F477188

General Info

Members Datasets Scaffolds Average Seq Length
718 563 1436 152

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0000130|Ga0495654_0000130_32016_32558
Length 180
Sequence MTRKQKRLAVIAGGMSFIIVAVFLVMFAFSQSVAYFFMPGDIAAANLQPGTRIRLGGLVEQGSVRRGQGSTVSFSVTDGKATVPVSYTGILPDLFREGQGVVTEGAFDAASHGFVADSVLAKHDENYMPKEVADRLKKDGVWEDGSGKGMAPAQDKAKAKGADGAEKTTEKDQVVGSTKP

Samples

Sample ID Description Type Environment
1 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
80 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
81 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
82 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
152 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
232 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
233 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
238 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
242 2509276019 Ensifer aridi TW10 Isolate Nodule
243 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
244 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
245 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
246 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
247 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
248 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
249 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
250 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
251 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
252 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
253 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
254 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
255 2516143018 Ensifer sp. BR816 Isolate Nodule
256 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
257 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
258 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
259 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
260 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
261 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
262 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
263 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
264 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
265 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
266 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
267 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
268 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
269 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
270 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
271 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
272 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
273 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
274 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
275 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
276 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
277 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
278 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
279 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
280 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
281 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
282 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
283 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
284 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
285 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
286 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
287 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
288 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
289 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
290 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
291 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
292 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
293 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
294 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
295 2643221557 Ensifer sp. Root558 Isolate Unclassified
296 2643221568 Rhizobium sp. Root564 Isolate Unclassified
297 2643221582 Rhizobium sp. Root651 Isolate Unclassified
298 2643221607 Rhizobium sp. Root73 Isolate Unclassified
299 2643221610 Ensifer sp. Root74 Isolate Unclassified
300 2643221618 Ensifer sp. Root231 Isolate Unclassified
301 2643221626 Ensifer sp. Root31 Isolate Unclassified
302 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
303 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
304 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
305 2643221655 Ensifer sp. Root1252 Isolate Unclassified
306 2643221659 Ensifer sp. Root127 Isolate Unclassified
307 2643221668 Ensifer sp. Root423 Isolate Unclassified
308 2643221675 Ensifer sp. Root1298 Isolate Unclassified
309 2643221680 Ensifer sp. Root1312 Isolate Unclassified
310 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
311 2643221688 Rhizobium sp. Root482 Isolate Unclassified
312 2643221693 Rhizobium sp. Root491 Isolate Unclassified
313 2643221698 Ensifer sp. Root142 Isolate Unclassified
314 2643221712 Ensifer sp. Root258 Isolate Unclassified
315 2643221718 Rhizobium sp. Root268 Isolate Unclassified
316 2643221719 Rhizobium sp. Root274 Isolate Unclassified
317 2643221723 Ensifer sp. Root278 Isolate Unclassified
318 2643221726 Ensifer sp. Root954 Isolate Unclassified
319 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
320 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
321 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
322 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
323 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
324 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
325 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
326 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
327 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
328 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
329 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
330 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
331 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
332 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
333 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
334 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
335 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
336 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
337 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
338 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
339 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
340 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
341 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
342 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
343 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
344 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
345 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
346 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
347 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
348 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
349 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
350 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
351 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
352 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
353 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
