3300047469 Bacteria 3403
505 Ga0495686_0015968 3300047472 Bacteria 5104
506 Ga0495593_0010595 3300047673 Bacteria 5318
507 Ga0496100_0000109 3300048903 Bacteria 47454
508 Ga0496100_0005227 3300048903 Bacteria 6972
509 Ga0496100_0008249 3300048903 Bacteria 5804
510 Ga0496100_0044977 3300048903 Bacteria 2831
511 Ga0496100_0190600 3300048903 Bacteria 1488
512 Ga0496100_0214984 3300048903 Bacteria 1408
513 Ga0496100_0259073 3300048903 Bacteria 1289
514 Ga0496101_0000020 3300048904 Bacteria 218859
515 Ga0496101_0000075 3300048904 Bacteria 112785
516 Ga0496101_0000310 3300048904 Bacteria 33833
517 Ga0496101_0001332 3300048904 Bacteria 14794
518 Ga0496101_0002044 3300048904 Bacteria 12282
519 Ga0496101_0020525 3300048904 Bacteria 4525
520 Ga0496101_0030708 3300048904 Bacteria 3771
521 Ga0496101_0045216 3300048904 Bacteria 3153
522 Ga0496101_0055704 3300048904 Bacteria 2857
523 Ga0496101_0066568 3300048904 Bacteria 2628
524 Ga0496101_0557816 3300048904 Bacteria 906
525 Ga0496102_0000003 3300048905 Bacteria 592263
526 Ga0496102_0004064 3300048905 Bacteria 12406
527 Ga0496102_0004363 3300048905 Bacteria 11952
528 Ga0496102_0004756 3300048905 Bacteria 11489
529 Ga0496102_0012877 3300048905 Bacteria 7240
530 Ga0496102_0026778 3300048905 Bacteria 5147
531 Ga0496103_0000014 3300048906 Bacteria 290397
532 Ga0496103_0000093 3300048906 Bacteria 100010
533 Ga0496103_0000512 3300048906 Bacteria 31958
534 Ga0496103_0051048 3300048906 Bacteria 2559
535 Ga0496103_0185782 3300048906 Bacteria 1336
536 Ga0496104_0004308 3300048907 Bacteria 12375
537 Ga0496104_0036280 3300048907 Bacteria 4609
538 Ga0496105_0075358 3300048908 Bacteria 2786
539 Ga0496105_0323700 3300048908 Bacteria 1235
540 Ga0496106_0002847 3300048909 Bacteria 12845
541 Ga0496106_0058826 3300048909 Bacteria 2911
542 Ga0496106_0059545 3300048909 Bacteria 2893
543 Ga0496106_0143147 3300048909 Bacteria 1881
544 Ga0496106_0192127 3300048909 Bacteria 1623
545 Ga0496107_0005122 3300048910 Bacteria 8940
546 Ga0496107_0005597 3300048910 Bacteria 8604
547 Ga0496107_0028961 3300048910 Bacteria 3938
548 Ga0496107_0119159 3300048910 Bacteria 1944
549 Ga0496107_0251667 3300048910 Bacteria 1314
550 Ga0496108_0000222 3300048911 Bacteria 50962
551 Ga0496108_0000405 3300048911 Bacteria 35593
552 Ga0496108_0038421 3300048911 Bacteria 3988
553 Ga0496108_0456742 3300048911 Bacteria 1116
554 Ga0496108_0654519 3300048911 Bacteria 913
555 Ga0496109_0002338 3300048912 Bacteria 15809
556 Ga0496109_0024536 3300048912 Bacteria 5362
557 Ga0496109_0080408 3300048912 Bacteria 3003
558 Ga0496109_0121178 3300048912 Bacteria 2437
559 Ga0496109_0236798 3300048912 Bacteria 1717
560 Ga0496109_0238853 3300048912 Bacteria 1710
561 Ga0496109_0597939 3300048912 Bacteria 1039
562 Ga0496110_0019778 3300048913 Bacteria 5672
563 Ga0496110_0129575 3300048913 Bacteria 2277
564 Ga0496110_0537552 3300048913 Bacteria 1063
565 Ga0496110_0542860 3300048913 Bacteria 1057
566 Ga0496110_0631846 3300048913 Bacteria 970
567 Ga0496111_0008829 3300048914 Bacteria 6697
568 Ga0496111_0169898 3300048914 Bacteria 1620
569 Ga0496111_0228855 3300048914 Bacteria 1381
570 Ga0496112_0025991 3300048915 Bacteria 5627
571 Ga0496112_0054350 3300048915 Bacteria 3934
572 Ga0496112_0301215 3300048915 Bacteria 1548
573 Ga0496112_0617058 3300048915 Bacteria 1016
574 Ga0496113_0001800 3300048916 Bacteria 12155
575 Ga0496113_0109697 3300048916 Bacteria 2146
576 Ga0496113_0115102 3300048916 Bacteria 2097
577 Ga0496113_0330911 3300048916 Bacteria 1221
578 Ga0496113_0674587 3300048916 Bacteria 826
579 Ga0496114_0000181 3300048917 Bacteria 45025
