F477185

General Info

Members Datasets Scaffolds Average Seq Length
718 293 1436 318

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0002708|Ga0466967_0002708_3841_4920
Length 359
Sequence MERYAPEWPPTFGSNRQPQPNARQRSNEDEENFVSAIITDNVTRRFGDFTAVDRVSIRVEKGEVFGFLGPNGSGKTTLIKMLTGLLPLSEGSASVDDVDVTADPELVRERIGYMSQKFSLYDDLTVEENLTFYGRIYGLSPQRLRSRMDAIIETNGLAPYVRRSAAKLSGGWKQRLALGCAMLHEPRIMFLDEPTAGIDPVARRTLWDLLFQLSGQGITFFVTTHYMDEAERCSHVAYIYFGRIIADGTPDDLKEIPEINPPGTKRIEIDSSEVTRALMLAREFAGVRSATVFGQAIHALVDDRLSESALSEYLSREHIRVHEIRSLLPSLEDVFVELTYRRQAELEAENGVAKETVHA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.9
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0002708 3300045976 Bacteria 11201
2 JGI25406J46586_10019228 3300003203 Bacteria 2789
3 rootL2_10024844 3300003322 Bacteria 7071
4 Ga0065715_10095553 3300005293 Bacteria 4060
5 Ga0070676_10002577 3300005328 Bacteria 9318
6 Ga0070676_10013025 3300005328 Bacteria 4557
7 Ga0070683_100000097 3300005329 Bacteria 57304
8 Ga0070683_100015960 3300005329 Bacteria 6607
9 Ga0070683_100022036 3300005329 Bacteria 5688
10 Ga0070683_100044469 3300005329 Bacteria 4095
11 Ga0070683_100207182 3300005329 Bacteria 1862
12 Ga0070683_100222443 3300005329 Bacteria 1794
13 Ga0070690_100002589 3300005330 Bacteria 9744
14 Ga0070690_100012605 3300005330 Bacteria 4976
15 Ga0070690_100097002 3300005330 Bacteria 1949
16 Ga0070670_100010640 3300005331 Bacteria 7859
17 Ga0070670_100013420 3300005331 Bacteria 7017
18 Ga0070670_100175734 3300005331 Bacteria 1858
19 Ga0068869_100001114 3300005334 Bacteria 15660
20 Ga0068869_100004783 3300005334 Bacteria 8453
21 Ga0070680_100010238 3300005336 Bacteria 7230
22 Ga0070682_100000082 3300005337 Bacteria 85071
23 Ga0070682_100064671 3300005337 Bacteria 2322
24 Ga0068868_100000479 3300005338 Bacteria 26512
25 Ga0068868_100003002 3300005338 Bacteria 11729
26 Ga0068868_100226090 3300005338 Bacteria 1568
27 Ga0070689_100000899 3300005340 Bacteria 18558
28 Ga0070689_100030208 3300005340 Bacteria 4111
29 Ga0070689_100290896 3300005340 Bacteria 1358
30 Ga0070687_100131256 3300005343 Bacteria 1447
31 Ga0070661_100005145 3300005344 Bacteria 9008
32 Ga0070661_100005454 3300005344 Bacteria 8771
33 Ga0070661_100045692 3300005344 Bacteria 3202
34 Ga0070661_100216062 3300005344 Unclassified 1469
35 Ga0070661_100356730 3300005344 Bacteria 1148
36 Ga0070668_100168194 3300005347 Bacteria 1783
37 Ga0070669_100004094 3300005353 Bacteria 10564
38 Ga0070669_100100748 3300005353 Bacteria 2178
39 Ga0070675_100000003 3300005354 Bacteria 422595
40 Ga0070675_100029761 3300005354 Bacteria 4406
41 Ga0070675_100051327 3300005354 Bacteria 3389
42 Ga0070671_100007588 3300005355 Bacteria 8673
43 Ga0070671_100017627 3300005355 Bacteria 5786
44 Ga0070671_100029409 3300005355 Bacteria 4530
45 Ga0070688_100046952 3300005365 Bacteria 2676
46 Ga0070688_100137183 3300005365 Bacteria 1657
47 Ga0070659_100004954 3300005366 Bacteria 9526
48 Ga0070659_100404524 3300005366 Bacteria 1153
49 Ga0070667_100000808 3300005367 Bacteria 29235
50 Ga0070667_100045107 3300005367 Bacteria 3706
51 Ga0070667_100050889 3300005367 Bacteria 3491
52 Ga0070709_10080316 3300005434 Bacteria 2126
53 Ga0070709_10096014 3300005434 Bacteria 1965
54 Ga0070714_100123214 3300005435 Bacteria 2308
55 Ga0070714_100207413 3300005435 Unclassified 1795
56 Ga0070701_10026517 3300005438 Bacteria 2827
57 Ga0070711_100018101 3300005439 Bacteria 4495
58 Ga0070711_100123852 3300005439 Bacteria 1916
59 Ga0070705_100002661 3300005440 Bacteria 8942
60 Ga0070705_100043942 3300005440 Bacteria 2564
61 Ga0070705_100173749 3300005440 Unclassified 1453
62 Ga0070700_100000001 3300005441 Bacteria 346167
63 Ga0070694_100016968 3300005444 Bacteria 4594
64 Ga0070694_100311393 3300005444 Bacteria 1209
65 Ga0070708_100006686 3300005445 Bacteria 9181
66 Ga0070708_100017608 3300005445 Bacteria 5965
67 Ga0070708_100040668 3300005445 Unclassified 4072
68 Ga0070708_100443327 3300005445 Bacteria 1225
69 Ga0070663_100002121 3300005455 Bacteria 11111
70 Ga0070663_100003832 3300005455 Bacteria 8755
71 Ga0070663_100075253 3300005455 Bacteria 2467
72 Ga0070678_100005711 3300005456 Bacteria 7228
73 Ga0070678_100255363 3300005456 Bacteria 1471
74 Ga0070662_100000757 3300005457 Bacteria 19820
75 Ga0070662_100002775 3300005457 Bacteria 10842
76 Ga0070681_10418887 3300005458 Bacteria 1251
77 Ga0068867_100004156 3300005459 Bacteria 10180
78 Ga0070685_10003684 3300005466 Bacteria 7766
79 Ga0070685_10064461 3300005466 Bacteria 2154
80 Ga0070706_100006053 3300005467 Bacteria 11435
81 Ga0070706_100012328 3300005467 Bacteria 7922
82 Ga0070707_100001974 3300005468 Bacteria 19626
83 Ga0070707_100003066 3300005468 Bacteria 15829
84 Ga0070707_100004807 3300005468 Bacteria 12652
85 Ga0070707_100024983 3300005468 Bacteria 5665
86 Ga0070698_100006903 3300005471 Bacteria 12304
87 Ga0070698_100022863 3300005471 Bacteria 6537
88 Ga0070698_100034608 3300005471 Bacteria 5228
89 Ga0070698_100157613 3300005471 Bacteria 2215
90 Ga0070698_100195545 3300005471 Bacteria 1959
91 Ga0070698_100278086 3300005471 Bacteria 1606
92 Ga0070699_100011123 3300005518 Bacteria 7777
93 Ga0070699_100015577 3300005518 Bacteria 6531
94 Ga0070699_100033738 3300005518 Bacteria 4423
95 Ga0070699_100047276 3300005518 Unclassified 3723
96 Ga0070699_100099871 3300005518 Bacteria 2543
97 Ga0070679_100069183 3300005530 Bacteria 3521
98 Ga0070679_100079144 3300005530 Bacteria 3276
99 Ga0070684_100000031 3300005535 Bacteria 106109
100 Ga0070684_100016682 3300005535 Bacteria 6010
101 Ga0070684_100097193 3300005535 Bacteria 2626
102 Ga0070697_100007629 3300005536 Bacteria 8421
103 Ga0070697_100009220 3300005536 Bacteria 7711
104 Ga0068853_100006331 3300005539 Bacteria 9396
105 Ga0068853_100025332 3300005539 Bacteria 4977
106 Ga0070672_100000324 3300005543 Bacteria 27234
107 Ga0070672_100004476 3300005543 Bacteria 9153
108 Ga0070695_100002293 3300005545 Bacteria 10965
109 Ga0070696_100004097 3300005546 Bacteria 9718
110 Ga0070696_100167489 3300005546 Bacteria 1622
111 Ga0070693_100000004 3300005547 Bacteria 94899
112 Ga0070693_100005354 3300005547 Bacteria 6152
113 Ga0070693_100007822 3300005547 Bacteria 5239
114 Ga0070665_100003370 3300005548 Bacteria 17092
115 Ga0070665_100009991 3300005548 Bacteria 9601
116 Ga0070665_100013260 3300005548 Bacteria 8300
117 Ga0070665_100019857 3300005548 Bacteria 6747
118 Ga0070704_100002014 3300005549 Bacteria 11260
119 Ga0068855_100009684 3300005563 Bacteria 11631
120 Ga0068855_100014801 3300005563 Bacteria 9392
121 Ga0068855_100017878 3300005563 Bacteria 8519
122 Ga0068855_100743515 3300005563 Bacteria 1046
123 Ga0070664_100077832 3300005564 Bacteria 2852
124 Ga0070664_100119594 3300005564 Bacteria 2305
125 Ga0068857_100000602 3300005577 Bacteria 26435