354 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
355 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
356 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
357 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
358 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
359 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
360 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
361 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
362 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
363 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
364 2844163670 Ensifer sp. 1H6 Isolate Unclassified
365 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
366 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
367 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
368 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
369 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
370 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
371 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
372 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
373 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
374 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
375 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
376 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
377 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
378 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
379 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
380 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
381 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
382 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
383 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
384 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
385 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
386 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
387 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
388 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
389 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
390 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
391 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
392 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
393 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
394 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
395 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
396 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
397 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
398 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
399 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
400 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
401 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
402 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
403 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
404 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
405 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
406 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
407 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
408 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
409 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
410 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
411 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
412 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
413 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
414 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
415 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
416 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
417 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
418 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
419 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
420 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
421 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
422 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
423 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
424 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
425 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
426 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
427 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
428 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
429 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
430 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
431 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
432 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
433 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
434 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
435 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
436 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
437 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
438 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
439 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
440 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
441 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
442 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
443 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
444 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
445 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
446 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
447 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
448 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
449 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
450 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
451 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
452 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
453 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
454 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
455 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
456 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
457 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
458 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
459 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
460 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
461 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
462 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
463 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
464 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
465 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
466 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
467 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
468 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
469 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
470 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
471 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
472 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
473 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
474 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
475 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
476 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
477 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
478 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
479 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