580 Ga0496114_0011672 3300048917 Bacteria 7026
581 Ga0496114_0043138 3300048917 Bacteria 3740
582 Ga0496115_0005302 3300048918 Bacteria 9378
583 Ga0496115_0009311 3300048918 Bacteria 7298
584 Ga0496115_0037126 3300048918 Bacteria 3861
585 Ga0496116_0000071 3300048919 Bacteria 244521
586 Ga0496116_0004420 3300048919 Bacteria 13422
587 Ga0496116_0015952 3300048919 Bacteria 5907
588 Ga0496117_0000003 3300048920 Bacteria 1881097
589 Ga0496117_0000711 3300048920 Bacteria 52638
590 Ga0496118_0000001 3300048921 Bacteria 1881100
591 Ga0496118_0000488 3300048921 Bacteria 65611
592 Ga0496118_0068619 3300048921 Bacteria 2573
593 Ga0496119_0000266 3300048922 Bacteria 74075
594 Ga0496119_0002301 3300048922 Bacteria 21118
595 Ga0496119_0002624 3300048922 Bacteria 19518
596 Ga0496119_0120032 3300048922 Bacteria 1446
597 Ga0496120_0000235 3300048923 Bacteria 94653
598 Ga0496120_0001188 3300048923 Bacteria 33095
599 Ga0496120_0034101 3300048923 Bacteria 3053
600 Ga0496121_0000002 3300048924 Bacteria 1494588
601 Ga0496121_0000019 3300048924 Bacteria 499976
602 Ga0496121_0006826 3300048924 Bacteria 13964
603 Ga0496122_0000312 3300048925 Bacteria 107109
604 Ga0496122_0012626 3300048925 Bacteria 8377
605 Ga0496122_0017076 3300048925 Bacteria 6810
606 Ga0496122_0312790 3300048925 Bacteria 840
607 Ga0496123_0003426 3300048926 Bacteria 17817
608 Ga0496123_0019484 3300048926 Bacteria 5345
609 Ga0496124_0000002 3300048927 Bacteria 1494588
610 Ga0496124_0008699 3300048927 Bacteria 10555
611 Ga0496124_0211984 3300048927 Bacteria 1465
612 Ga0496125_0000002 3300048928 Bacteria 1480920
613 Ga0496125_0055291 3300048928 Bacteria 3235
614 Ga0496125_0160805 3300048928 Bacteria 1526
615 Ga0496126_0000011 3300048929 Bacteria 744275
616 Ga0496126_0003151 3300048929 Bacteria 21253
617 Ga0496126_0004196 3300048929 Bacteria 17363
618 Ga0496126_0021074 3300048929 Bacteria 6375
619 Ga0496126_0029729 3300048929 Bacteria 5187
620 Ga0496126_0212040 3300048929 Bacteria 1630
621 Ga0496126_0494612 3300048929 Bacteria 978
622 Ga0501032_0000469 3300049569 Bacteria 32526
623 Ga0501032_0038979 3300049569 Bacteria 3234
624 Ga0501034_0009642 3300049571 Bacteria 10098
625 Ga0501034_0011897 3300049571 Bacteria 9002
626 Ga0501036_0016952 3300049572 Bacteria 6086
627 Ga0501037_0000234 3300049573 Bacteria 47815
628 Ga0501038_0000365 3300049574 Bacteria 39105
629 Ga0501039_0000113 3300049575 Bacteria 54895
630 Ga0501039_0586768 3300049575 Bacteria 874
631 Ga0501043_0000082 3300049579 Bacteria 84442
632 Ga0501043_0141367 3300049579 Bacteria 1885
633 Ga0501043_0259167 3300049579 Bacteria 1338
634 Ga0501047_0008566 3300049581 Bacteria 9652
635 Ga0501047_0567756 3300049581 Bacteria 958
636 Ga0501048_0232310 3300049582 Bacteria 1309
637 Ga0501067_0226201 3300049583 Bacteria 1041
638 Ga0501070_0001505 3300049586 Bacteria 20787
639 Ga0501071_0319850 3300049587 Bacteria 1178
640 Ga0501072_0127722 3300049588 Bacteria 2026
641 Ga0501073_0144970 3300049589 Bacteria 1645
642 Ga0501076_0103222 3300049592 Bacteria 2300
643 Ga0501080_0029877 3300049742 Bacteria 5073
644 Ga0501035_0009531 3300049822 Bacteria 9030
645 Ga0501044_0003845 3300049823 Bacteria 16843
646 Ga0501044_0008670 3300049823 Bacteria 11134
647 Ga0501044_0013412 3300049823 Bacteria 8862
648 nmdc:mga03683_135079_c1 3300050489 Bacteria 1106
649 nmdc:mga03683_30607_c1 3300050489 Bacteria 2154
650 nmdc:mga03n38_1202_c1 3300050490 Bacteria 7246
651 nmdc:mga03n38_21750_c1 3300050490 Bacteria 2585
652 nmdc:mga03n38_293550_c1 3300050490 Bacteria 871
653 nmdc:mga03n38_37775_c1 3300050490 Bacteria 2085