126 Ga0068857_100003885 3300005577 Bacteria 12577
127 Ga0068857_100004856 3300005577 Bacteria 11400
128 Ga0068857_100015384 3300005577 Bacteria 6681
129 Ga0068857_100178342 3300005577 Bacteria 1933
130 Ga0068854_100000587 3300005578 Bacteria 21705
131 Ga0068854_100007505 3300005578 Bacteria 6970
132 Ga0068854_100178829 3300005578 Bacteria 1656
133 Ga0068856_100009485 3300005614 Bacteria 9450
134 Ga0068856_100016636 3300005614 Bacteria 7121
135 Ga0068856_100039225 3300005614 Bacteria 4649
136 Ga0068856_100295138 3300005614 Bacteria 1638
137 Ga0070702_100003922 3300005615 Bacteria 6743
138 Ga0070702_100014769 3300005615 Bacteria 3970
139 Ga0068852_100000032 3300005616 Bacteria 102480
140 Ga0068852_100002033 3300005616 Bacteria 13786
141 Ga0068852_100104777 3300005616 Bacteria 2561
142 Ga0068852_100218104 3300005616 Unclassified 1813
143 Ga0068852_100313696 3300005616 Bacteria 1521
144 Ga0068859_100015723 3300005617 Bacteria 7605
145 Ga0068859_100024506 3300005617 Bacteria 6054
146 Ga0068859_100112219 3300005617 Bacteria 2789
147 Ga0068864_100000001 3300005618 Bacteria 686767
148 Ga0068864_100011164 3300005618 Bacteria 7424
149 Ga0068864_100033344 3300005618 Bacteria 4377
150 Ga0068864_100156212 3300005618 Bacteria 2070
151 Ga0068866_10009415 3300005718 Bacteria 4147
152 Ga0068851_10007717 3300005834 Bacteria 4948
153 Ga0068851_10009873 3300005834 Bacteria 4445
154 Ga0068870_10001103 3300005840 Bacteria 10735
155 Ga0068863_100003024 3300005841 Bacteria 16624
156 Ga0068863_100011180 3300005841 Bacteria 8699
157 Ga0068863_100058770 3300005841 Bacteria 3639
158 Ga0068863_100082252 3300005841 Unclassified 3051
159 Ga0068863_100123713 3300005841 Bacteria 2468
160 Ga0068863_100127894 3300005841 Bacteria 2424
161 Ga0068863_100283149 3300005841 Bacteria 1606
162 Ga0068858_100001897 3300005842 Bacteria 21342
163 Ga0068858_100005975 3300005842 Bacteria 11887
164 Ga0068858_100008393 3300005842 Bacteria 9936
165 Ga0068858_100013939 3300005842 Bacteria 7582
166 Ga0068858_100149088 3300005842 Bacteria 2198
167 Ga0068860_100000031 3300005843 Bacteria 255068
168 Ga0068860_100047573 3300005843 Bacteria 4088
169 Ga0068860_100073434 3300005843 Bacteria 3251
170 Ga0068860_100144359 3300005843 Bacteria 2289
171 Ga0068862_100003359 3300005844 Bacteria 13812
172 Ga0068862_100008925 3300005844 Bacteria 8300
173 Ga0081455_10007293 3300005937 Bacteria 11668
174 Ga0081455_10065623 3300005937 Unclassified 3035
175 Ga0081539_10018248 3300005985 Bacteria 4879
176 Ga0070717_10005591 3300006028 Bacteria 9176
177 Ga0070717_10527211 3300006028 Bacteria 1069
178 Ga0070716_100000450 3300006173 Bacteria 17008
179 Ga0070716_100003804 3300006173 Bacteria 7159
180 Ga0070716_100004439 3300006173 Bacteria 6709
181 Ga0070716_100030254 3300006173 Bacteria 2936
182 Ga0070716_100136952 3300006173 Bacteria 1556
183 Ga0070712_100054144 3300006175 Bacteria 2804
184 Ga0097621_100012626 3300006237 Bacteria 6269
185 Ga0097621_100109589 3300006237 Bacteria 2332
186 Ga0097621_100185260 3300006237 Bacteria 1800
187 Ga0097621_100279321 3300006237 Bacteria 1470
188 Ga0068871_100001244 3300006358 Bacteria 17011
189 Ga0068871_100011283 3300006358 Bacteria 6551
190 Ga0068871_100190361 3300006358 Bacteria 1767
191 Ga0075428_100031691 3300006844 Bacteria 5841
192 Ga0075428_100293309 3300006844 Bacteria 1749
193 Ga0075431_100018995 3300006847 Bacteria 7003
194 Ga0075431_100136569 3300006847 Bacteria 2528
195 Ga0075431_100402784 3300006847 Bacteria 1369
196 Ga0075431_100430035 3300006847 Bacteria 1318
197 Ga0075433_10035022 3300006852 Bacteria 4315
198 Ga0075433_10131004 3300006852 Bacteria 2228
199 Ga0075433_10280229 3300006852 Bacteria 1477
200 Ga0075434_100003588 3300006871 Bacteria 13866
201 Ga0075434_100030079 3300006871 Bacteria 5346
202 Ga0075434_100055325 3300006871 Bacteria 3943
203 Ga0075434_100239241 3300006871 Bacteria 1836
204 Ga0075429_100263342 3300006880 Bacteria 1510
205 Ga0068865_100002290 3300006881 Bacteria 11280
206 Ga0068865_100039266 3300006881 Bacteria 3210
207 Ga0075436_100000737 3300006914 Bacteria 21698
208 Ga0075436_100005655 3300006914 Bacteria 8581
209 Ga0075436_100026238 3300006914 Unclassified 4011
210 Ga0097620_100015722 3300006931 Bacteria 7605
211 Ga0097620_100024506 3300006931 Bacteria 6054
212 Ga0097620_100112217 3300006931 Bacteria 2789
213 Ga0075435_100058675 3300007076 Bacteria 3118
214 Ga0075435_100093913 3300007076 Unclassified 2479
215 Ga0075435_100336284 3300007076 Unclassified 1294
216 Ga0099794_10006331 3300007265 Bacteria 4785
217 Ga0099794_10023214 3300007265 Bacteria 2835
218 Ga0099794_10045411 3300007265 Bacteria 2102
219 Ga0099794_10148372 3300007265 Bacteria 1190
220 Ga0099795_10025446 3300007788 Bacteria 1985
221 Ga0105244_10013367 3300009036 Bacteria 4803
222 Ga0105240_10000135 3300009093 Bacteria 151432
223 Ga0105240_10000451 3300009093 Bacteria 75544
224 Ga0105240_10004680 3300009093 Bacteria 20685
225 Ga0105240_10010538 3300009093 Bacteria 12985
226 Ga0105240_10017307 3300009093 Bacteria 9718
227 Ga0105240_10048663 3300009093 Bacteria 5356
228 Ga0105240_10172716 3300009093 Bacteria 2558
229 Ga0105240_10372207 3300009093 Bacteria 1615
230 Ga0105240_10388657 3300009093 Bacteria 1574
231 Ga0105240_10439322 3300009093 Bacteria 1462
232 Ga0105240_10521159 3300009093 Bacteria 1319
233 Ga0105240_10543670 3300009093 Bacteria 1286
234 Ga0105245_10000786 3300009098 Bacteria 28771
235 Ga0105245_10002852 3300009098 Bacteria 15538
236 Ga0105245_10016836 3300009098 Bacteria 6382
237 Ga0105245_10040917 3300009098 Bacteria 4131
238 Ga0105245_10238688 3300009098 Bacteria 1761
239 Ga0114129_10157396 3300009147 Bacteria 3106
240 Ga0114129_10239068 3300009147 Bacteria 2442
241 Ga0105241_10010010 3300009174 Bacteria 6962
242 Ga0105241_10021359 3300009174 Bacteria 4785
243 Ga0105241_10050809 3300009174 Bacteria 3160
244 Ga0105241_10171475 3300009174 Bacteria 1792
245 Ga0105242_10002605 3300009176 Bacteria 14141
246 Ga0105242_10011272 3300009176 Bacteria 6869
247 Ga0105242_10024358 3300009176 Bacteria 4780
248 Ga0105248_10009291 3300009177 Bacteria 10826
249 Ga0105248_10026710 3300009177 Bacteria 6420
250 Ga0105248_10076405 3300009177 Bacteria 3764
251 Ga0105248_10186842 3300009177 Bacteria 2335
252 Ga0105237_10017522 3300009545 Bacteria 7423
253 Ga0105237_10021398 3300009545 Bacteria 6649
254 Ga0105237_10297153 3300009545 Bacteria 1618
255 Ga0105238_10001963 3300009551 Bacteria 20716
256 Ga0105238_10666499 3300009551 Bacteria 1051
257 Ga0105249_10039077 3300009553 Bacteria 4307
258 Ga0105249_10089888 3300009553 Bacteria 2870
259 Ga0105249_10119018 3300009553 Unclassified 2508
260 Ga0105249_10525790 3300009553 Bacteria 1231
261 Ga0099796_10000665 3300010159 Bacteria 6015
262 Ga0105239_10035672 3300010375 Bacteria 5460