480 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
481 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
482 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
483 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
484 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
485 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
486 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
487 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
488 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
489 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
490 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
491 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
492 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
493 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
494 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
495 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
496 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
497 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
498 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
499 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
500 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
501 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
502 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
503 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
504 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
505 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
506 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
507 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
508 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
509 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
510 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
511 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
512 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
513 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
514 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
515 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
516 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
517 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
518 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
519 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
520 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
521 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
522 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
523 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
524 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
525 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
526 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
527 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
528 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
529 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
530 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
531 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
532 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
533 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
534 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
535 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
536 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
537 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
538 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
539 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
540 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
541 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
542 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
543 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
544 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
545 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
546 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
547 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
548 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
549 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
550 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
551 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
552 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
553 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
554 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
555 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
556 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
557 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
558 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
559 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
560 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
561 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
562 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
563 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.46
Metatranscriptomes 0.28
Isolates 45.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 16.99
Nodule 31.06
Rhizoplane 2.37
Rhizosphere 28.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495654_0000130 3300046530 Bacteria 81643
2 JGI24740J21852_10001706 3300001979 Bacteria 10085
3 JGI25162J39368_1000243 3300002737 Bacteria 54503
4 JGI25162J39368_1000372 3300002737 Bacteria 38119
5 JGI25154J39366_1025527 3300002738 Bacteria 538
6 JGI25159J45721_1000001 3300002987 Bacteria 303489
7 JGI25159J45721_1007076 3300002987 Bacteria 3268
8 JGI25151J46595_10014402 3300003187 Bacteria 3524
9 JGI25151J46595_10036328 3300003187 Bacteria 1860
10 JGI25165J46597_1000318 3300003214 Bacteria 57977
11 JGI25165J46597_1000413 3300003214 Bacteria 44960
12 rootH2_10088068 3300003320 Bacteria 2927
13 rootL2_10004432 3300003322 Bacteria 5832
14 rootL2_10004433 3300003322 Bacteria 1005
15 rootH1_10018310 3300003323 Bacteria 3819
16 rootH1_10066496 3300003323 Bacteria 4032
17 JGI25160J50197_1000002 3300003354 Bacteria 561707
18 JGI25160J50197_1011762 3300003354 Bacteria 3077
19 JGI25161J50226_1000742 3300003374 Bacteria 12536
20 JGI25161J50226_1004189 3300003374 Bacteria 3077
21 Ga0055526_1000805 3300003771 Bacteria 23389
22 Ga0055524_1046411 3300003775 Bacteria 1033
23 Ga0055536_1000427 3300003781 Bacteria 30054
24 Ga0055536_1002131 3300003781 Bacteria 11268
25 Ga0055530_10004975 3300003791 Bacteria 6570
26 Ga0055540_1003388 3300003792 Bacteria 7725
27 Ga0055540_1022338 3300003792 Bacteria 1621
28 Ga0055531_10003223 3300003794 Bacteria 10465
29 Ga0055531_10019032 3300003794 Bacteria 2802
30 Ga0055543_1005842 3300004625 Bacteria 3077
31 Ga0055543_1008229 3300004625 Bacteria 2324
32 Ga0065165_1000004 3300005262 Bacteria 377081
33 Ga0065165_1006277 3300005262 Bacteria 6303
34 Ga0065165_1015306 3300005262 Bacteria 2930
35 Ga0070676_10118877 3300005328 Bacteria 1656
36 Ga0070683_100689029 3300005329 Bacteria 978
37 Ga0070680_100008482 3300005336 Bacteria 7869
38 Ga0070680_100062152 3300005336 Bacteria 3058
39 Ga0070660_100085737 3300005339 Bacteria 2477
40 Ga0070661_100169973 3300005344 Bacteria 1655
41 Ga0070668_100486269 3300005347 Bacteria 1067
42 Ga0070669_100054894 3300005353 Bacteria 2919
43 Ga0070659_100032152 3300005366 Bacteria 4068
44 Ga0070659_101147645 3300005366 Bacteria 686
45 Ga0070714_100024490 3300005435 Bacteria 4972
46 Ga0070710_10389396 3300005437 Bacteria 931
47 Ga0070711_100518830 3300005439 Bacteria 984