654 nmdc:mga03n38_435_c1 3300050490 Bacteria 10412
655 nmdc:mga03n38_76454_c1 3300050490 Bacteria 1562
656 nmdc:mga00v17_140178_c1 3300050491 Bacteria 1550
657 nmdc:mga00v17_142939_c1 3300050491 Bacteria 1535
658 nmdc:mga00v17_265643_c1 3300050491 Bacteria 1113
659 nmdc:mga00v17_4868_c1 3300050491 Bacteria 7037
660 nmdc:mga00v17_5302_c1 3300050491 Bacteria 6794
661 nmdc:mga00v17_5879_c1 3300050491 Bacteria 6479
662 nmdc:mga00v17_6485_c1 3300050491 Bacteria 6210
663 nmdc:mga0yw44_27834_c1 3300050492 Bacteria 3243
664 nmdc:mga0yw44_512_c1 3300050492 Bacteria 13855
665 nmdc:mga0k408_327613_c1 3300050493 Bacteria 914
666 nmdc:mga06z11_108728_c1 3300050494 Bacteria 1532
667 nmdc:mga06z11_43756_c1 3300050494 Bacteria 2255
668 nmdc:mga04h51_6791_c1 3300050495 Bacteria 2988
669 nmdc:mga07m45_115305_c1 3300050496 Bacteria 1549
670 nmdc:mga07m45_13773_c1 3300050496 Bacteria 4295
671 nmdc:mga07m45_1418_c1 3300050496 Bacteria 10985
672 nmdc:mga07m45_169682_c1 3300050496 Bacteria 1268
673 nmdc:mga07m45_250642_c1 3300050496 Bacteria 1030
674 nmdc:mga07m45_29031_c1 3300050496 Bacteria 3055
675 nmdc:mga07m45_343084_c1 3300050496 Bacteria 868
676 nmdc:mga05p37_28521_c1 3300050507 Bacteria 6806
677 nmdc:mga0qj67_23517_c1 3300050509 Bacteria 4742
678 nmdc:mga0qj67_267627_c1 3300050509 Bacteria 1386
679 nmdc:mga0sz30_11295_c1 3300050516 Bacteria 3445
680 nmdc:mga0sz30_148938_c1 3300050516 Bacteria 1035
681 nmdc:mga0sz30_2088_c1 3300050516 Bacteria 7140
682 nmdc:mga0sz30_29181_c1 3300050516 Bacteria 2272
683 nmdc:mga0sz30_7358_c1 3300050516 Bacteria 4125
684 nmdc:mga0sz30_7673_c1 3300050516 Bacteria 4051
685 nmdc:mga0sz30_89784_c1 3300050516 Bacteria 1336
686 Ga0500635_0043582 3300053080 Bacteria 1510
687 Ga0495655_0031366 3300053083 Bacteria 1292
688 Ga0500643_001890 3300053087 Bacteria 11384
689 Ga0500643_004512 3300053087 Bacteria 6263
690 Ga0500643_010251 3300053087 Bacteria 3503
691 Ga0500556_0008054 3300053104 Bacteria 3032
692 Ga0500642_0056149 3300053130 Bacteria 1754
693 Ga0500652_033856 3300053131 Bacteria 2021
694 Ga0500616_0003117 3300053153 Bacteria 12957
695 Ga0500616_0094853 3300053153 Bacteria 1469
696 Ga0500616_0126342 3300053153 Bacteria 1214
697 Ga0500627_0047935 3300053158 Bacteria 1855
698 Ga0500645_000075 3300053730 Bacteria 78736
699 Ga0466962_0034873 3300061719 Bacteria 2410
700 Ga0466962_0120602 3300061719 Bacteria 1265
701 Ga0530510_0269726 3300061734 Bacteria 1270
702 2644490050 2643221687 Bacteria 6500351
703 2644512940 2643221692 Bacteria 7282860
704 2644635722 2643221715 Bacteria 6671032
705 2738664285 2738541264 Bacteria 5935393
706 2739143420 2738541356 Bacteria 5935017
707 2842136803 2842134933 Bacteria 5847019
708 2866552148 2866552031 Bacteria 5824618
709 2870787103 2870782633 Bacteria 9624083
710 2902793009 2902792274 Bacteria 7270173
711 2902797430 2902792274 Bacteria 7270173
712 2902801812 2902799365 Bacteria 5419524
713 2902812392 2902810491 Bacteria 6794147
714 2902813672 2902810491 Bacteria 6794147
715 2902841682 2902837492 Bacteria 6697721
716 2929213803 2929212328 Bacteria 7708288
717 2939589092 2939582691 Bacteria 7088898
718 3003001325 3002998708 Bacteria 11715108
719 Ga0395900_0609856
720 JGI24737J22298_10017351
721 JGI24743J22301_10000706
722 JGI24750J21931_1001321
723 JGI24738J21930_10004733
724 JGI24738J21930_10031264
725 JGI24744J21845_10003959
726 JGI24744J21845_10005701
727 JGI24034J26672_10001252
728 JGI24742J22300_10000645
729 JGI24742J22300_10009587
730 rootH2_10007847
731 Ga0055540_1000044
732 Ga0055540_1004604
733 Ga0055540_1011097