263 Ga0105239_10057403 3300010375 Unclassified 4269
264 Ga0105239_10111537 3300010375 Unclassified 3032
265 Ga0105239_10366714 3300010375 Bacteria 1627
266 Ga0105246_10001466 3300011119 Bacteria 14010
267 Ga0105246_10085885 3300011119 Bacteria 2254
268 Ga0157373_10003983 3300013100 Bacteria 11139
269 Ga0157373_10004107 3300013100 Bacteria 10974
270 Ga0157371_10043860 3300013102 Bacteria 3185
271 Ga0157370_10000023 3300013104 Bacteria 161359
272 Ga0157370_10015084 3300013104 Bacteria 7874
273 Ga0157369_10000010 3300013105 Bacteria 273443
274 Ga0157369_10035913 3300013105 Bacteria 5432
275 Ga0157369_10042861 3300013105 Unclassified 4936
276 Ga0157369_10062729 3300013105 Bacteria 4004
277 Ga0157369_10213051 3300013105 Bacteria 2024
278 Ga0157369_10446150 3300013105 Bacteria 1340
279 Ga0157374_10001688 3300013296 Bacteria 18485
280 Ga0157374_10046796 3300013296 Bacteria 4008
281 Ga0157374_10047646 3300013296 Bacteria 3974
282 Ga0157374_10239095 3300013296 Unclassified 1786
283 Ga0157374_10316594 3300013296 Bacteria 1546
284 Ga0157378_10000044 3300013297 Bacteria 106822
285 Ga0157378_10002388 3300013297 Bacteria 16681
286 Ga0157378_10006829 3300013297 Bacteria 9955
287 Ga0157378_10016679 3300013297 Bacteria 6436
288 Ga0157378_10095021 3300013297 Unclassified 2714
289 Ga0157378_10193705 3300013297 Bacteria 1919
290 Ga0157378_10304705 3300013297 Bacteria 1543
291 Ga0163162_10001495 3300013306 Bacteria 21784
292 Ga0163162_10007750 3300013306 Bacteria 10461
293 Ga0163162_10010928 3300013306 Bacteria 8838
294 Ga0163162_10017286 3300013306 Bacteria 7057
295 Ga0163162_10176040 3300013306 Bacteria 2265
296 Ga0163162_10440447 3300013306 Unclassified 1435
297 Ga0163162_10555036 3300013306 Bacteria 1277
298 Ga0157372_10000055 3300013307 Bacteria 126308
299 Ga0157372_10007697 3300013307 Bacteria 11460
300 Ga0157372_10008911 3300013307 Bacteria 10660
301 Ga0157372_10068306 3300013307 Bacteria 3995
302 Ga0157372_10104887 3300013307 Bacteria 3232
303 Ga0157372_10211618 3300013307 Bacteria 2247
304 Ga0157372_10223635 3300013307 Bacteria 2182
305 Ga0157372_10250472 3300013307 Unclassified 2056
306 Ga0157372_10372883 3300013307 Bacteria 1663
307 Ga0157375_10000005 3300013308 Bacteria 429412
308 Ga0157375_10000092 3300013308 Bacteria 90157
309 Ga0157375_10122045 3300013308 Bacteria 2716
310 Ga0157375_10247725 3300013308 Bacteria 1942
311 Ga0157375_10517914 3300013308 Bacteria 1356
312 Ga0163163_10001291 3300014325 Bacteria 21165
313 Ga0163163_10004292 3300014325 Bacteria 12142
314 Ga0163163_10004406 3300014325 Bacteria 11999
315 Ga0163163_10011078 3300014325 Bacteria 8159
316 Ga0163163_10055189 3300014325 Unclassified 3927
317 Ga0163163_10086516 3300014325 Unclassified 3144
318 Ga0157380_10362470 3300014326 Unclassified 1360
319 Ga0157377_10000105 3300014745 Bacteria 57869
320 Ga0157377_10000304 3300014745 Bacteria 22848
321 Ga0157379_10001222 3300014968 Bacteria 20890
322 Ga0157379_10008140 3300014968 Bacteria 9106
323 Ga0157376_10000008 3300014969 Bacteria 351192
324 Ga0157376_10002199 3300014969 Bacteria 13151
325 Ga0157376_10018878 3300014969 Bacteria 5301
326 Ga0157376_10022142 3300014969 Bacteria 4948
327 Ga0157376_10068900 3300014969 Unclassified 2997
328 Ga0157376_10079463 3300014969 Bacteria 2812
329 Ga0157376_10118333 3300014969 Bacteria 2344
330 Ga0157376_10170736 3300014969 Bacteria 1980
331 Ga0157376_10570691 3300014969 Bacteria 1122
332 Ga0213873_10000001 3300021358 Bacteria 1657979
333 Ga0213876_10000002 3300021384 Bacteria 1168769
334 Ga0213876_10042452 3300021384 Bacteria 2403
335 Ga0228598_1024820 3300024227 Bacteria 1179
336 Ga0207697_10028981 3300025315 Bacteria 2265
337 Ga0207656_10009454 3300025321 Bacteria 3622
338 Ga0207656_10045886 3300025321 Unclassified 1872
339 Ga0207655_1040181 3300025728 Bacteria 2022
340 Ga0207653_10056710 3300025885 Bacteria 1314
341 Ga0207682_10007200 3300025893 Bacteria 4450
342 Ga0207710_10001423 3300025900 Bacteria 11961
343 Ga0207688_10011349 3300025901 Bacteria 4852
344 Ga0207688_10093320 3300025901 Unclassified 1731
345 Ga0207680_10002500 3300025903 Bacteria 8573
346 Ga0207680_10004549 3300025903 Bacteria 6585
347 Ga0207680_10042030 3300025903 Bacteria 2671
348 Ga0207647_10007389 3300025904 Bacteria 7943
349 Ga0207647_10015179 3300025904 Bacteria 5290
350 Ga0207685_10022938 3300025905 Bacteria 2117
351 Ga0207699_10069725 3300025906 Bacteria 2145
352 Ga0207645_10003138 3300025907 Bacteria 12670
353 Ga0207645_10003581 3300025907 Bacteria 11749
354 Ga0207645_10040661 3300025907 Bacteria 2977
355 Ga0207643_10000247 3300025908 Bacteria 37737
356 Ga0207684_10015257 3300025910 Bacteria 6618
357 Ga0207684_10015510 3300025910 Bacteria 6554
358 Ga0207684_10040516 3300025910 Bacteria 3948
359 Ga0207654_10013984 3300025911 Bacteria 4138
360 Ga0207654_10030271 3300025911 Unclassified 2970
361 Ga0207654_10118775 3300025911 Bacteria 1657
362 Ga0207707_10035921 3300025912 Bacteria 4333
363 Ga0207707_10258700 3300025912 Bacteria 1511
364 Ga0207707_10350079 3300025912 Bacteria 1273
365 Ga0207695_10000050 3300025913 Bacteria 405727
366 Ga0207695_10000075 3300025913 Bacteria 308496
367 Ga0207695_10002642 3300025913 Bacteria 26207
368 Ga0207695_10006933 3300025913 Bacteria 14557
369 Ga0207695_10028415 3300025913 Bacteria 6202
370 Ga0207695_10049587 3300025913 Bacteria 4424
371 Ga0207695_10072236 3300025913 Bacteria 3522
372 Ga0207695_10373390 3300025913 Unclassified 1312
373 Ga0207671_10001031 3300025914 Bacteria 33913
374 Ga0207671_10010247 3300025914 Bacteria 7755
375 Ga0207671_10060918 3300025914 Unclassified 2800
376 Ga0207671_10061951 3300025914 Bacteria 2777
377 Ga0207671_10142339 3300025914 Bacteria 1848
378 Ga0207693_10044049 3300025915 Bacteria 3507
379 Ga0207693_10046145 3300025915 Bacteria 3423
380 Ga0207693_10052328 3300025915 Bacteria 3203
381 Ga0207693_10060064 3300025915 Bacteria 2978
382 Ga0207663_10010895 3300025916 Bacteria 4857
383 Ga0207663_10014302 3300025916 Bacteria 4339
384 Ga0207663_10039572 3300025916 Bacteria 2858
385 Ga0207663_10062463 3300025916 Bacteria 2368
386 Ga0207657_10001280 3300025919 Bacteria 26783
387 Ga0207657_10008909 3300025919 Bacteria 10144
388 Ga0207649_10000566 3300025920 Bacteria 25447
389 Ga0207652_10029113 3300025921 Bacteria 4615
390 Ga0207652_10105765 3300025921 Bacteria 2490
391 Ga0207652_10165814 3300025921 Bacteria 1981
392 Ga0207646_10002647 3300025922 Bacteria 21021
393 Ga0207646_10002966 3300025922 Bacteria 19640
394 Ga0207646_10010731 3300025922 Bacteria 8911
395 Ga0207646_10014722 3300025922 Bacteria 7410
396 Ga0207646_10072525 3300025922 Bacteria 3076
397 Ga0207646_10161234 3300025922 Unclassified 2024
398 Ga0207681_10045028 3300025923 Bacteria 2960
399 Ga0207694_10000024 3300025924 Bacteria 259443