48 Ga0070711_100747284 3300005439 Bacteria 826
49 Ga0070679_100248409 3300005530 Bacteria 1735
50 Ga0070684_100194099 3300005535 Bacteria 1848
51 Ga0068853_100003501 3300005539 Bacteria 12013
52 Ga0068853_100199143 3300005539 Bacteria 1822
53 Ga0068853_100337428 3300005539 Bacteria 1400
54 Ga0070693_100290156 3300005547 Bacteria 1099
55 Ga0070665_100134095 3300005548 Bacteria 2478
56 Ga0070665_100184170 3300005548 Bacteria 2089
57 Ga0070665_100402121 3300005548 Bacteria 1378
58 Ga0068855_100019140 3300005563 Bacteria 8227
59 Ga0068855_100517370 3300005563 Bacteria 1295
60 Ga0068855_102238740 3300005563 Bacteria 548
61 Ga0070664_101407448 3300005564 Bacteria 659
62 Ga0068857_100099392 3300005577 Bacteria 2610
63 Ga0068854_100055705 3300005578 Bacteria 2848
64 Ga0068854_100289276 3300005578 Bacteria 1322
65 Ga0068854_100394108 3300005578 Bacteria 1144
66 Ga0068856_100046878 3300005614 Bacteria 4257
67 Ga0068852_100014111 3300005616 Bacteria 6135
68 Ga0068852_100216600 3300005616 Bacteria 1819
69 Ga0068851_10103600 3300005834 Bacteria 1512
70 Ga0081455_10512935 3300005937 Bacteria 802
71 Ga0081539_10273761 3300005985 Bacteria 738
72 Ga0075365_10000488 3300006038 Bacteria 15084
73 Ga0075368_10003865 3300006042 Bacteria 5040
74 Ga0075363_100054797 3300006048 Bacteria 2134
75 Ga0075364_10057050 3300006051 Bacteria 2557
76 Ga0075364_10295213 3300006051 Bacteria 1103
77 Ga0070712_100111918 3300006175 Bacteria 2039
78 Ga0070712_100533098 3300006175 Bacteria 987
79 Ga0075362_10001934 3300006177 Bacteria 6808
80 Ga0075367_10028701 3300006178 Bacteria 3176
81 Ga0075367_10296427 3300006178 Bacteria 1018
82 Ga0075369_10015858 3300006186 Bacteria 3031
83 Ga0075369_10040475 3300006186 Bacteria 1992
84 Ga0075369_10309731 3300006186 Bacteria 738
85 Ga0075370_10033815 3300006353 Bacteria 2864
86 Ga0075370_10249191 3300006353 Bacteria 1052
87 Ga0075431_100034414 3300006847 Bacteria 5219
88 Ga0068865_100341634 3300006881 Bacteria 1210
89 Ga0075436_100032738 3300006914 Bacteria 3583
90 Ga0079104_1000010 3300006946 Bacteria 366021
91 Ga0099826_10000030 3300006948 Bacteria 128684
92 Ga0099826_10005897 3300006948 Bacteria 8850
93 Ga0105240_10000027 3300009093 Bacteria 348486
94 Ga0114129_10048144 3300009147 Bacteria 5990
95 Ga0105243_10003211 3300009148 Bacteria 13374
96 Ga0105243_10325071 3300009148 Bacteria 1403
97 Ga0105242_10267060 3300009176 Bacteria 1548
98 Ga0105248_10284786 3300009177 Bacteria 1861
99 Ga0105237_10006371 3300009545 Bacteria 13105
100 Ga0105238_10916640 3300009551 Bacteria 895
101 Ga0105033_107133 3300009986 Bacteria 969
102 Ga0105239_10031150 3300010375 Bacteria 5868
103 Ga0105239_10847388 3300010375 Bacteria 1048
104 Ga0105239_11284261 3300010375 Bacteria 844
105 Ga0157373_10037216 3300013100 Bacteria 3489
106 Ga0157373_10554686 3300013100 Bacteria 833
107 Ga0157371_10000307 3300013102 Bacteria 63760
108 Ga0157371_10194006 3300013102 Bacteria 1455
109 Ga0157370_10000223 3300013104 Bacteria 72025
110 Ga0157370_10000577 3300013104 Bacteria 45697
111 Ga0157370_10164829 3300013104 Bacteria 2061
112 Ga0157369_10306780 3300013105 Bacteria 1651
113 Ga0157369_10442725 3300013105 Bacteria 1346
114 Ga0171463_1001 3300013249 Bacteria 1406070
115 Ga0157378_12629022 3300013297 Bacteria 556
116 Ga0157372_10092379 3300013307 Bacteria 3443
117 Ga0157380_10517191 3300014326 Bacteria 1163
118 Ga0182007_10000805 3300015262 Bacteria 17521
119 Ga0182005_1001955 3300015265 Bacteria 7751
120 Ga0183363_1305 3300015690 Bacteria 6838
121 Ga0214542_1000010 3300021321 Bacteria 262816
122 Ga0214543_1000003 3300021327 Bacteria 692327
123 Ga0214543_1000004 3300021327 Bacteria 527190
124 Ga0209435_100036 3300025206 Bacteria 126970
125 Ga0209435_106982 3300025206 Bacteria 1252
126 Ga0209760_101252 3300025207 Bacteria 2813
127 Ga0209436_103777 3300025208 Bacteria 3914
128 Ga0209436_104773 3300025208 Bacteria 3273
129 Ga0207427_117028 3300025231 Bacteria 675
130 Ga0209437_100033 3300025233 Bacteria 512520
131 Ga0209437_100036 3300025233 Bacteria 469153
132 Ga0209646_1000132 3300025246 Bacteria 126859
133 Ga0209646_1013311 3300025246 Bacteria 1252
134 Ga0209646_1045463 3300025246 Bacteria 538
135 Ga0209026_1015454 3300025250 Bacteria 1252
136 Ga0209677_100419 3300025253 Bacteria 25164
137 Ga0209148_1038824 3300025254 Bacteria 668
138 Ga0209759_1025591 3300025256 Bacteria 1252
139 Ga0209233_1000056 3300025261 Bacteria 438104
140 Ga0209233_1000064 3300025261 Bacteria 392156
141 Ga0209233_1000152 3300025261 Bacteria 175910
142 Ga0209565_1046264 3300025263 Bacteria 794
143 Ga0209130_1000008 3300025284 Bacteria 581232
144 Ga0209130_1006133 3300025284 Bacteria 3970
145 Ga0209676_1000885 3300025292 Bacteria 38361
146 Ga0209676_1032958 3300025292 Bacteria 1550
147 Ga0209025_1000074 3300025294 Bacteria 277445
148 Ga0209025_1000080 3300025294 Bacteria 267244
149 Ga0209025_1000100 3300025294 Bacteria 229182
150 Ga0209025_1063801 3300025294 Bacteria 1357
151 Ga0209025_1085903 3300025294 Bacteria 1048
152 Ga0209564_1000104 3300025295 Bacteria 219017
153 Ga0209758_1000121 3300025297 Bacteria 192028
154 Ga0209758_1053900 3300025297 Bacteria 1378
155 Ga0209758_1101417 3300025297 Bacteria 818
156 Ga0209050_1001263 3300025298 Bacteria 29191
157 Ga0209050_1002888 3300025298 Bacteria 13567
158 Ga0209256_1001494 3300025299 Bacteria 23770
159 Ga0207426_1000016 3300025302 Bacteria 581232
160 Ga0207426_1012037 3300025302 Bacteria 3268
161 Ga0209051_1000918 3300025303 Bacteria 29277
162 Ga0209051_1001239 3300025303 Bacteria 22894
163 Ga0209051_1137631 3300025303 Bacteria 592
164 Ga0209257_1005831 3300025304 Bacteria 8356
165 Ga0209257_1032555 3300025304 Bacteria 1651
166 Ga0209257_1032558 3300025304 Bacteria 1651
167 Ga0207645_10079055 3300025907 Bacteria 2108
168 Ga0207707_10379544 3300025912 Bacteria 1215
169 Ga0207695_10000024 3300025913 Bacteria 632311
170 Ga0207695_10836915 3300025913 Bacteria 800
171 Ga0207671_10000986 3300025914 Bacteria 35178
172 Ga0207693_10012816 3300025915 Bacteria 6764
173 Ga0207693_10071773 3300025915 Bacteria 2711
174 Ga0207663_10158114 3300025916 Bacteria 1597
175 Ga0207660_10019044 3300025917 Bacteria 4585
176 Ga0207660_10041434 3300025917 Bacteria 3227
177 Ga0207657_10163197 3300025919 Bacteria 1809
178 Ga0207649_10194352 3300025920 Bacteria 1429
179 Ga0207652_10175794 3300025921 Bacteria 1923
180 Ga0207681_10147047 3300025923 Bacteria 1762
181 Ga0207681_10387676 3300025923 Bacteria 1126
182 Ga0207650_10000567 3300025925 Bacteria 30017
183 Ga0207664_10219165 3300025929 Bacteria 1649
184 Ga0207690_11084353 3300025932 Bacteria 667
185 Ga0207686_10281055 3300025934 Bacteria 1229
186 Ga0207709_10134080 3300025935 Bacteria 1692
187 Ga0207711_10192203 3300025941 Bacteria 1861
188 Ga0207689_10186811 3300025942 Bacteria 1709
189 Ga0207661_10058969 3300025944 Bacteria 3092
190 Ga0207667_10096670 3300025949 Bacteria 3048
191 Ga0207667_10163651 3300025949 Bacteria 2287
192 Ga0207667_10241500 3300025949 Bacteria 1848
193 Ga0207667_11950947 3300025949 Bacteria 548
194 Ga0207640_10068813 3300025981 Bacteria 2374
195 Ga0207640_10116982 3300025981 Bacteria 1902
196 Ga0207658_11134507 3300025986 Bacteria 714
197 Ga0207639_10189792 3300026041 Bacteria 1754
198 Ga0207702_10425191 3300026078 Bacteria 1285
199 Ga0207702_10501763 3300026078 Bacteria 1183
200 Ga0207698_10159815 3300026142 Bacteria 1969