734 Ga0070658_10341471
735 Ga0070683_100143368
736 Ga0070690_100011762
737 Ga0070677_10308029
738 Ga0068869_100395891
739 Ga0070666_10089765
740 Ga0070666_10239736
741 Ga0070666_10421395
742 Ga0070682_100004933
743 Ga0070682_100010131
744 Ga0068868_100002812
745 Ga0068868_100082181
746 Ga0070689_100052956
747 Ga0070689_100072816
748 Ga0070691_10005230
749 Ga0070691_10222286
750 Ga0070692_10039242
751 Ga0070668_100005941
752 Ga0070668_100043134
753 Ga0070668_100414938
754 Ga0070669_100012086
755 Ga0070669_100207659
756 Ga0070669_100294549
757 Ga0070671_100107568
758 Ga0070674_100003739
759 Ga0070674_100066583
760 Ga0070674_100109314
761 Ga0070688_100008640
762 Ga0070688_100084050
763 Ga0070659_100024813
764 Ga0070659_100082462
765 Ga0070667_100000074
766 Ga0070667_100005546
767 Ga0070667_100014115
768 Ga0070667_100293555
769 Ga0070667_100450152
770 Ga0070709_10113631
771 Ga0070714_100393188
772 Ga0070713_100013669
773 Ga0070710_10001139
774 Ga0070710_10391999
775 Ga0070701_10004473
776 Ga0070711_100000479
777 Ga0070711_100001760
778 Ga0070711_100221420
779 Ga0070705_100092914
780 Ga0070705_100217602
781 Ga0070700_100010521
782 Ga0070694_100282211
783 Ga0070663_100028178
784 Ga0070663_100085485
785 Ga0070663_100152471
786 Ga0070663_100173251
787 Ga0070663_100258765
788 Ga0070678_100000595
789 Ga0070662_100063895
790 Ga0068867_100001973
791 Ga0068867_100153185
792 Ga0070685_10113710
793 Ga0070685_10126078
794 Ga0070706_100005214
795 Ga0070698_100002967
796 Ga0070679_100764772
797 Ga0070684_100045721
798 Ga0068853_100013047
799 Ga0068853_100027722
800 Ga0068853_100087726
801 Ga0068853_100188058
802 Ga0068853_100748885
803 Ga0070672_100067670
804 Ga0070672_100403508
805 Ga0070686_100275487
806 Ga0070695_100024200
807 Ga0070696_100081372
808 Ga0070693_100124355
809 Ga0070693_100227826
810 Ga0070665_100004155
811 Ga0070665_100005707
812 Ga0070665_100019535
813 Ga0070665_100057570
814 Ga0070665_100141611
815 Ga0070704_100000666
816 Ga0070704_100135752
817 Ga0068855_100108707
818 Ga0068855_100398404
819 Ga0068857_100395612
820 Ga0068854_100003429
821 Ga0068854_100304584
822 Ga0070702_100071437
823 Ga0068852_100149584
824 Ga0068859_100000567
825 Ga0068859_100012214
826 Ga0068859_100444675
827 Ga0068864_100050538
828 Ga0068864_100322235
829 Ga0068864_100380874
830 Ga0068864_100568416
831 Ga0068864_100730701
832 Ga0068866_10001475
833 Ga0068866_10007613
834 Ga0068861_100029389
835 Ga0068861_100279129
836 Ga0068851_10024994
837 Ga0068863_100001963
838 Ga0068863_100002994
839 Ga0068863_100150728
840 Ga0068858_100015365
841 Ga0068858_100092957
842 Ga0068860_100000276
843 Ga0068860_100011255
844 Ga0068862_100000065
845 Ga0068862_100099705
846 Ga0068862_100980316
847 Ga0081455_10041314
848 Ga0081455_10068507
849 Ga0081455_10096638
850 Ga0081540_1119944
851 Ga0070717_10073663
852 Ga0070717_10118701
853 Ga0070717_10210554
854 Ga0075365_10109707
855 Ga0075365_10398454
856 Ga0075368_10096850
857 Ga0075363_100000288
858 Ga0075363_100016182
859 Ga0075363_100025973
860 Ga0075363_100122047
861 Ga0075364_10000591
862 Ga0075364_10004624
863 Ga0075364_10027240
864 Ga0075364_10342981
865 Ga0070716_100050770
866 Ga0070712_100002669
867 Ga0070712_100007238
868 Ga0070712_100114627
869 Ga0075362_10004246
870 Ga0075362_10020527
871 Ga0075362_10142229
872 Ga0075367_10004233
873 Ga0075367_10155463
874 Ga0075369_10000174
875 Ga0075369_10000333
876 Ga0075369_10001566
877 Ga0075369_10002203
878 Ga0075369_10008524
879 Ga0075369_10013179
880 Ga0075369_10020744
881 Ga0075369_10034370
882 Ga0075369_10036600
883 Ga0075369_10042723