400 Ga0207650_10000051 3300025925 Bacteria 168652
401 Ga0207650_10031548 3300025925 Bacteria 3828
402 Ga0207659_10000001 3300025926 Bacteria 660958
403 Ga0207659_10008490 3300025926 Bacteria 6381
404 Ga0207687_10000623 3300025927 Bacteria 23906
405 Ga0207687_10001469 3300025927 Bacteria 16181
406 Ga0207687_10001653 3300025927 Bacteria 15376
407 Ga0207687_10002345 3300025927 Bacteria 12888
408 Ga0207687_10018255 3300025927 Bacteria 4628
409 Ga0207700_10009425 3300025928 Bacteria 6097
410 Ga0207700_10025361 3300025928 Bacteria 4115
411 Ga0207664_10146730 3300025929 Bacteria 2001
412 Ga0207664_10276449 3300025929 Bacteria 1473
413 Ga0207664_10292927 3300025929 Bacteria 1430
414 Ga0207644_10001997 3300025931 Bacteria 13209
415 Ga0207644_10002704 3300025931 Bacteria 11422
416 Ga0207644_10388516 3300025931 Unclassified 1139
417 Ga0207690_10028250 3300025932 Bacteria 3554
418 Ga0207706_10000339 3300025933 Bacteria 50795
419 Ga0207706_10004876 3300025933 Bacteria 12553
420 Ga0207706_10009068 3300025933 Bacteria 9151
421 Ga0207686_10013161 3300025934 Bacteria 4571
422 Ga0207686_10031876 3300025934 Bacteria 3133
423 Ga0207670_10000778 3300025936 Bacteria 16755
424 Ga0207670_10287211 3300025936 Bacteria 1284
425 Ga0207669_10063345 3300025937 Bacteria 2282
426 Ga0207704_10029097 3300025938 Bacteria 3075
427 Ga0207704_10037110 3300025938 Unclassified 2812
428 Ga0207704_10148443 3300025938 Bacteria 1651
429 Ga0207665_10010339 3300025939 Bacteria 6127
430 Ga0207665_10014588 3300025939 Bacteria 5173
431 Ga0207665_10048966 3300025939 Unclassified 2838
432 Ga0207665_10218907 3300025939 Bacteria 1394
433 Ga0207691_10001710 3300025940 Bacteria 21634
434 Ga0207691_10001789 3300025940 Bacteria 21139
435 Ga0207691_10037155 3300025940 Unclassified 4511
436 Ga0207711_10013284 3300025941 Bacteria 6842
437 Ga0207711_10016683 3300025941 Bacteria 6098
438 Ga0207711_10041585 3300025941 Bacteria 3915
439 Ga0207689_10000184 3300025942 Bacteria 54232
440 Ga0207689_10051744 3300025942 Unclassified 3385
441 Ga0207661_10000069 3300025944 Bacteria 70656
442 Ga0207661_10051554 3300025944 Bacteria 3284
443 Ga0207661_10481396 3300025944 Bacteria 1133
444 Ga0207679_10000101 3300025945 Bacteria 71096
445 Ga0207679_10009655 3300025945 Bacteria 6186
446 Ga0207667_10001729 3300025949 Bacteria 27497
447 Ga0207667_10005590 3300025949 Bacteria 15338
448 Ga0207667_10035351 3300025949 Bacteria 5359
449 Ga0207667_10051783 3300025949 Bacteria 4327
450 Ga0207667_10058356 3300025949 Bacteria 4048
451 Ga0207667_10203137 3300025949 Unclassified 2033
452 Ga0207667_10233401 3300025949 Bacteria 1883
453 Ga0207651_10067331 3300025960 Unclassified 2520
454 Ga0207712_10017344 3300025961 Bacteria 4675
455 Ga0207712_10131552 3300025961 Bacteria 1907
456 Ga0207668_10030920 3300025972 Bacteria 3522
457 Ga0207640_10102348 3300025981 Bacteria 2011
458 Ga0207640_10305128 3300025981 Bacteria 1261
459 Ga0207658_10001141 3300025986 Bacteria 21288
460 Ga0207658_10003193 3300025986 Bacteria 11675
461 Ga0207658_10019055 3300025986 Bacteria 4746
462 Ga0207677_10000003 3300026023 Bacteria 450061
463 Ga0207677_10000034 3300026023 Bacteria 117922
464 Ga0207703_10000019 3300026035 Bacteria 254885
465 Ga0207703_10000839 3300026035 Bacteria 30236
466 Ga0207703_10041152 3300026035 Bacteria 3700
467 Ga0207703_10290434 3300026035 Bacteria 1488
468 Ga0207639_10000005 3300026041 Bacteria 579948
469 Ga0207639_10025342 3300026041 Bacteria 4300
470 Ga0207639_10114812 3300026041 Bacteria 2201
471 Ga0207639_10264938 3300026041 Bacteria 1505
472 Ga0207639_10268059 3300026041 Bacteria 1497
473 Ga0207678_10000921 3300026067 Bacteria 26925
474 Ga0207678_10002190 3300026067 Bacteria 17649
475 Ga0207678_10002652 3300026067 Bacteria 16263
476 Ga0207708_10000024 3300026075 Bacteria 172863
477 Ga0207702_10004078 3300026078 Bacteria 13112
478 Ga0207702_10008197 3300026078 Bacteria 8831
479 Ga0207702_10141454 3300026078 Bacteria 2178
480 Ga0207702_10208082 3300026078 Unclassified 1817
481 Ga0207641_10000006 3300026088 Bacteria 442569
482 Ga0207641_10002780 3300026088 Bacteria 15941
483 Ga0207641_10006018 3300026088 Bacteria 10281
484 Ga0207641_10047752 3300026088 Bacteria 3611
485 Ga0207641_10099035 3300026088 Bacteria 2564
486 Ga0207641_10102806 3300026088 Bacteria 2520
487 Ga0207641_10392045 3300026088 Unclassified 1332
488 Ga0207648_10000664 3300026089 Bacteria 38538
489 Ga0207648_10003349 3300026089 Bacteria 16845
490 Ga0207648_10009473 3300026089 Bacteria 9324
491 Ga0207676_10000002 3300026095 Bacteria 1198607
492 Ga0207676_10002185 3300026095 Bacteria 14106
493 Ga0207676_10094434 3300026095 Bacteria 2464
494 Ga0207676_10133693 3300026095 Bacteria 2113
495 Ga0207674_10002167 3300026116 Bacteria 24843
496 Ga0207674_10009736 3300026116 Bacteria 10951
497 Ga0207674_10012889 3300026116 Bacteria 9329
498 Ga0207674_10017826 3300026116 Bacteria 7739
499 Ga0207674_10230528 3300026116 Bacteria 1799
500 Ga0207675_100106512 3300026118 Bacteria 2643
501 Ga0207683_10000460 3300026121 Bacteria 37808
502 Ga0207683_10001670 3300026121 Bacteria 19882
503 Ga0207683_10099462 3300026121 Bacteria 2596
504 Ga0207698_10000008 3300026142 Bacteria 281991
505 Ga0207698_10101694 3300026142 Bacteria 2384
506 Ga0207698_10300883 3300026142 Bacteria 1493
507 Ga0207698_10309124 3300026142 Unclassified 1475
508 Ga0209588_1011308 3300027671 Bacteria 2695
509 Ga0207428_10138319 3300027907 Bacteria 1861
510 Ga0265354_1000021 3300028016 Bacteria 24904
511 Ga0265354_1001873 3300028016 Bacteria 2813
512 Ga0268266_10000153 3300028379 Bacteria 131887
513 Ga0268266_10002191 3300028379 Bacteria 21364
514 Ga0268266_10013979 3300028379 Bacteria 6911
515 Ga0268266_10055676 3300028379 Bacteria 3400
516 Ga0268266_10104266 3300028379 Bacteria 2504
517 Ga0268265_10011994 3300028380 Bacteria 5865
518 Ga0268265_10299912 3300028380 Bacteria 1446
519 Ga0268264_10000669 3300028381 Bacteria 40172
520 Ga0268264_10001226 3300028381 Bacteria 24663
521 Ga0268264_10045316 3300028381 Bacteria 3651
522 Ga0268264_10167702 3300028381 Bacteria 1983
523 Ga0268264_10248502 3300028381 Unclassified 1651
524 Ga0265338_10052974 3300028800 Bacteria 3635
525 Ga0265338_10180950 3300028800 Bacteria 1607
526 Ga0265770_1001287 3300030878 Bacteria 3462
527 Ga0265770_1003233 3300030878 Bacteria 2216
528 Ga0265765_1003655 3300030879 Bacteria 1550
529 Ga0265339_10005498 3300031249 Bacteria 8440
530 Ga0265331_10128639 3300031250 Bacteria 1156
531 Ga0265316_10041336 3300031344 Bacteria 3690
532 Ga0265313_10008888 3300031595 Bacteria 6607
533 Ga0265314_10007163 3300031711 Bacteria 9707
534 Ga0265342_10030322 3300031712 Bacteria 3352
535 Ga0307416_100123614 3300032002 Bacteria 2313
536 Ga0316212_1001185 3300033547 Bacteria 3487
537 Ga0373926_0000636 3300035083 Bacteria 9569