201 Ga0209281_1000053 3300027111 Bacteria 309587
202 Ga0209281_1000377 3300027111 Bacteria 71243
203 Ga0209371_1000009 3300027312 Bacteria 963030
204 Ga0209371_1001001 3300027312 Bacteria 21687
205 Ga0209371_1007294 3300027312 Bacteria 3880
206 Ga0209282_1001844 3300027666 Bacteria 11920
207 Ga0209813_10010599 3300027866 Bacteria 2388
208 Ga0268266_10077344 3300028379 Bacteria 2893
209 Ga0268266_10151057 3300028379 Bacteria 2093
210 Ga0268266_10518792 3300028379 Bacteria 1139
211 Ga0268266_10755119 3300028379 Bacteria 939
212 Ga0307515_10002710 3300028794 Bacteria 37898
213 Ga0265338_10383584 3300028800 Bacteria 1005
214 Ga0268256_1000010 3300030500 Bacteria 963034
215 Ga0268256_1008343 3300030500 Bacteria 3560
216 Ga0268256_1026173 3300030500 Bacteria 1470
217 Ga0265325_10032431 3300031241 Bacteria 2789
218 Ga0265339_10160866 3300031249 Bacteria 1130
219 Ga0307408_100335795 3300031548 Bacteria 1278
220 Ga0307408_100710404 3300031548 Bacteria 904
221 Ga0307408_100863603 3300031548 Bacteria 826
222 Ga0307508_10408162 3300031616 Bacteria 950
223 Ga0265314_10002263 3300031711 Bacteria 19929
224 Ga0307405_10057233 3300031731 Bacteria 2449
225 Ga0307405_10153351 3300031731 Bacteria 1623
226 Ga0307413_10730087 3300031824 Bacteria 826
227 Ga0307406_10012978 3300031901 Bacteria 4762
228 Ga0307412_10223405 3300031911 Bacteria 1445
229 Ga0307416_102248550 3300032002 Bacteria 646
230 Ga0307414_10218475 3300032004 Bacteria 1563
231 Ga0307414_10488251 3300032004 Bacteria 1087
232 Ga0307414_10927605 3300032004 Bacteria 799
233 Ga0373939_0001378 3300035114 Bacteria 5884
234 Ga0373933_0282428 3300035724 Bacteria 1073
235 Ga0400485_00599 3300038735 Bacteria 2466
236 Ga0400488_43485 3300038741 Bacteria 1268
237 Ga0400486_12542 3300038742 Bacteria 1110
238 Ga0439436_0002969 3300041404 Bacteria 5142
239 Ga0439436_0081436 3300041404 Bacteria 901
240 Ga0439438_029569 3300041405 Bacteria 1466
241 Ga0439438_130062 3300041405 Bacteria 604
242 Ga0439466_0090180 3300041411 Bacteria 961
243 Ga0439466_0138362 3300041411 Bacteria 748
244 Ga0439465_0042221 3300041413 Bacteria 1477
245 Ga0451839_0390476 3300041496 Bacteria 529
246 Ga0451851_0457214 3300041507 Bacteria 696
247 Ga0439433_0086967 3300041999 Bacteria 765
248 Ga0439445_0102546 3300042004 Bacteria 812
249 Ga0439449_0009869 3300042007 Bacteria 3611
250 Ga0439449_0038896 3300042007 Bacteria 1768
251 Ga0439462_0009200 3300042015 Bacteria 2498
252 Ga0450920_006043 3300042122 Bacteria 2167
253 Ga0439458_0026517 3300042157 Bacteria 1364
254 Ga0450909_015526 3300042185 Bacteria 1124
255 Ga0439434_0167943 3300042435 Bacteria 731
256 Ga0495606_0005820 3300046507 Bacteria 11630
257 Ga0495643_0057328 3300046522 Bacteria 2076
258 Ga0495648_0242839 3300046524 Bacteria 874
259 Ga0495654_0117822 3300046530 Bacteria 1205
260 Ga0495633_0037945 3300046558 Bacteria 2303
261 Ga0495588_0000397 3300046674 Bacteria 24653
262 Ga0495681_0011685 3300047470 Bacteria 5210
263 Ga0495686_0000613 3300047472 Bacteria 49253
264 Ga0496102_0011682 3300048905 Bacteria 7581
265 Ga0496103_0008622 3300048906 Bacteria 6055
266 Ga0496104_0110009 3300048907 Bacteria 2641
267 Ga0496106_0135684 3300048909 Bacteria 1932
268 Ga0496110_0140994 3300048913 Bacteria 2179
269 Ga0496111_0005007 3300048914 Bacteria 8430
270 Ga0496111_0153817 3300048914 Bacteria 1707
271 Ga0496111_0440266 3300048914 Bacteria 962
272 Ga0496112_1072320 3300048915 Bacteria 724
273 Ga0496113_0016544 3300048916 Bacteria 5098
274 Ga0496115_0113228 3300048918 Bacteria 2229
275 Ga0496116_0000036 3300048919 Bacteria 388508
276 Ga0496116_0028892 3300048919 Bacteria 4009
277 Ga0496116_0030413 3300048919 Bacteria 3879
278 Ga0496116_0122294 3300048919 Bacteria 1503
279 Ga0496117_0000002 3300048920 Bacteria 2483758
280 Ga0496117_0006286 3300048920 Bacteria 12091
281 Ga0496117_0034950 3300048920 Bacteria 3780
282 Ga0496118_0000084 3300048921 Bacteria 181733
283 Ga0496118_0000396 3300048921 Bacteria 73830
284 Ga0496118_0037022 3300048921 Bacteria 3934
285 Ga0496119_0015105 3300048922 Bacteria 5976
286 Ga0496119_0027835 3300048922 Bacteria 3872
287 Ga0496119_0073005 3300048922 Bacteria 2002
288 Ga0496119_0131286 3300048922 Bacteria 1365
289 Ga0496120_0000087 3300048923 Bacteria 152857
290 Ga0496120_0052565 3300048923 Bacteria 2319
291 Ga0496120_0422386 3300048923 Bacteria 585
292 Ga0496121_0000001 3300048924 Bacteria 1830318
293 Ga0496121_0001010 3300048924 Bacteria 50285
294 Ga0496121_0001141 3300048924 Bacteria 46594
295 Ga0496121_0025166 3300048924 Bacteria 5661
296 Ga0496121_0064478 3300048924 Bacteria 2987
297 Ga0496121_0110909 3300048924 Bacteria 2093
298 Ga0496121_0297016 3300048924 Bacteria 1098
299 Ga0496122_0000001 3300048925 Bacteria 1827766
300 Ga0496122_0000009 3300048925 Bacteria 584024
301 Ga0496122_0000106 3300048925 Bacteria 193672
302 Ga0496122_0013058 3300048925 Bacteria 8180
303 Ga0496122_0015206 3300048925 Bacteria 7367
304 Ga0496122_0052205 3300048925 Bacteria 3097
305 Ga0496122_0067194 3300048925 Bacteria 2584
306 Ga0496122_0095049 3300048925 Bacteria 2015
307 Ga0496122_0239159 3300048925 Bacteria 1025
308 Ga0496123_0000001 3300048926 Bacteria 1831497
309 Ga0496123_0007453 3300048926 Bacteria 10298
310 Ga0496123_0007860 3300048926 Bacteria 9917
311 Ga0496123_0057243 3300048926 Bacteria 2539
312 Ga0496123_0161009 3300048926 Bacteria 1196
313 Ga0496124_0000133 3300048927 Bacteria 154328
314 Ga0496124_0017643 3300048927 Bacteria 6720
315 Ga0496124_0030507 3300048927 Bacteria 4785
316 Ga0496124_0030549 3300048927 Bacteria 4780
317 Ga0496124_0052164 3300048927 Bacteria 3476
318 Ga0496124_0210195 3300048927 Bacteria 1473
319 Ga0496124_0212805 3300048927 Bacteria 1461
320 Ga0496124_0480062 3300048927 Bacteria 839
321 Ga0496124_0605693 3300048927 Bacteria 711
322 Ga0496125_0000001 3300048928 Bacteria 1766138
323 Ga0496125_0007816 3300048928 Bacteria 11305
324 Ga0496125_0012245 3300048928 Bacteria 8532
325 Ga0496125_0062106 3300048928 Bacteria 2990
326 Ga0496126_0001111 3300048929 Bacteria 45099
327 Ga0496126_0076529 3300048929 Bacteria 2968
328 Ga0496126_0271404 3300048929 Bacteria 1407
329 Ga0496126_0766130 3300048929 Bacteria 744
330 Ga0501032_0443016 3300049569 Bacteria 832
331 Ga0501033_0000038 3300049570 Bacteria 144438
332 Ga0501073_0050372 3300049589 Bacteria 2918
333 Ga0501073_0566135 3300049589 Bacteria 785
334 Ga0501074_0579567 3300049590 Bacteria 794
335 Ga0501238_009603 3300049671 Bacteria 1284
336 Ga0501079_1033732 3300049741 Bacteria 647
337 Ga0501080_0327946 3300049742 Bacteria 1385
338 Ga0501280_002457 3300049776 Bacteria 3081
339 Ga0501280_021713 3300049776 Bacteria 959
340 Ga0501035_0000326 3300049822 Bacteria 55174
341 Ga0501044_0374382 3300049823 Bacteria 1340
342 nmdc:mga03n38_9588_c1 3300050490 Bacteria 3529
343 nmdc:mga00v17_244489_c1 3300050491 Bacteria 1164
344 nmdc:mga00v17_325606_c1 3300050491 Bacteria 998
345 nmdc:mga00v17_52_c1 3300050491 Bacteria 72738
346 nmdc:mga0yw44_36498_c1 3300050492 Bacteria 2896
347 nmdc:mga0yw44_36786_c1 3300050492 Bacteria 2887
348 nmdc:mga0k408_87799_c1 3300050493 Bacteria 1827
349 nmdc:mga06z11_308360_c1 3300050494 Bacteria 942
350 nmdc:mga07m45_208570_c1 3300050496 Bacteria 1137
351 nmdc:mga06r32_33896_c1 3300050510 Bacteria 4812
352 nmdc:mga08x19_121754_c1 3300050514 Bacteria 1749
353 nmdc:mga0sz30_1906_c1 3300050516 Bacteria 7447
354 nmdc:mga0sz30_70596_c1 3300050516 Bacteria 1503