884 Ga0075369_10048526
885 Ga0075369_10118775
886 Ga0075369_10289448
887 Ga0075366_10322339
888 Ga0097621_100100697
889 Ga0075370_10045146
890 Ga0075370_10048459
891 Ga0075370_10117729
892 Ga0075370_10141055
893 Ga0075370_10201464
894 Ga0068871_100132570
895 Ga0068871_100359902
896 Ga0075428_100023896
897 Ga0075430_100003713
898 Ga0075431_100177920
899 Ga0068865_100016530
900 Ga0068865_100150829
901 Ga0097620_100000567
902 Ga0097620_100012214
903 Ga0097620_100444628
904 Ga0099795_10003237
905 Ga0105250_10073552
906 Ga0105245_10004418
907 Ga0105245_10187753
908 Ga0105245_10247155
909 Ga0105247_10000017
910 Ga0105247_10002837
911 Ga0105247_10103865
912 Ga0105247_10158216
913 Ga0114129_10089982
914 Ga0105243_10005087
915 Ga0105243_10018750
916 Ga0105243_10151180
917 Ga0105243_10422207
918 Ga0105241_10020983
919 Ga0105242_10001113
920 Ga0105242_10029712
921 Ga0105248_10000194
922 Ga0105248_10003348
923 Ga0105248_10019251
924 Ga0105237_10003695
925 Ga0105237_10057089
926 Ga0105237_10134668
927 Ga0105238_10089712
928 Ga0105238_10216295
929 Ga0105249_10000096
930 Ga0105249_10001976
931 Ga0105249_10160009
932 Ga0105032_102023
933 Ga0105239_10009981
934 Ga0105239_10010576
935 Ga0105239_10126490
936 Ga0105239_10141106
937 Ga0105239_10515987
938 Ga0105246_10019937
939 Ga0105246_10250843
940 Ga0105246_10327228
941 Ga0157369_10353423
942 Ga0157374_10132704
943 Ga0157374_10183972
944 Ga0157378_10006478
945 Ga0157378_10233861
946 Ga0163162_10005025
947 Ga0163162_10016373
948 Ga0163162_10322630
949 Ga0157372_10007458
950 Ga0157375_10014077
951 Ga0157375_10565307
952 Ga0163163_10613719
953 Ga0157380_10000771
954 Ga0157377_10248506
955 Ga0157379_10006231
956 Ga0157379_10066922
957 Ga0157379_10219308
958 Ga0157376_10335131
959 Ga0163161_10002358
960 Ga0163161_10324756
961 Ga0213873_10000038
962 Ga0213876_10028698
963 Ga0213876_10055427
964 Ga0213875_10000221
965 Ga0213875_10005568
966 Ga0213875_10026048
967 Ga0213875_10038185
968 Ga0209051_1000051
969 Ga0209051_1001135
970 Ga0209051_1001817
971 Ga0209051_1005060
972 Ga0209051_1021362
973 Ga0207656_10035805
974 Ga0207692_10113223
975 Ga0207692_10135001
976 Ga0207642_10000124
977 Ga0207710_10000033
978 Ga0207710_10020186
979 Ga0207710_10076557
980 Ga0207688_10002685
981 Ga0207688_10010477
982 Ga0207688_10162469
983 Ga0207680_10064428
984 Ga0207680_10406204
985 Ga0207647_10114642
986 Ga0207647_10160814
987 Ga0207685_10009785
988 Ga0207685_10169387
989 Ga0207699_10147306
990 Ga0207699_10172634
991 Ga0207645_10012184
992 Ga0207705_10308731
993 Ga0207684_10024027
994 Ga0207671_10052330
995 Ga0207671_10179486
996 Ga0207693_10001826
997 Ga0207693_10002737
998 Ga0207663_10045487
999 Ga0207662_10057602
1000 Ga0207657_10130362
1001 Ga0207652_10137439
1002 Ga0207646_10174525
1003 Ga0207681_10000849
1004 Ga0207681_10150685
1005 Ga0207681_10349725
1006 Ga0207687_10010419
1007 Ga0207687_10179027
1008 Ga0207687_10194310
1009 Ga0207700_10110539
1010 Ga0207664_10059924
1011 Ga0207664_10226189
1012 Ga0207664_10300802
1013 Ga0207664_10321252
1014 Ga0207664_10326770
1015 Ga0207644_10002040
1016 Ga0207644_10077123
1017 Ga0207644_10459048
1018 Ga0207690_10075037
1019 Ga0207690_10701268
1020 Ga0207690_10859480
1021 Ga0207706_10112691
1022 Ga0207709_10013600
1023 Ga0207670_10006196
1024 Ga0207670_10046367
1025 Ga0207669_10018039
1026 Ga0207669_10046129
1027 Ga0207704_10000291
1028 Ga0207665_10011867
1029 Ga0207665_10029835
1030 Ga0207691_10069745
1031 Ga0207691_10422044
1032 Ga0207711_10000169
1033 Ga0207711_10027770
1034 Ga0207711_10053624
1035 Ga0207711_10113240