538 Ga0373934_0000710 3300035086 Bacteria 11888
539 Ga0373953_0082393 3300035117 Unclassified 1339
540 Ga0373954_0007118 3300035118 Bacteria 4883
541 Ga0373956_0009696 3300035119 Bacteria 3921
542 Ga0373956_0018682 3300035119 Bacteria 2937
543 Ga0373946_0001883 3300035171 Bacteria 7325
544 Ga0373955_0005463 3300035172 Bacteria 5713
545 Ga0373955_0054539 3300035172 Bacteria 2186
546 Ga0373955_0076666 3300035172 Bacteria 1881
547 Ga0373961_0026879 3300035241 Bacteria 1576
548 Ga0373924_0011060 3300035410 Bacteria 3344
549 Ga0373931_0008198 3300035691 Bacteria 4949
550 Ga0373931_0045338 3300035691 Bacteria 2322
551 Ga0373935_0159403 3300035692 Bacteria 1537
552 Ga0373927_0000782 3300035695 Bacteria 24268
553 Ga0373933_0009110 3300035724 Bacteria 5418
554 Ga0373933_0039687 3300035724 Bacteria 2771
555 Ga0373947_0017268 3300035725 Bacteria 4150
556 Ga0373947_0073749 3300035725 Bacteria 2098
557 Ga0373937_0000349 3300036401 Bacteria 43599
558 Ga0373937_0096703 3300036401 Bacteria 2739
559 Ga0373937_0097787 3300036401 Bacteria 2723
560 Ga0373925_0000717 3300037068 Bacteria 30876
561 Ga0373925_0021689 3300037068 Bacteria 4681
562 Ga0373925_0243120 3300037068 Bacteria 1442
563 Ga0395905_0007860 3300037471 Bacteria 10563
564 Ga0395905_0094350 3300037471 Bacteria 2807
565 Ga0436365_0235218 3300039437 Bacteria 5170
566 Ga0436365_0693404 3300039437 Bacteria 102624
567 Ga0436365_1172964 3300039437 Bacteria 3139
568 Ga0436363_0124748 3300039450 Bacteria 1401
569 Ga0436363_1479800 3300039450 Bacteria 7165
570 Ga0436362_0984254 3300039453 Bacteria 405590
571 Ga0451577_0033406 3300042876 Bacteria 4638
572 Ga0451577_0202079 3300042876 Bacteria 1794
573 Ga0453683_0028024 3300044673 Bacteria 3568
574 Ga0466963_0031125 3300044694 Bacteria 3447
575 Ga0451576_0234056 3300045051 Bacteria 1918
576 Ga0466967_0143575 3300045976 Bacteria 2225
577 Ga0466967_0420615 3300045976 Archaea 1302
578 Ga0495603_0001224 3300046455 Bacteria 14983
579 Ga0495603_0015962 3300046455 Bacteria 4539
580 Ga0495629_0013388 3300046459 Bacteria 5918
581 Ga0495629_0030616 3300046459 Bacteria 3815
582 Ga0495629_0036209 3300046459 Bacteria 3485
583 Ga0495629_0140932 3300046459 Bacteria 1677
584 Ga0495629_0184823 3300046459 Bacteria 1444
585 Ga0495641_0013483 3300046461 Bacteria 4486
586 Ga0495641_0018646 3300046461 Bacteria 3576
587 Ga0495651_0023136 3300046462 Bacteria 4833
588 Ga0495651_0323015 3300046462 Bacteria 1028
589 Ga0495653_0156588 3300046463 Bacteria 1586
590 Ga0495580_0001359 3300046472 Bacteria 21509
591 Ga0495580_0021567 3300046472 Bacteria 4750
592 Ga0495580_0039037 3300046472 Bacteria 3397
593 Ga0495580_0142280 3300046472 Bacteria 1663
594 Ga0495582_0000382 3300046473 Bacteria 24110
595 Ga0495582_0042520 3300046473 Bacteria 2503
596 Ga0495582_0061327 3300046473 Bacteria 2076
597 Ga0495639_0001243 3300046475 Bacteria 11478
598 Ga0495639_0097343 3300046475 Bacteria 1386
599 Ga0495662_0031837 3300046476 Bacteria 2548
600 Ga0495664_0006870 3300046477 Bacteria 6297
601 Ga0495664_0095376 3300046477 Bacteria 1791
602 Ga0495585_0056531 3300046492 Bacteria 2167
603 Ga0495594_0001319 3300046499 Bacteria 12905
604 Ga0495594_0001600 3300046499 Bacteria 11779
605 Ga0495594_0003442 3300046499 Bacteria 8169
606 Ga0495583_0040172 3300046506 Bacteria 2200
607 Ga0495606_0031487 3300046507 Bacteria 3687
608 Ga0495606_0144380 3300046507 Bacteria 1403
609 Ga0495616_0037220 3300046513 Bacteria 2505
610 Ga0495630_0012090 3300046517 Bacteria 6259
611 Ga0495666_0021800 3300046526 Bacteria 3171
612 Ga0495665_0004658 3300046531 Bacteria 7396
613 Ga0495665_0029902 3300046531 Bacteria 2917
614 Ga0495640_0005257 3300046533 Bacteria 10292
615 Ga0495640_0017251 3300046533 Bacteria 5384
616 Ga0495586_0003873 3300046535 Bacteria 8019
617 Ga0495587_0041029 3300046536 Bacteria 2763
618 Ga0495587_0118461 3300046536 Bacteria 1517
619 Ga0495609_0033809 3300046538 Bacteria 2320
620 Ga0495645_0016995 3300046543 Bacteria 5208
621 Ga0495645_0040549 3300046543 Bacteria 3396
622 Ga0495645_0128538 3300046543 Bacteria 1778
623 Ga0495645_0150100 3300046543 Bacteria 1620
624 Ga0495622_0012938 3300046557 Bacteria 3870
625 Ga0495667_0026544 3300046559 Bacteria 3904
626 Ga0495667_0038489 3300046559 Bacteria 3184
627 Ga0495634_0032295 3300046642 Bacteria 3601
628 Ga0495625_0039657 3300046660 Bacteria 3438
629 Ga0495635_0117040 3300046663 Bacteria 1819
630 Ga0495635_0210844 3300046663 Bacteria 1315
631 Ga0495635_0249144 3300046663 Bacteria 1198
632 Ga0495588_0081695 3300046674 Bacteria 1687
633 Ga0495657_0108859 3300046675 Bacteria 1758
634 Ga0495623_0052314 3300046679 Bacteria 2581
635 Ga0495647_0003725 3300046681 Bacteria 4897
636 Ga0495669_0001925 3300046684 Bacteria 8523
637 Ga0495669_0002169 3300046684 Bacteria 8054
638 Ga0495669_0012854 3300046684 Unclassified 3564
639 Ga0495613_0004084 3300046689 Bacteria 10908
640 Ga0495613_0027378 3300046689 Bacteria 4242
641 Ga0495613_0062387 3300046689 Bacteria 2728
642 Ga0495624_0051285 3300046690 Bacteria 2612
643 Ga0495670_0041221 3300046691 Bacteria 2303
644 Ga0495671_0102202 3300046692 Bacteria 1401
645 Ga0495600_0006833 3300046809 Bacteria 6956
646 Ga0495600_0019628 3300046809 Bacteria 4319
647 Ga0495581_0013471 3300047315 Bacteria 4742
648 Ga0495581_0038031 3300047315 Bacteria 2784
649 Ga0495604_0001770 3300047317 Bacteria 17631
650 Ga0495604_0029105 3300047317 Bacteria 4395
651 Ga0495674_0009174 3300047319 Bacteria 9399
652 Ga0495674_0035705 3300047319 Bacteria 4482
653 Ga0495674_0036725 3300047319 Bacteria 4407
654 Ga0495676_0001777 3300047321 Bacteria 18840
655 Ga0495676_0007774 3300047321 Bacteria 9836
656 Ga0495675_0021825 3300047444 Bacteria 4079
657 Ga0495684_0011951 3300047471 Bacteria 6696
658 Ga0495684_0060732 3300047471 Bacteria 2876
659 Ga0495593_0040756 3300047673 Bacteria 2499
660 Ga0495602_0013387 3300048088 Bacteria 8386
661 Ga0495614_0007434 3300048089 Bacteria 4877
662 Ga0495614_0021477 3300048089 Bacteria 2788
663 Ga0496101_0081230 3300048904 Bacteria 2397
664 Ga0496102_0003513 3300048905 Bacteria 13281
665 Ga0496102_0004269 3300048905 Bacteria 12085
666 Ga0496103_0015318 3300048906 Bacteria 4561
667 Ga0496104_0210221 3300048907 Bacteria 1857
668 Ga0496104_0217841 3300048907 Bacteria 1821
669 Ga0496105_0048746 3300048908 Bacteria 3496
670 Ga0496105_0059250 3300048908 Bacteria 3160
671 Ga0496106_0070980 3300048909 Bacteria 2661
672 Ga0496107_0010356 3300048910 Bacteria 6478
673 Ga0496108_0000095 3300048911 Bacteria 92520
674 Ga0496108_0113319 3300048911 Bacteria 2321
675 Ga0496109_0000126 3300048912 Bacteria 77920
676 Ga0496109_0000410 3300048912 Bacteria 38147
677 Ga0496110_0002871 3300048913 Bacteria 13020
678 Ga0496111_0007966 3300048914 Bacteria 6985
679 Ga0496112_0000615 3300048915 Bacteria 24595