355 Ga0495619_0057278 3300053085 Bacteria 2586
356 Ga0500643_004960 3300053087 Bacteria 5853
357 Ga0500644_0000781 3300053088 Bacteria 10867
358 Ga0500646_0044020 3300053090 Bacteria 1266
359 Ga0500651_0214340 3300053093 Bacteria 1131
360 Ga0500566_0012016 3300053094 Bacteria 5099
361 Ga0500560_000501 3300053107 Bacteria 5485
362 Ga0500569_013863 3300053109 Bacteria 1984
363 Ga0500572_000194 3300053111 Bacteria 21418
364 Ga0500595_000002 3300053119 Bacteria 1074388
365 Ga0500595_055022 3300053119 Bacteria 1219
366 Ga0500607_045137 3300053121 Bacteria 2367
367 Ga0500608_006049 3300053122 Bacteria 4882
368 Ga0500614_090431 3300053123 Bacteria 869
369 Ga0500618_000055 3300053125 Bacteria 99876
370 Ga0500618_000945 3300053125 Bacteria 14881
371 Ga0500652_000062 3300053131 Bacteria 47514
372 Ga0500652_013374 3300053131 Bacteria 2904
373 Ga0500559_0000979 3300053136 Bacteria 17809
374 Ga0500559_0007920 3300053136 Bacteria 4685
375 Ga0500573_0000780 3300053140 Bacteria 14326
376 Ga0500573_0089940 3300053140 Bacteria 1735
377 Ga0500616_0000002 3300053153 Bacteria 1611257
378 Ga0500616_0002928 3300053153 Bacteria 13602
379 Ga0500616_0206442 3300053153 Bacteria 866
380 Ga0500624_001959 3300053157 Bacteria 2939
381 Ga0500624_047045 3300053157 Bacteria 793
382 Ga0500634_0002869 3300053161 Bacteria 7461
383 Ga0500634_0023083 3300053161 Bacteria 3381
384 Ga0500639_009890 3300053163 Bacteria 4990
385 Ga0500636_0000004 3300053177 Bacteria 202392
386 Ga0500636_0000820 3300053177 Bacteria 16724
387 Ga0500636_0054912 3300053177 Bacteria 2335
388 Ga0500576_025879 3300053725 Bacteria 2675
389 Ga0500645_000012 3300053730 Bacteria 168579
390 Ga0500565_001313 3300053734 Bacteria 1640
391 Ga0587090_007679 3300059510 Bacteria 1423
392 Ga0587072_014032 3300059643 Bacteria 1346
393 Ga0466962_0027943 3300061719 Bacteria 2704
394 2509107448 2508501122 Bacteria 6292184
395 2509374560 2509276019 Bacteria 6802256
396 2510304479 2510065057 Bacteria 6649661
397 2510842891 2510461069 Bacteria 5505000
398 2511133622 2510917022 Bacteria 6504556
399 2511173684 2510917026 Bacteria 7046020
400 2511500903 2511231052 Bacteria 6974333
401 2512532326 2512047086 Bacteria 6850303
402 2513583559 2513237086 Bacteria 7265287
403 2513617515 2513237091 Bacteria 6900273
404 2513882772 2513237140 Bacteria 7076289
405 2513905316 2513237143 Bacteria 6664116
406 2513999448 2513237159 Bacteria 6810126
407 2515608029 2515154107 Bacteria 6795637
408 2516208783 2516143018 Bacteria 6951533
409 2516892180 2516653046 Bacteria 6989037
410 2524450227 2524023207 Bacteria 6813453
411 2524457900 2524023209 Bacteria 6679728
412 2537874540 2537561587 Bacteria 5425293
413 2551676363 2551306084 Bacteria 8942552
414 2551687470 2551306085 Bacteria 7347181
415 2551693401 2551306086 Bacteria 6843938
416 2551699187 2551306087 Bacteria 7351905
417 2551714775 2551306089 Bacteria 7162724
418 2551719035 2551306090 Bacteria 7953713
419 2551730346 2551306091 Bacteria 7086830
420 2551734581 2551306092 Bacteria 6992595
421 2551745404 2551306093 Bacteria 7064773
422 2554247000 2554235003 Bacteria 5877155
423 2558863589 2558860100 Bacteria 8458965
424 2559294225 2558860242 Bacteria 5568029
425 2585266296 2582581306 Bacteria 6450535
426 2585275766 2582581307 Bacteria 6597605
427 2585278788 2582581308 Bacteria 7413247
428 2585325598 2582581315 Bacteria 7318924
429 2585329753 2582581316 Bacteria 7774528
430 2585387297 2582581865 Bacteria 6644329
431 2585397798 2582581866 Bacteria 6859583
432 2585535898 2585427527 Bacteria 7273426
433 2585554019 2585427530 Bacteria 7383882
434 2585559315 2585427531 Bacteria 6992870
435 2585901219 2585427608 Bacteria 6544331
436 2585905309 2585427609 Bacteria 6667127
437 2585994973 2585427633 Bacteria 6413184
438 2585999516 2585427634 Bacteria 6455027
439 2587979576 2585428125 Bacteria 6662905
440 2599603440 2599185210 Bacteria 5624189
441 2599724201 2599185236 Bacteria 6875203
442 2600191829 2599185352 Bacteria 7228948
443 2601608792 2600255279 Bacteria 5605316
444 2601745566 2600255308 Bacteria 5611129
445 2616305938 2615840626 Bacteria 7921970
446 2616553817 2615840698 Bacteria 7319877
447 2617381936 2617270742 Bacteria 6808054
448 2643807309 2643221557 Bacteria 7184309
449 2643856005 2643221568 Bacteria 5187270
450 2643918596 2643221582 Bacteria 5804683
451 2644046691 2643221607 Bacteria 6314006
452 2644069721 2643221610 Bacteria 7480339
453 2644109100 2643221618 Bacteria 7717186
454 2644151620 2643221626 Bacteria 8069654
455 2644202398 2643221636 Bacteria 6583769
456 2644206313 2643221637 Bacteria 5345260
457 2644296967 2643221653 Bacteria 4569637
458 2644311756 2643221655 Bacteria 7722067
459 2644330027 2643221659 Bacteria 7890716
460 2644380692 2643221668 Bacteria 7306521
461 2644414597 2643221675 Bacteria 7473456
462 2644448254 2643221680 Bacteria 7473610
463 2644479480 2643221686 Bacteria 6310811
464 2644493501 2643221688 Bacteria 5260751
465 2644518859 2643221693 Bacteria 5513853
466 2644543219 2643221698 Bacteria 7756764
467 2644617554 2643221712 Bacteria 7729434
468 2644649961 2643221718 Bacteria 5345506
469 2644655221 2643221719 Bacteria 4568197
470 2644673654 2643221723 Bacteria 7095460
471 2644689439 2643221726 Bacteria 7455827
472 2657682216 2657244999 Bacteria 5946535
473 2671112744 2667528174 Bacteria 6435400
474 2692316922 2690316117 Bacteria 6800650
475 2753458898 2751185821 Bacteria 6189929
476 2776912633 2775507049 Bacteria 6284736
477 2778177347 2775507266 Bacteria 7392367
478 2792584063 2791355082 Bacteria 5973319
479 2792622134 2791355091 Bacteria 6135441
480 2792628301 2791355092 Bacteria 6248105
481 2792638441 2791355094 Bacteria 7011481
482 2804751235 2802429268 Bacteria 6094027
483 2808985999 2808606387 Bacteria 5697198
484 2819242682 2818991272 Bacteria 4622173
485 2819556120 2818991439 Bacteria 6907412
486 2819613631 2818991448 Bacteria 6772224
487 2819639367 2818991453 Bacteria 7181617
488 2819684283 2818991461 Bacteria 7026071
489 2821124130 2821123053 Bacteria 7836056
490 2838031296 2838029111 Bacteria 6603031
491 2838076340 2838074704 Bacteria 6785777
492 2838676847 2838675328 Bacteria 4909118
493 2838715732 2838714209 Bacteria 5525906
494 2838720467 2838719591 Bacteria 5523910
495 2838726487 2838724970 Bacteria 4908691
496 2838738846 2838736955 Bacteria 5760694
497 2841842745 2841840854 Bacteria 5761912
498 2841847397 2841846520 Bacteria 5345850
499 2841860064 2841859092 Bacteria 5436171
500 2842126573 2842124991 Bacteria 5346824
501 2842131740 2842130223 Bacteria 4909145
502 2842142525 2842140634 Bacteria 5759631
503 2842153091 2842152218 Bacteria 4908957
504 2842171976 2842170452 Bacteria 5525737
505 2842176710 2842175837 Bacteria 4908771
506 2842188841 2842187318 Bacteria 5524014
507 2842213153 2842211629 Bacteria 5523832
508 2842225229 2842224351 Bacteria 5524473
509 2842300483 2842298080 Bacteria 6123127
510 2842358399 2842357229 Bacteria 6485165
511 2842478109 2842475841 Bacteria 6603183
512 2842482736 2842482326 Bacteria 7212537
513 2842504918 2842502639 Bacteria 6604161
514 2842509605 2842509118 Bacteria 6850950
515 2842514338 2842509118 Bacteria 6850950
516 2842516849 2842515876 Bacteria 5436280
517 2842525241 2842521101 Bacteria 6569494
518 2844163894 2844163670 Bacteria 7266046
519 2847418009 2847417321 Bacteria 6913799
520 2848992986 2848992105 Bacteria 6810864