1036 Ga0207689_10034774
1037 Ga0207689_10235673
1038 Ga0207661_10311455
1039 Ga0207667_10163989
1040 Ga0207712_10000005
1041 Ga0207712_10014365
1042 Ga0207712_10120297
1043 Ga0207668_10076093
1044 Ga0207668_10077003
1045 Ga0207668_10101294
1046 Ga0207668_10930932
1047 Ga0207640_10007670
1048 Ga0207640_10164672
1049 Ga0207658_10000321
1050 Ga0207658_10002978
1051 Ga0207658_10024173
1052 Ga0207658_10169047
1053 Ga0207658_10192238
1054 Ga0207658_10255424
1055 Ga0207677_10005597
1056 Ga0207703_10027480
1057 Ga0207703_10549731
1058 Ga0207703_10843456
1059 Ga0207678_10008103
1060 Ga0207678_10018663
1061 Ga0207678_10038498
1062 Ga0207678_10100697
1063 Ga0207678_10209133
1064 Ga0207708_10002264
1065 Ga0207708_10024779
1066 Ga0207641_10001342
1067 Ga0207641_10005082
1068 Ga0207641_10165747
1069 Ga0207648_10002008
1070 Ga0207676_10042274
1071 Ga0207676_10261453
1072 Ga0207676_10302924
1073 Ga0207676_10351881
1074 Ga0207676_10770159
1075 Ga0207674_10078136
1076 Ga0207675_100003453
1077 Ga0207675_100105439
1078 Ga0207675_100132073
1079 Ga0207675_100703811
1080 Ga0207683_10003523
1081 Ga0207683_10082669
1082 Ga0207683_10093099
1083 Ga0207683_10479874
1084 Ga0207698_10490636
1085 Ga0209813_10009588
1086 Ga0268266_10002162
1087 Ga0268266_10014326
1088 Ga0268266_10051711
1089 Ga0268266_10063446
1090 Ga0268266_10072953
1091 Ga0268266_10108442
1092 Ga0268265_10000022
1093 Ga0268265_10113828
1094 Ga0268265_11081860
1095 Ga0268264_10000005
1096 Ga0268264_10002955
1097 Ga0265327_10005197
1098 Ga0307513_10566709
1099 Ga0307509_10080875
1100 Ga0307413_10123549
1101 Ga0307410_10281340
1102 Ga0307409_100174129
1103 Ga0307409_100213604
1104 Ga0307409_100708557
1105 Ga0307416_100019535
1106 Ga0307411_10247877
1107 Ga0307415_100033139
1108 Ga0316583_10087685
1109 Ga0373948_0017955
1110 Ga0373932_0012097
1111 Ga0373939_0180308
1112 Ga0373941_0050039
1113 Ga0373960_0148312
1114 Ga0373942_0011297
1115 Ga0373962_0029125
1116 Ga0373931_0036011
1117 Ga0316582_0446940
1118 Ga0316584_0105339
1119 Ga0373925_0000465
1120 Ga0395898_0014341
1121 Ga0395898_0950810
1122 Ga0436364_0109597
1123 Ga0436364_0166911
1124 Ga0436364_0674082
1125 Ga0395901_0033443
1126 Ga0400485_05417
1127 Ga0400488_13710
1128 Ga0400486_22540
1129 Ga0436365_0889838
1130 Ga0436365_1189683
1131 Ga0436365_1842056
1132 Ga0436363_0792619
1133 Ga0436363_0952188
1134 Ga0436362_1280188
1135 Ga0439461_0000185
1136 Ga0439466_0005710
1137 Ga0439465_0000060
1138 Ga0439465_0105929
1139 Ga0451791_0149111
1140 Ga0451793_0748559
1141 Ga0451841_0274634
1142 Ga0439442_026321
1143 Ga0439445_0006212
1144 Ga0439445_0025196
1145 Ga0439434_0008822
1146 Ga0439434_0013038
1147 Ga0439435_0069657
1148 Ga0466972_0004246
1149 Ga0466972_0006240
1150 Ga0466972_0023859
1151 Ga0466972_0059377
1152 Ga0466965_0022927
1153 Ga0466965_0065468
1154 Ga0466965_0071980
1155 Ga0466965_0084113
1156 Ga0466965_0095009
1157 Ga0466966_0007032
1158 Ga0466966_0025400
1159 Ga0466966_0066122
1160 Ga0466961_0003256
1161 Ga0466961_0030169
1162 Ga0466961_0033442
1163 Ga0466961_0099398
1164 Ga0466963_0032537
1165 Ga0466963_0037680
1166 Ga0466963_0059594
1167 Ga0466964_0037327
1168 Ga0466971_0031618
1169 Ga0466971_0039657
1170 Ga0466968_0000412
1171 Ga0466968_0000969
1172 Ga0466968_0015951
1173 Ga0466968_0016051
1174 Ga0466968_0021901
1175 Ga0466968_0064974
1176 Ga0466970_0005005
1177 Ga0466970_0046555
1178 Ga0466970_0122320
1179 Ga0466970_0145544
1180 Ga0466970_0150283
1181 Ga0466957_0017432
1182 Ga0466957_0020345
1183 Ga0466957_0075154
1184 Ga0466957_0128597
1185 Ga0466960_0000298
1186 Ga0466960_0009724