680 Ga0496112_0005230 3300048915 Bacteria 11169
681 Ga0496112_0017844 3300048915 Bacteria 6679
682 Ga0496112_0309642 3300048915 Bacteria 1524
683 Ga0496113_0003748 3300048916 Bacteria 9167
684 Ga0496113_0357896 3300048916 Unclassified 1171
685 Ga0496114_0022761 3300048917 Bacteria 5107
686 Ga0496114_0030844 3300048917 Bacteria 4410
687 Ga0496114_0238661 3300048917 Bacteria 1598
688 Ga0496115_0006563 3300048918 Bacteria 8528
689 Ga0496115_0009132 3300048918 Bacteria 7359
690 Ga0496115_0045376 3300048918 Unclassified 3508
691 Ga0501073_0012134 3300049589 Bacteria 6291
692 Ga0501080_0001025 3300049742 Bacteria 22971
693 Ga0501081_0147021 3300049743 Bacteria 1692
694 nmdc:mga05p37_22163_c1 3300050507 Bacteria 7700
695 nmdc:mga06r32_217866_c1 3300050510 Bacteria 1897
696 nmdc:mga06r32_299693_c1 3300050510 Bacteria 1594
697 nmdc:mga06r32_367438_c1 3300050510 Bacteria 1422
698 nmdc:mga06r32_9974_c1 3300050510 Bacteria 8568
699 nmdc:mga08y16_35772_c1 3300050511 Bacteria 5216
700 nmdc:mga0n895_100917_c1 3300050512 Bacteria 2368
701 nmdc:mga0n895_51073_c1 3300050512 Bacteria 4055
702 nmdc:mga0n895_907_c1 3300050512 Bacteria 14186
703 nmdc:mga0rr50_10588_c1 3300050513 Bacteria 5861
704 nmdc:mga0rr50_275741_c1 3300050513 Bacteria 1402
705 nmdc:mga0rr50_49268_c1 3300050513 Bacteria 3118
706 nmdc:mga0rr50_64144_c1 3300050513 Unclassified 2777
707 nmdc:mga08x19_146_c1 3300050514 Bacteria 60222
708 nmdc:mga08x19_2567_c1 3300050514 Bacteria 11042
709 nmdc:mga08x19_57650_c1 3300050514 Bacteria 2510
710 nmdc:mga08x19_6583_c1 3300050514 Bacteria 6885
711 nmdc:mga08x19_689_c1 3300050514 Bacteria 21661
712 nmdc:mga0a205_141703_c1 3300050515 Bacteria 2304
713 nmdc:mga0a205_37552_c1 3300050515 Bacteria 4658
714 nmdc:mga0a205_46298_c1 3300050515 Bacteria 4194
715 Ga0495619_0015727 3300053085 Bacteria 4791
716 Ga0501084_0018572 3300054114 Bacteria 5788
717 Ga0501084_0089633 3300054114 Bacteria 2582
718 Ga0501082_0131148 3300060353 Bacteria 2175
719 Ga0466967_0002708
720 JGI25406J46586_10019228
721 rootL2_10024844
722 Ga0065715_10095553
723 Ga0070676_10002577
724 Ga0070676_10013025
725 Ga0070683_100000097
726 Ga0070683_100015960
727 Ga0070683_100022036
728 Ga0070683_100044469
729 Ga0070683_100207182
730 Ga0070683_100222443
731 Ga0070690_100002589
732 Ga0070690_100012605
733 Ga0070690_100097002
734 Ga0070670_100010640
735 Ga0070670_100013420
736 Ga0070670_100175734
737 Ga0068869_100001114
738 Ga0068869_100004783
739 Ga0070680_100010238
740 Ga0070682_100000082
741 Ga0070682_100064671
742 Ga0068868_100000479
743 Ga0068868_100003002
744 Ga0068868_100226090
745 Ga0070689_100000899
746 Ga0070689_100030208
747 Ga0070689_100290896
748 Ga0070687_100131256
749 Ga0070661_100005145
750 Ga0070661_100005454
751 Ga0070661_100045692
752 Ga0070661_100216062
753 Ga0070661_100356730
754 Ga0070668_100168194
755 Ga0070669_100004094
756 Ga0070669_100100748
757 Ga0070675_100000003
758 Ga0070675_100029761
759 Ga0070675_100051327
760 Ga0070671_100007588
761 Ga0070671_100017627
762 Ga0070671_100029409
763 Ga0070688_100046952
764 Ga0070688_100137183
765 Ga0070659_100004954
766 Ga0070659_100404524
767 Ga0070667_100000808
768 Ga0070667_100045107
769 Ga0070667_100050889
770 Ga0070709_10080316
771 Ga0070709_10096014
772 Ga0070714_100123214
773 Ga0070714_100207413
774 Ga0070701_10026517
775 Ga0070711_100018101
776 Ga0070711_100123852
777 Ga0070705_100002661
778 Ga0070705_100043942
779 Ga0070705_100173749
780 Ga0070700_100000001
781 Ga0070694_100016968
782 Ga0070694_100311393
783 Ga0070708_100006686
784 Ga0070708_100017608
785 Ga0070708_100040668
786 Ga0070708_100443327
787 Ga0070663_100002121
788 Ga0070663_100003832
789 Ga0070663_100075253
790 Ga0070678_100005711
791 Ga0070678_100255363
792 Ga0070662_100000757
793 Ga0070662_100002775
794 Ga0070681_10418887
795 Ga0068867_100004156
796 Ga0070685_10003684
797 Ga0070685_10064461
798 Ga0070706_100006053
799 Ga0070706_100012328
800 Ga0070707_100001974
801 Ga0070707_100003066
802 Ga0070707_100004807
803 Ga0070707_100024983
804 Ga0070698_100006903
805 Ga0070698_100022863
806 Ga0070698_100034608
807 Ga0070698_100157613
808 Ga0070698_100195545
809 Ga0070698_100278086
810 Ga0070699_100011123
811 Ga0070699_100015577
812 Ga0070699_100033738
813 Ga0070699_100047276
814 Ga0070699_100099871
815 Ga0070679_100069183
816 Ga0070679_100079144
817 Ga0070684_100000031
818 Ga0070684_100016682
819 Ga0070684_100097193
820 Ga0070697_100007629
821 Ga0070697_100009220
822 Ga0068853_100006331
823 Ga0068853_100025332
824 Ga0070672_100000324
825 Ga0070672_100004476
826 Ga0070695_100002293
827 Ga0070696_100004097
828 Ga0070696_100167489
829 Ga0070693_100000004
830 Ga0070693_100005354
831 Ga0070693_100007822
832 Ga0070665_100003370
833 Ga0070665_100009991
834 Ga0070665_100013260
835 Ga0070665_100019857
836 Ga0070704_100002014
837 Ga0068855_100009684
838 Ga0068855_100014801
839 Ga0068855_100017878
840 Ga0068855_100743515
841 Ga0070664_100077832
842 Ga0070664_100119594
843 Ga0068857_100000602
844 Ga0068857_100003885
845 Ga0068857_100004856
846 Ga0068857_100015384
847 Ga0068857_100178342
848 Ga0068854_100000587
849 Ga0068854_100007505
850 Ga0068854_100178829
851 Ga0068856_100009485
852 Ga0068856_100016636
853 Ga0068856_100039225
854 Ga0068856_100295138
855 Ga0070702_100003922
856 Ga0070702_100014769
857 Ga0068852_100000032
858 Ga0068852_100002033
859 Ga0068852_100104777
860 Ga0068852_100218104
861 Ga0068852_100313696
862 Ga0068859_100015723
863 Ga0068859_100024506
864 Ga0068859_100112219
865 Ga0068864_100000001
866 Ga0068864_100011164
867 Ga0068864_100033344
868 Ga0068864_100156212
869 Ga0068866_10009415
870 Ga0068851_10007717
871 Ga0068851_10009873
872 Ga0068870_10001103
873 Ga0068863_100003024
874 Ga0068863_100011180
875 Ga0068863_100058770
876 Ga0068863_100082252
877 Ga0068863_100123713
878 Ga0068863_100127894
879 Ga0068863_100283149
880 Ga0068858_100001897
881 Ga0068858_100005975
882 Ga0068858_100008393
883 Ga0068858_100013939
884 Ga0068858_100149088
885 Ga0068860_100000031
886 Ga0068860_100047573
887 Ga0068860_100073434
888 Ga0068860_100144359
889 Ga0068862_100003359
890 Ga0068862_100008925
891 Ga0081455_10007293
892 Ga0081455_10065623
893 Ga0081539_10018248
894 Ga0070717_10005591
895 Ga0070717_10527211
896 Ga0070716_100000450
897 Ga0070716_100003804
898 Ga0070716_100004439
899 Ga0070716_100030254
900 Ga0070716_100136952
901 Ga0070712_100054144
902 Ga0097621_100012626
903 Ga0097621_100109589
904 Ga0097621_100185260
905 Ga0097621_100279321
906 Ga0068871_100001244
907 Ga0068871_100011283
908 Ga0068871_100190361
909 Ga0075428_100031691
910 Ga0075428_100293309
911 Ga0075431_100018995
912 Ga0075431_100136569
913 Ga0075431_100402784
914 Ga0075431_100430035
915 Ga0075433_10035022
916 Ga0075433_10131004
917 Ga0075433_10280229