521 2850080372 2850079185 Bacteria 6848280
522 2852388945 2852387548 Bacteria 8025568
523 2854898758 2854896431 Bacteria 5869725
524 2854921658 2854916844 Bacteria 5725939
525 2855831254 2855825444 Bacteria 6785811
526 2855840379 2855839649 Bacteria 7135830
527 2855879048 2855872281 Bacteria 6964271
528 2857531711 2857531043 Bacteria 6754041
529 2858800909 2858800743 Bacteria 6603254
530 2896386542 2896384573 Bacteria 7700774
531 2899792132 2899792073 Bacteria 4926588
532 2899806116 2899803654 Bacteria 5577784
533 2899846291 2899845264 Bacteria 5672268
534 2913297540 2913295892 Bacteria 6333755
535 2915993307 2915986958 Bacteria 6739310
536 2915997892 2915993759 Bacteria 7016183
537 2916005714 2916000859 Bacteria 6865702
538 2916012787 2916007675 Bacteria 6898660
539 2916020961 2916014648 Bacteria 6946486
540 2916022512 2916021584 Bacteria 6854472
541 2916034603 2916028427 Bacteria 6748433
542 2916035350 2916035215 Bacteria 6755766
543 2916043281 2916041962 Bacteria 6820487
544 2916052490 2916048683 Bacteria 6543552
545 2916057598 2916055098 Bacteria 6758838
546 2916072964 2916068649 Bacteria 6943657
547 2916076728 2916076590 Bacteria 6596108
548 2919115935 2919114240 Bacteria 5700270
549 2919167229 2919166419 Bacteria 4952238
550 2919171574 2919171160 Bacteria 6499771
551 2919409183 2919408235 Bacteria 6149349
552 2920762973 2920760137 Bacteria 7427611
553 2920823745 2920822456 Bacteria 6897201
554 2921201772 2921201388 Bacteria 6926299
555 2921209733 2921208531 Bacteria 6745326
556 2921243927 2921237296 Bacteria 6876710
557 2921245964 2921244191 Bacteria 6568419
558 2921269353 2921263974 Bacteria 6864552
559 2921286411 2921282425 Bacteria 6826397
560 2921294058 2921289301 Bacteria 7316391
561 2921302223 2921296804 Bacteria 7176999
562 2924146924 2924144063 Bacteria 6883928
563 2924156262 2924150972 Bacteria 7169444
564 2924160504 2924158325 Bacteria 7188855
565 2924166115 2924165586 Bacteria 7260590
566 2924178551 2924172951 Bacteria 6749356
567 2924181494 2924179722 Bacteria 6843264
568 2924190288 2924186466 Bacteria 6876637
569 2924195957 2924193448 Bacteria 6955718
570 2924204391 2924200457 Bacteria 6757188
571 2924207427 2924207177 Bacteria 6917007
572 2924216461 2924214083 Bacteria 7080103
573 2924224437 2924221636 Bacteria 7113495
574 2924234867 2924228884 Bacteria 6633132
575 2926756889 2926754445 Bacteria 5964435
576 2926761113 2926760298 Bacteria 5505990
577 2929139319 2929138655 Bacteria 5810547
578 2933007734 2933006813 Bacteria 4912075
579 2933012509 2933011516 Bacteria 5439334
580 2933594949 2933594066 Bacteria 5594265
581 2937000459 2936996657 Bacteria 6298727
582 2937009584 2937002841 Bacteria 6934057
583 2937010818 2937009748 Bacteria 6746052
584 2937020814 2937016420 Bacteria 6782579
585 2937049617 2937042894 Bacteria 6741576
586 2937052646 2937049772 Bacteria 6757901
587 2937061602 2937056579 Bacteria 7107896
588 2937066481 2937063883 Bacteria 7199456
589 2937073811 2937071275 Bacteria 6984483
590 2937098953 2937091812 Bacteria 6979387
591 2937103696 2937098957 Bacteria 7249374
592 2937111589 2937106411 Bacteria 6947143
593 2937118241 2937113482 Bacteria 6505872
594 2937121117 2937119839 Bacteria 6597547
595 2937130154 2937126314 Bacteria 6771275
596 2941500322 2941499720 Bacteria 7599444
597 2957385137 2957382221 Bacteria 6737050
598 2957389200 2957388812 Bacteria 6778072
599 2957402675 2957402308 Bacteria 6741770
600 2957415211 2957408893 Bacteria 6558585
601 2957418018 2957415311 Bacteria 6991633
602 2957425803 2957422303 Bacteria 7172205
603 2957433143 2957430029 Bacteria 7022557
604 2957449908 2957443900 Bacteria 6869977
605 2957453508 2957450854 Bacteria 6765715
606 2957457828 2957457609 Bacteria 6967680
607 2957466446 2957464669 Bacteria 6568877
608 2957473983 2957471148 Bacteria 6797643
609 2957483731 2957478035 Bacteria 6756658
610 2957485858 2957484790 Bacteria 6703082
611 2957495927 2957491536 Bacteria 6695180
612 2957499810 2957498199 Bacteria 7126688
613 2957510303 2957505466 Bacteria 7253085
614 2960587126 2960584000 Bacteria 6864594
615 2960600643 2960597568 Bacteria 6550735
616 2960609420 2960603979 Bacteria 6898737
617 2960613798 2960610863 Bacteria 6691244
618 2960617638 2960617483 Bacteria 6727748
619 2960625480 2960624210 Bacteria 6875384
620 2960642343 2960637947 Bacteria 7296468
621 2960652778 2960645483 Bacteria 7211087
622 2960656797 2960652885 Bacteria 7083688
623 2960662315 2960660292 Bacteria 7041660
624 2960673857 2960667422 Bacteria 6763020
625 2960676136 2960674078 Bacteria 6609048
626 2960691072 2960687367 Bacteria 6535474
627 2964612094 2964607997 Bacteria 7101408
628 2964623233 2964621998 Bacteria 6834995
629 2964633185 2964628898 Bacteria 7083044
630 2964642114 2964636051 Bacteria 7091832
631 2964648742 2964643177 Bacteria 6820887
632 2964653034 2964649959 Bacteria 6675118
633 2964661096 2964656573 Bacteria 7100150
634 2964666041 2964663802 Bacteria 7019362
635 2964677680 2964670856 Bacteria 6851364
636 2964683678 2964678106 Bacteria 6792020
637 2964689155 2964685014 Bacteria 6839111
638 2964695773 2964691889 Bacteria 6802758
639 2964701881 2964698721 Bacteria 6765331
640 2964712390 2964705432 Bacteria 7114648
641 2964718630 2964712639 Bacteria 6695970
642 2964726204 2964719344 Bacteria 7286602
643 2967669707 2967664464 Bacteria 6948836
644 2967673703 2967671571 Bacteria 7021409
645 2967678856 2967678726 Bacteria 7264382
646 2967693177 2967693043 Bacteria 6804451
647 2967702590 2967699805 Bacteria 6854538
648 2967709235 2967706974 Bacteria 7186053
649 2967716598 2967714385 Bacteria 7000047
650 2967724790 2967721400 Bacteria 7073753
651 2967740966 2967735183 Bacteria 6827012
652 2967746063 2967742019 Bacteria 6794534
653 2967752173 2967748971 Bacteria 6733771
654 2967763751 2967762386 Bacteria 6923502
655 2967773125 2967769361 Bacteria 6587838
656 2967777195 2967775926 Bacteria 6738189
657 2970026002 2970019648 Bacteria 7072033
658 2970039146 2970033650 Bacteria 7118744
659 2970047626 2970040964 Bacteria 6731123
660 2970049987 2970047711 Bacteria 7088379
661 2970059676 2970054988 Bacteria 6611507
662 2970067858 2970061556 Bacteria 7099761
663 2970074952 2970068827 Bacteria 7123112
664 2970076432 2970076120 Bacteria 6697332
665 2970086619 2970082768 Bacteria 6183754
666 2970093471 2970088815 Bacteria 6933825
667 2970101672 2970095765 Bacteria 6936963
668 2970109887 2970109326 Bacteria 6863976
669 2970118036 2970116247 Bacteria 6501857
670 2970129450 2970129317 Bacteria 6806560
671 2970136959 2970136068 Bacteria 7207982
672 2970153882 2970149975 Bacteria 6779706
673 2970162382 2970156795 Bacteria 7168044
674 2970167436 2970164137 Bacteria 6861252
675 2970171537 2970170962 Bacteria 6876229
676 2970182202 2970177841 Bacteria 6768001
677 2970189424 2970184632 Bacteria 7054431
678 2970198392 2970191845 Bacteria 7032787
679 2977518637 2977516862 Bacteria 6940108
680 2977527207 2977523885 Bacteria 6960446
681 2977537921 2977537788 Bacteria 6929320
682 2977551918 2977551784 Bacteria 7125765
683 2977563130 2977558990 Bacteria 6863948
684 2977568911 2977565890 Bacteria 6901543
685 2977579029 2977572785 Bacteria 6763888
686 2977581562 2977579622 Bacteria 6772100
687 2978973655 2978969890 Bacteria 5400756
688 2979093603 2979089926 Bacteria 5670289
689 2979099009 2979095461 Bacteria 5669583
690 2979105583 2979100975 Bacteria 5423623