1187 Ga0466960_0010966
1188 Ga0466960_0014887
1189 Ga0466959_0006453
1190 Ga0466959_0056319
1191 Ga0466959_0131775
1192 Ga0466959_0347532
1193 Ga0466959_0378031
1194 Ga0466958_0001933
1195 Ga0466958_0016366
1196 Ga0466958_0024402
1197 Ga0466958_0025549
1198 Ga0466958_0037553
1199 Ga0466967_0040189
1200 Ga0466967_0045901
1201 Ga0466967_0082166
1202 Ga0466967_0093003
1203 Ga0466967_0108128
1204 Ga0466967_0171487
1205 Ga0466967_0176449
1206 Ga0466967_0525753
1207 Ga0495638_0006500
1208 Ga0495648_0008720
1209 Ga0495654_0091874
1210 Ga0495668_0011318
1211 Ga0495668_0218701
1212 Ga0495625_0095070
1213 Ga0495625_0117736
1214 Ga0495671_0130130
1215 Ga0495672_0002584
1216 Ga0495672_0003747
1217 Ga0495672_0008946
1218 Ga0495672_0088508
1219 Ga0495672_0150771
1220 Ga0495683_0183445
1221 Ga0495673_0012229
1222 Ga0495673_0019428
1223 Ga0495686_0015968
1224 Ga0495593_0010595
1225 Ga0496100_0000109
1226 Ga0496100_0005227
1227 Ga0496100_0008249
1228 Ga0496100_0044977
1229 Ga0496100_0190600
1230 Ga0496100_0214984
1231 Ga0496100_0259073
1232 Ga0496101_0000020
1233 Ga0496101_0000075
1234 Ga0496101_0000310
1235 Ga0496101_0001332
1236 Ga0496101_0002044
1237 Ga0496101_0020525
1238 Ga0496101_0030708
1239 Ga0496101_0045216
1240 Ga0496101_0055704
1241 Ga0496101_0066568
1242 Ga0496101_0557816
1243 Ga0496102_0000003
1244 Ga0496102_0004064
1245 Ga0496102_0004363
1246 Ga0496102_0004756
1247 Ga0496102_0012877
1248 Ga0496102_0026778
1249 Ga0496103_0000014
1250 Ga0496103_0000093
1251 Ga0496103_0000512
1252 Ga0496103_0051048
1253 Ga0496103_0185782
1254 Ga0496104_0004308
1255 Ga0496104_0036280
1256 Ga0496105_0075358
1257 Ga0496105_0323700
1258 Ga0496106_0002847
1259 Ga0496106_0058826
1260 Ga0496106_0059545
1261 Ga0496106_0143147
1262 Ga0496106_0192127
1263 Ga0496107_0005122
1264 Ga0496107_0005597
1265 Ga0496107_0028961
1266 Ga0496107_0119159
1267 Ga0496107_0251667
1268 Ga0496108_0000222
1269 Ga0496108_0000405
1270 Ga0496108_0038421
1271 Ga0496108_0456742
1272 Ga0496108_0654519
1273 Ga0496109_0002338
1274 Ga0496109_0024536
1275 Ga0496109_0080408
1276 Ga0496109_0121178
1277 Ga0496109_0236798
1278 Ga0496109_0238853
1279 Ga0496109_0597939
1280 Ga0496110_0019778
1281 Ga0496110_0129575
1282 Ga0496110_0537552
1283 Ga0496110_0542860
1284 Ga0496110_0631846
1285 Ga0496111_0008829
1286 Ga0496111_0169898
1287 Ga0496111_0228855
1288 Ga0496112_0025991
1289 Ga0496112_0054350
1290 Ga0496112_0301215
1291 Ga0496112_0617058
1292 Ga0496113_0001800
1293 Ga0496113_0109697
1294 Ga0496113_0115102
1295 Ga0496113_0330911
1296 Ga0496113_0674587
1297 Ga0496114_0000181
1298 Ga0496114_0011672
1299 Ga0496114_0043138
1300 Ga0496115_0005302
1301 Ga0496115_0009311
1302 Ga0496115_0037126
1303 Ga0496116_0000071
1304 Ga0496116_0004420
1305 Ga0496116_0015952
1306 Ga0496117_0000003
1307 Ga0496117_0000711
1308 Ga0496118_0000001
1309 Ga0496118_0000488
1310 Ga0496118_0068619
1311 Ga0496119_0000266
1312 Ga0496119_0002301
1313 Ga0496119_0002624
1314 Ga0496119_0120032
1315 Ga0496120_0000235
1316 Ga0496120_0001188
1317 Ga0496120_0034101
1318 Ga0496121_0000002
1319 Ga0496121_0000019
1320 Ga0496121_0006826
1321 Ga0496122_0000312
1322 Ga0496122_0012626
1323 Ga0496122_0017076
1324 Ga0496122_0312790
1325 Ga0496123_0003426
1326 Ga0496123_0019484
1327 Ga0496124_0000002
1328 Ga0496124_0008699
1329 Ga0496124_0211984
1330 Ga0496125_0000002
1331 Ga0496125_0055291
1332 Ga0496125_0160805
1333 Ga0496126_0000011
1334 Ga0496126_0003151
1335 Ga0496126_0004196
1336 Ga0496126_0021074
1337 Ga0496126_0029729
1338 Ga0496126_0212040
1339 Ga0496126_0494612
1340 Ga0501032_0000469
1341 Ga0501032_0038979