918 Ga0075434_100003588
919 Ga0075434_100030079
920 Ga0075434_100055325
921 Ga0075434_100239241
922 Ga0075429_100263342
923 Ga0068865_100002290
924 Ga0068865_100039266
925 Ga0075436_100000737
926 Ga0075436_100005655
927 Ga0075436_100026238
928 Ga0097620_100015722
929 Ga0097620_100024506
930 Ga0097620_100112217
931 Ga0075435_100058675
932 Ga0075435_100093913
933 Ga0075435_100336284
934 Ga0099794_10006331
935 Ga0099794_10023214
936 Ga0099794_10045411
937 Ga0099794_10148372
938 Ga0099795_10025446
939 Ga0105244_10013367
940 Ga0105240_10000135
941 Ga0105240_10000451
942 Ga0105240_10004680
943 Ga0105240_10010538
944 Ga0105240_10017307
945 Ga0105240_10048663
946 Ga0105240_10172716
947 Ga0105240_10372207
948 Ga0105240_10388657
949 Ga0105240_10439322
950 Ga0105240_10521159
951 Ga0105240_10543670
952 Ga0105245_10000786
953 Ga0105245_10002852
954 Ga0105245_10016836
955 Ga0105245_10040917
956 Ga0105245_10238688
957 Ga0114129_10157396
958 Ga0114129_10239068
959 Ga0105241_10010010
960 Ga0105241_10021359
961 Ga0105241_10050809
962 Ga0105241_10171475
963 Ga0105242_10002605
964 Ga0105242_10011272
965 Ga0105242_10024358
966 Ga0105248_10009291
967 Ga0105248_10026710
968 Ga0105248_10076405
969 Ga0105248_10186842
970 Ga0105237_10017522
971 Ga0105237_10021398
972 Ga0105237_10297153
973 Ga0105238_10001963
974 Ga0105238_10666499
975 Ga0105249_10039077
976 Ga0105249_10089888
977 Ga0105249_10119018
978 Ga0105249_10525790
979 Ga0099796_10000665
980 Ga0105239_10035672
981 Ga0105239_10057403
982 Ga0105239_10111537
983 Ga0105239_10366714
984 Ga0105246_10001466
985 Ga0105246_10085885
986 Ga0157373_10003983
987 Ga0157373_10004107
988 Ga0157371_10043860
989 Ga0157370_10000023
990 Ga0157370_10015084
991 Ga0157369_10000010
992 Ga0157369_10035913
993 Ga0157369_10042861
994 Ga0157369_10062729
995 Ga0157369_10213051
996 Ga0157369_10446150
997 Ga0157374_10001688
998 Ga0157374_10046796
999 Ga0157374_10047646
1000 Ga0157374_10239095
1001 Ga0157374_10316594
1002 Ga0157378_10000044
1003 Ga0157378_10002388
1004 Ga0157378_10006829
1005 Ga0157378_10016679
1006 Ga0157378_10095021
1007 Ga0157378_10193705
1008 Ga0157378_10304705
1009 Ga0163162_10001495
1010 Ga0163162_10007750
1011 Ga0163162_10010928
1012 Ga0163162_10017286
1013 Ga0163162_10176040
1014 Ga0163162_10440447
1015 Ga0163162_10555036
1016 Ga0157372_10000055
1017 Ga0157372_10007697
1018 Ga0157372_10008911
1019 Ga0157372_10068306
1020 Ga0157372_10104887
1021 Ga0157372_10211618
1022 Ga0157372_10223635
1023 Ga0157372_10250472
1024 Ga0157372_10372883
1025 Ga0157375_10000005
1026 Ga0157375_10000092
1027 Ga0157375_10122045
1028 Ga0157375_10247725
1029 Ga0157375_10517914
1030 Ga0163163_10001291
1031 Ga0163163_10004292
1032 Ga0163163_10004406
1033 Ga0163163_10011078
1034 Ga0163163_10055189
1035 Ga0163163_10086516
1036 Ga0157380_10362470
1037 Ga0157377_10000105
1038 Ga0157377_10000304
1039 Ga0157379_10001222
1040 Ga0157379_10008140
1041 Ga0157376_10000008
1042 Ga0157376_10002199
1043 Ga0157376_10018878
1044 Ga0157376_10022142
1045 Ga0157376_10068900
1046 Ga0157376_10079463
1047 Ga0157376_10118333
1048 Ga0157376_10170736
1049 Ga0157376_10570691
1050 Ga0213873_10000001
1051 Ga0213876_10000002
1052 Ga0213876_10042452
1053 Ga0228598_1024820
1054 Ga0207697_10028981
1055 Ga0207656_10009454
1056 Ga0207656_10045886
1057 Ga0207655_1040181
1058 Ga0207653_10056710
1059 Ga0207682_10007200
1060 Ga0207710_10001423
1061 Ga0207688_10011349
1062 Ga0207688_10093320
1063 Ga0207680_10002500
1064 Ga0207680_10004549
1065 Ga0207680_10042030
1066 Ga0207647_10007389
1067 Ga0207647_10015179
1068 Ga0207685_10022938
1069 Ga0207699_10069725
1070 Ga0207645_10003138
1071 Ga0207645_10003581
1072 Ga0207645_10040661
1073 Ga0207643_10000247
1074 Ga0207684_10015257
1075 Ga0207684_10015510
1076 Ga0207684_10040516
1077 Ga0207654_10013984
1078 Ga0207654_10030271
1079 Ga0207654_10118775
1080 Ga0207707_10035921
1081 Ga0207707_10258700
1082 Ga0207707_10350079
1083 Ga0207695_10000050
1084 Ga0207695_10000075
1085 Ga0207695_10002642
1086 Ga0207695_10006933
1087 Ga0207695_10028415
1088 Ga0207695_10049587
1089 Ga0207695_10072236
1090 Ga0207695_10373390
1091 Ga0207671_10001031
1092 Ga0207671_10010247
1093 Ga0207671_10060918
1094 Ga0207671_10061951
1095 Ga0207671_10142339
1096 Ga0207693_10044049
1097 Ga0207693_10046145
1098 Ga0207693_10052328
1099 Ga0207693_10060064
1100 Ga0207663_10010895
1101 Ga0207663_10014302
1102 Ga0207663_10039572
1103 Ga0207663_10062463
1104 Ga0207657_10001280
1105 Ga0207657_10008909
1106 Ga0207649_10000566
1107 Ga0207652_10029113
1108 Ga0207652_10105765
1109 Ga0207652_10165814
1110 Ga0207646_10002647
1111 Ga0207646_10002966
1112 Ga0207646_10010731
1113 Ga0207646_10014722
1114 Ga0207646_10072525
1115 Ga0207646_10161234
1116 Ga0207681_10045028
1117 Ga0207694_10000024
1118 Ga0207650_10000051
1119 Ga0207650_10031548
1120 Ga0207659_10000001
1121 Ga0207659_10008490
1122 Ga0207687_10000623
1123 Ga0207687_10001469
1124 Ga0207687_10001653
1125 Ga0207687_10002345
1126 Ga0207687_10018255
1127 Ga0207700_10009425
1128 Ga0207700_10025361
1129 Ga0207664_10146730
1130 Ga0207664_10276449
1131 Ga0207664_10292927
1132 Ga0207644_10001997
1133 Ga0207644_10002704
1134 Ga0207644_10388516
1135 Ga0207690_10028250
1136 Ga0207706_10000339
1137 Ga0207706_10004876
1138 Ga0207706_10009068
1139 Ga0207686_10013161
1140 Ga0207686_10031876
1141 Ga0207670_10000778
1142 Ga0207670_10287211
1143 Ga0207669_10063345
1144 Ga0207704_10029097
1145 Ga0207704_10037110
1146 Ga0207704_10148443
1147 Ga0207665_10010339
1148 Ga0207665_10014588
1149 Ga0207665_10048966
1150 Ga0207665_10218907
1151 Ga0207691_10001710
1152 Ga0207691_10001789
1153 Ga0207691_10037155
1154 Ga0207711_10013284
1155 Ga0207711_10016683
1156 Ga0207711_10041585
1157 Ga0207689_10000184
1158 Ga0207689_10051744
1159 Ga0207661_10000069
1160 Ga0207661_10051554
1161 Ga0207661_10481396
1162 Ga0207679_10000101
1163 Ga0207679_10009655
1164 Ga0207667_10001729
1165 Ga0207667_10005590
1166 Ga0207667_10035351
1167 Ga0207667_10051783
1168 Ga0207667_10058356
1169 Ga0207667_10203137
1170 Ga0207667_10233401
1171 Ga0207651_10067331
1172 Ga0207712_10017344
1173 Ga0207712_10131552
1174 Ga0207668_10030920
1175 Ga0207640_10102348
1176 Ga0207640_10305128
1177 Ga0207658_10001141
1178 Ga0207658_10003193
1179 Ga0207658_10019055
1180 Ga0207677_10000003
1181 Ga0207677_10000034
1182 Ga0207703_10000019
1183 Ga0207703_10000839
1184 Ga0207703_10041152
1185 Ga0207703_10290434
1186 Ga0207639_10000005
1187 Ga0207639_10025342
1188 Ga0207639_10114812
1189 Ga0207639_10264938
1190 Ga0207639_10268059
1191 Ga0207678_10000921
1192 Ga0207678_10002190
1193 Ga0207678_10002652
1194 Ga0207708_10000024
1195 Ga0207702_10004078
1196 Ga0207702_10008197
1197 Ga0207702_10141454
1198 Ga0207702_10208082
1199 Ga0207641_10000006
1200 Ga0207641_10002780