1342 Ga0501034_0009642
1343 Ga0501034_0011897
1344 Ga0501036_0016952
1345 Ga0501037_0000234
1346 Ga0501038_0000365
1347 Ga0501039_0000113
1348 Ga0501039_0586768
1349 Ga0501043_0000082
1350 Ga0501043_0141367
1351 Ga0501043_0259167
1352 Ga0501047_0008566
1353 Ga0501047_0567756
1354 Ga0501048_0232310
1355 Ga0501067_0226201
1356 Ga0501070_0001505
1357 Ga0501071_0319850
1358 Ga0501072_0127722
1359 Ga0501073_0144970
1360 Ga0501076_0103222
1361 Ga0501080_0029877
1362 Ga0501035_0009531
1363 Ga0501044_0003845
1364 Ga0501044_0008670
1365 Ga0501044_0013412
1366 nmdc:mga03683_135079_c1
1367 nmdc:mga03683_30607_c1
1368 nmdc:mga03n38_1202_c1
1369 nmdc:mga03n38_21750_c1
1370 nmdc:mga03n38_293550_c1
1371 nmdc:mga03n38_37775_c1
1372 nmdc:mga03n38_435_c1
1373 nmdc:mga03n38_76454_c1
1374 nmdc:mga00v17_140178_c1
1375 nmdc:mga00v17_142939_c1
1376 nmdc:mga00v17_265643_c1
1377 nmdc:mga00v17_4868_c1
1378 nmdc:mga00v17_5302_c1
1379 nmdc:mga00v17_5879_c1
1380 nmdc:mga00v17_6485_c1
1381 nmdc:mga0yw44_27834_c1
1382 nmdc:mga0yw44_512_c1
1383 nmdc:mga0k408_327613_c1
1384 nmdc:mga06z11_108728_c1
1385 nmdc:mga06z11_43756_c1
1386 nmdc:mga04h51_6791_c1
1387 nmdc:mga07m45_115305_c1
1388 nmdc:mga07m45_13773_c1
1389 nmdc:mga07m45_1418_c1
1390 nmdc:mga07m45_169682_c1
1391 nmdc:mga07m45_250642_c1
1392 nmdc:mga07m45_29031_c1
1393 nmdc:mga07m45_343084_c1
1394 nmdc:mga05p37_28521_c1
1395 nmdc:mga0qj67_23517_c1
1396 nmdc:mga0qj67_267627_c1
1397 nmdc:mga0sz30_11295_c1
1398 nmdc:mga0sz30_148938_c1
1399 nmdc:mga0sz30_2088_c1
1400 nmdc:mga0sz30_29181_c1
1401 nmdc:mga0sz30_7358_c1
1402 nmdc:mga0sz30_7673_c1
1403 nmdc:mga0sz30_89784_c1
1404 Ga0500635_0043582
1405 Ga0495655_0031366
1406 Ga0500643_001890
1407 Ga0500643_004512
1408 Ga0500643_010251
1409 Ga0500556_0008054
1410 Ga0500642_0056149
1411 Ga0500652_033856
1412 Ga0500616_0003117
1413 Ga0500616_0094853
1414 Ga0500616_0126342
1415 Ga0500627_0047935
1416 Ga0500645_000075
1417 Ga0466962_0034873
1418 Ga0466962_0120602
1419 Ga0530510_0269726
1420 2644490050
1421 2644512940
1422 2644635722
1423 2738664285
1424 2739143420
1425 2842136803
1426 2866552148
1427 2870787103
1428 2902793009
1429 2902797430
1430 2902801812
1431 2902812392
1432 2902813672
1433 2902841682
1434 2929213803
1435 2939589092
1436 3003001325

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

154

210

0.97

PF00072

Response_reg

Response regulator receiver domain

11

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9923 189 247
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9883 189 247
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9882 189 247
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.986 189 247
6kju-assembly1.cif.gz_A huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.9857 189 248
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9945 189 245 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9785 189 247 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9763 189 243 1.10.10.10
3qp6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 189 245 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9603 189 243 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2M7A5F5-F1-model_v4 Two-component system response regulator 0.9612 62 158 GO:0000160
AF-B6DCI9-F1-model_v4 GacA 0.9583 69 159 GO:0000160
AF-A0A7W0GWP8-F1-model_v4 Response regulator transcription factor 0.9575 36 157 GO:0000160
AF-A0A2M7A5F5-F1-model_v4 Two-component system response regulator 0.9424 62 158 GO:0000160
AF-A0A847YI07-F1-model_v4 Response regulator 0.9388 35 155 GO:0000160
GO:0006935

Map