1201 Ga0207641_10006018
1202 Ga0207641_10047752
1203 Ga0207641_10099035
1204 Ga0207641_10102806
1205 Ga0207641_10392045
1206 Ga0207648_10000664
1207 Ga0207648_10003349
1208 Ga0207648_10009473
1209 Ga0207676_10000002
1210 Ga0207676_10002185
1211 Ga0207676_10094434
1212 Ga0207676_10133693
1213 Ga0207674_10002167
1214 Ga0207674_10009736
1215 Ga0207674_10012889
1216 Ga0207674_10017826
1217 Ga0207674_10230528
1218 Ga0207675_100106512
1219 Ga0207683_10000460
1220 Ga0207683_10001670
1221 Ga0207683_10099462
1222 Ga0207698_10000008
1223 Ga0207698_10101694
1224 Ga0207698_10300883
1225 Ga0207698_10309124
1226 Ga0209588_1011308
1227 Ga0207428_10138319
1228 Ga0265354_1000021
1229 Ga0265354_1001873
1230 Ga0268266_10000153
1231 Ga0268266_10002191
1232 Ga0268266_10013979
1233 Ga0268266_10055676
1234 Ga0268266_10104266
1235 Ga0268265_10011994
1236 Ga0268265_10299912
1237 Ga0268264_10000669
1238 Ga0268264_10001226
1239 Ga0268264_10045316
1240 Ga0268264_10167702
1241 Ga0268264_10248502
1242 Ga0265338_10052974
1243 Ga0265338_10180950
1244 Ga0265770_1001287
1245 Ga0265770_1003233
1246 Ga0265765_1003655
1247 Ga0265339_10005498
1248 Ga0265331_10128639
1249 Ga0265316_10041336
1250 Ga0265313_10008888
1251 Ga0265314_10007163
1252 Ga0265342_10030322
1253 Ga0307416_100123614
1254 Ga0316212_1001185
1255 Ga0373926_0000636
1256 Ga0373934_0000710
1257 Ga0373953_0082393
1258 Ga0373954_0007118
1259 Ga0373956_0009696
1260 Ga0373956_0018682
1261 Ga0373946_0001883
1262 Ga0373955_0005463
1263 Ga0373955_0054539
1264 Ga0373955_0076666
1265 Ga0373961_0026879
1266 Ga0373924_0011060
1267 Ga0373931_0008198
1268 Ga0373931_0045338
1269 Ga0373935_0159403
1270 Ga0373927_0000782
1271 Ga0373933_0009110
1272 Ga0373933_0039687
1273 Ga0373947_0017268
1274 Ga0373947_0073749
1275 Ga0373937_0000349
1276 Ga0373937_0096703
1277 Ga0373937_0097787
1278 Ga0373925_0000717
1279 Ga0373925_0021689
1280 Ga0373925_0243120
1281 Ga0395905_0007860
1282 Ga0395905_0094350
1283 Ga0436365_0235218
1284 Ga0436365_0693404
1285 Ga0436365_1172964
1286 Ga0436363_0124748
1287 Ga0436363_1479800
1288 Ga0436362_0984254
1289 Ga0451577_0033406
1290 Ga0451577_0202079
1291 Ga0453683_0028024
1292 Ga0466963_0031125
1293 Ga0451576_0234056
1294 Ga0466967_0143575
1295 Ga0466967_0420615
1296 Ga0495603_0001224
1297 Ga0495603_0015962
1298 Ga0495629_0013388
1299 Ga0495629_0030616
1300 Ga0495629_0036209
1301 Ga0495629_0140932
1302 Ga0495629_0184823
1303 Ga0495641_0013483
1304 Ga0495641_0018646
1305 Ga0495651_0023136
1306 Ga0495651_0323015
1307 Ga0495653_0156588
1308 Ga0495580_0001359
1309 Ga0495580_0021567
1310 Ga0495580_0039037
1311 Ga0495580_0142280
1312 Ga0495582_0000382
1313 Ga0495582_0042520
1314 Ga0495582_0061327
1315 Ga0495639_0001243
1316 Ga0495639_0097343
1317 Ga0495662_0031837
1318 Ga0495664_0006870
1319 Ga0495664_0095376
1320 Ga0495585_0056531
1321 Ga0495594_0001319
1322 Ga0495594_0001600
1323 Ga0495594_0003442
1324 Ga0495583_0040172
1325 Ga0495606_0031487
1326 Ga0495606_0144380
1327 Ga0495616_0037220
1328 Ga0495630_0012090
1329 Ga0495666_0021800
1330 Ga0495665_0004658
1331 Ga0495665_0029902
1332 Ga0495640_0005257
1333 Ga0495640_0017251
1334 Ga0495586_0003873
1335 Ga0495587_0041029
1336 Ga0495587_0118461
1337 Ga0495609_0033809
1338 Ga0495645_0016995
1339 Ga0495645_0040549
1340 Ga0495645_0128538
1341 Ga0495645_0150100
1342 Ga0495622_0012938
1343 Ga0495667_0026544
1344 Ga0495667_0038489
1345 Ga0495634_0032295
1346 Ga0495625_0039657
1347 Ga0495635_0117040
1348 Ga0495635_0210844
1349 Ga0495635_0249144
1350 Ga0495588_0081695
1351 Ga0495657_0108859
1352 Ga0495623_0052314
1353 Ga0495647_0003725
1354 Ga0495669_0001925
1355 Ga0495669_0002169
1356 Ga0495669_0012854
1357 Ga0495613_0004084
1358 Ga0495613_0027378
1359 Ga0495613_0062387
1360 Ga0495624_0051285
1361 Ga0495670_0041221
1362 Ga0495671_0102202
1363 Ga0495600_0006833
1364 Ga0495600_0019628
1365 Ga0495581_0013471
1366 Ga0495581_0038031
1367 Ga0495604_0001770
1368 Ga0495604_0029105
1369 Ga0495674_0009174
1370 Ga0495674_0035705
1371 Ga0495674_0036725
1372 Ga0495676_0001777
1373 Ga0495676_0007774
1374 Ga0495675_0021825
1375 Ga0495684_0011951
1376 Ga0495684_0060732
1377 Ga0495593_0040756
1378 Ga0495602_0013387
1379 Ga0495614_0007434
1380 Ga0495614_0021477
1381 Ga0496101_0081230
1382 Ga0496102_0003513
1383 Ga0496102_0004269
1384 Ga0496103_0015318
1385 Ga0496104_0210221
1386 Ga0496104_0217841
1387 Ga0496105_0048746
1388 Ga0496105_0059250
1389 Ga0496106_0070980
1390 Ga0496107_0010356
1391 Ga0496108_0000095
1392 Ga0496108_0113319
1393 Ga0496109_0000126
1394 Ga0496109_0000410
1395 Ga0496110_0002871
1396 Ga0496111_0007966
1397 Ga0496112_0000615
1398 Ga0496112_0005230
1399 Ga0496112_0017844
1400 Ga0496112_0309642
1401 Ga0496113_0003748
1402 Ga0496113_0357896
1403 Ga0496114_0022761
1404 Ga0496114_0030844
1405 Ga0496114_0238661
1406 Ga0496115_0006563
1407 Ga0496115_0009132
1408 Ga0496115_0045376
1409 Ga0501073_0012134
1410 Ga0501080_0001025
1411 Ga0501081_0147021
1412 nmdc:mga05p37_22163_c1
1413 nmdc:mga06r32_217866_c1
1414 nmdc:mga06r32_299693_c1
1415 nmdc:mga06r32_367438_c1
1416 nmdc:mga06r32_9974_c1
1417 nmdc:mga08y16_35772_c1
1418 nmdc:mga0n895_100917_c1
1419 nmdc:mga0n895_51073_c1
1420 nmdc:mga0n895_907_c1
1421 nmdc:mga0rr50_10588_c1
1422 nmdc:mga0rr50_275741_c1
1423 nmdc:mga0rr50_49268_c1
1424 nmdc:mga0rr50_64144_c1
1425 nmdc:mga08x19_146_c1
1426 nmdc:mga08x19_2567_c1
1427 nmdc:mga08x19_57650_c1
1428 nmdc:mga08x19_6583_c1
1429 nmdc:mga08x19_689_c1
1430 nmdc:mga0a205_141703_c1
1431 nmdc:mga0a205_37552_c1
1432 nmdc:mga0a205_46298_c1
1433 Ga0495619_0015727
1434 Ga0501084_0018572
1435 Ga0501084_0089633
1436 Ga0501082_0131148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9546 3 222
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9442 1 216
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.933 1 222
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9326 1 216
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.929 4 223
ID Description Score Start End Superfamily
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.966 4 224 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9636 2 220 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9595 2 221 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9552 1 221 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9547 4 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D2QAU4-F1-model_v4 ABC transporter ATP-binding protein 0.9789 3 153 GO:0005524
GO:0016887
AF-A0A358GWI5-F1-model_v4 deleted 0.9727 2 224
AF-A0A7Y8LYW3-F1-model_v4 ABC transporter ATP-binding protein 0.9715 2 181 GO:0005524
GO:0016887
AF-Q8VR06-F1-model_v4 Putative ABC transporter protein 0.971 81 222 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9684 1 183 GO:0005524
GO:0016887

Map