691 2984512569 2984509177 Bacteria 5274802
692 2984521070 2984518228 Bacteria 5277463
693 2984540364 2984537506 Bacteria 5277481
694 2984591929 2984587000 Bacteria 5263363
695 2984602561 2984601300 Bacteria 5455244
696 2989771932 2989771324 Bacteria 5605128
697 2989778051 2989776772 Bacteria 4843317
698 3005417727 3005416602 Bacteria 7064308
699 643824987 643692032 Bacteria 6891900
700 648740535 648276728 Bacteria 6968865
701 650739416 650716007 Bacteria 5573770
702 8003570458 8003570095 Bacteria 5747666
703 8003992796 8003992118 Bacteria 7266902
704 8005246707 8005246636 Bacteria 4933972
705 8005315083 8005314921 Bacteria 7072929
706 8005318064 8005314921 Bacteria 7072929
707 8005485745 8005484373 Bacteria 6297373
708 8005648112 8005645114 Bacteria 6950293
709 8005660085 8005658619 Bacteria 4500593
710 8005684719 8005682033 Bacteria 6726518
711 8024489866 8024486573 Bacteria 6540512
712 8046767549 8046767195 Bacteria 7547379
713 8049293816 8049293176 Bacteria 6128433
714 8054461768 8054460903 Bacteria 4872905
715 8054563584 8054558443 Bacteria 5204801
716 8055434057 8055431914 Bacteria 4551896
717 8056880013 8056875544 Bacteria 4355797
718 8057579107 8057575449 Bacteria 7367519
719 Ga0495654_0000130
720 JGI24740J21852_10001706
721 JGI25162J39368_1000243
722 JGI25162J39368_1000372
723 JGI25154J39366_1025527
724 JGI25159J45721_1000001
725 JGI25159J45721_1007076
726 JGI25151J46595_10014402
727 JGI25151J46595_10036328
728 JGI25165J46597_1000318
729 JGI25165J46597_1000413
730 rootH2_10088068
731 rootL2_10004432
732 rootL2_10004433
733 rootH1_10018310
734 rootH1_10066496
735 JGI25160J50197_1000002
736 JGI25160J50197_1011762
737 JGI25161J50226_1000742
738 JGI25161J50226_1004189
739 Ga0055526_1000805
740 Ga0055524_1046411
741 Ga0055536_1000427
742 Ga0055536_1002131
743 Ga0055530_10004975
744 Ga0055540_1003388
745 Ga0055540_1022338
746 Ga0055531_10003223
747 Ga0055531_10019032
748 Ga0055543_1005842
749 Ga0055543_1008229
750 Ga0065165_1000004
751 Ga0065165_1006277
752 Ga0065165_1015306
753 Ga0070676_10118877
754 Ga0070683_100689029
755 Ga0070680_100008482
756 Ga0070680_100062152
757 Ga0070660_100085737
758 Ga0070661_100169973
759 Ga0070668_100486269
760 Ga0070669_100054894
761 Ga0070659_100032152
762 Ga0070659_101147645
763 Ga0070714_100024490
764 Ga0070710_10389396
765 Ga0070711_100518830
766 Ga0070711_100747284
767 Ga0070679_100248409
768 Ga0070684_100194099
769 Ga0068853_100003501
770 Ga0068853_100199143
771 Ga0068853_100337428
772 Ga0070693_100290156
773 Ga0070665_100134095
774 Ga0070665_100184170
775 Ga0070665_100402121
776 Ga0068855_100019140
777 Ga0068855_100517370
778 Ga0068855_102238740
779 Ga0070664_101407448
780 Ga0068857_100099392
781 Ga0068854_100055705
782 Ga0068854_100289276
783 Ga0068854_100394108
784 Ga0068856_100046878
785 Ga0068852_100014111
786 Ga0068852_100216600
787 Ga0068851_10103600
788 Ga0081455_10512935
789 Ga0081539_10273761
790 Ga0075365_10000488
791 Ga0075368_10003865
792 Ga0075363_100054797
793 Ga0075364_10057050
794 Ga0075364_10295213
795 Ga0070712_100111918
796 Ga0070712_100533098
797 Ga0075362_10001934
798 Ga0075367_10028701
799 Ga0075367_10296427
800 Ga0075369_10015858
801 Ga0075369_10040475
802 Ga0075369_10309731
803 Ga0075370_10033815
804 Ga0075370_10249191
805 Ga0075431_100034414
806 Ga0068865_100341634
807 Ga0075436_100032738
808 Ga0079104_1000010
809 Ga0099826_10000030
810 Ga0099826_10005897
811 Ga0105240_10000027
812 Ga0114129_10048144
813 Ga0105243_10003211
814 Ga0105243_10325071
815 Ga0105242_10267060
816 Ga0105248_10284786
817 Ga0105237_10006371
818 Ga0105238_10916640
819 Ga0105033_107133
820 Ga0105239_10031150
821 Ga0105239_10847388
822 Ga0105239_11284261
823 Ga0157373_10037216
824 Ga0157373_10554686
825 Ga0157371_10000307
826 Ga0157371_10194006
827 Ga0157370_10000223
828 Ga0157370_10000577
829 Ga0157370_10164829
830 Ga0157369_10306780
831 Ga0157369_10442725
832 Ga0171463_1001
833 Ga0157378_12629022
834 Ga0157372_10092379
835 Ga0157380_10517191
836 Ga0182007_10000805
837 Ga0182005_1001955
838 Ga0183363_1305
839 Ga0214542_1000010
840 Ga0214543_1000003
841 Ga0214543_1000004
842 Ga0209435_100036
843 Ga0209435_106982
844 Ga0209760_101252
845 Ga0209436_103777
846 Ga0209436_104773
847 Ga0207427_117028
848 Ga0209437_100033
849 Ga0209437_100036
850 Ga0209646_1000132
851 Ga0209646_1013311
852 Ga0209646_1045463
853 Ga0209026_1015454
854 Ga0209677_100419
855 Ga0209148_1038824
856 Ga0209759_1025591
857 Ga0209233_1000056
858 Ga0209233_1000064
859 Ga0209233_1000152
860 Ga0209565_1046264
861 Ga0209130_1000008
862 Ga0209130_1006133
863 Ga0209676_1000885
864 Ga0209676_1032958
865 Ga0209025_1000074
866 Ga0209025_1000080
867 Ga0209025_1000100
868 Ga0209025_1063801
869 Ga0209025_1085903
870 Ga0209564_1000104
871 Ga0209758_1000121
872 Ga0209758_1053900
873 Ga0209758_1101417
874 Ga0209050_1001263
875 Ga0209050_1002888
876 Ga0209256_1001494
877 Ga0207426_1000016
878 Ga0207426_1012037
879 Ga0209051_1000918
880 Ga0209051_1001239
881 Ga0209051_1137631
882 Ga0209257_1005831
883 Ga0209257_1032555
884 Ga0209257_1032558
885 Ga0207645_10079055
886 Ga0207707_10379544
887 Ga0207695_10000024
888 Ga0207695_10836915
889 Ga0207671_10000986
890 Ga0207693_10012816
891 Ga0207693_10071773
892 Ga0207663_10158114
893 Ga0207660_10019044
894 Ga0207660_10041434
895 Ga0207657_10163197
896 Ga0207649_10194352
897 Ga0207652_10175794
898 Ga0207681_10147047
899 Ga0207681_10387676
900 Ga0207650_10000567
901 Ga0207664_10219165
902 Ga0207690_11084353
903 Ga0207686_10281055
904 Ga0207709_10134080
905 Ga0207711_10192203
906 Ga0207689_10186811
907 Ga0207661_10058969
908 Ga0207667_10096670
909 Ga0207667_10163651
910 Ga0207667_10241500
911 Ga0207667_11950947
912 Ga0207640_10068813
913 Ga0207640_10116982
914 Ga0207658_11134507
915 Ga0207639_10189792
916 Ga0207702_10425191
917 Ga0207702_10501763
918 Ga0207698_10159815
919 Ga0209281_1000053
920 Ga0209281_1000377
921 Ga0209371_1000009
922 Ga0209371_1001001
923 Ga0209371_1007294
924 Ga0209282_1001844
925 Ga0209813_10010599
926 Ga0268266_10077344
927 Ga0268266_10151057
928 Ga0268266_10518792
929 Ga0268266_10755119
930 Ga0307515_10002710
931 Ga0265338_10383584
932 Ga0268256_1000010
933 Ga0268256_1008343
934 Ga0268256_1026173
935 Ga0265325_10032431
936 Ga0265339_10160866
937 Ga0307408_100335795
938 Ga0307408_100710404
939 Ga0307408_100863603
940 Ga0307508_10408162
941 Ga0265314_10002263
942 Ga0307405_10057233
943 Ga0307405_10153351
944 Ga0307413_10730087
945 Ga0307406_10012978
946 Ga0307412_10223405
947 Ga0307416_102248550
948 Ga0307414_10218475
949 Ga0307414_10488251
950 Ga0307414_10927605
951 Ga0373939_0001378
952 Ga0373933_0282428
953 Ga0400485_00599
954 Ga0400488_43485
955 Ga0400486_12542
956 Ga0439436_0002969
957 Ga0439436_0081436
958 Ga0439438_029569
959 Ga0439438_130062
960 Ga0439466_0090180
961 Ga0439466_0138362
962 Ga0439465_0042221
963 Ga0451839_0390476
964 Ga0451851_0457214
965 Ga0439433_0086967
966 Ga0439445_0102546
967 Ga0439449_0009869
968 Ga0439449_0038896
969 Ga0439462_0009200
970 Ga0450920_006043
971 Ga0439458_0026517
972 Ga0450909_015526
973 Ga0439434_0167943
974 Ga0495606_0005820
975 Ga0495643_0057328
976 Ga0495648_0242839
977 Ga0495654_0117822
978 Ga0495633_0037945
979 Ga0495588_0000397
980 Ga0495681_0011685
981 Ga0495686_0000613
982 Ga0496102_0011682
983 Ga0496103_0008622
984 Ga0496104_0110009
985 Ga0496106_0135684
986 Ga0496110_0140994
987 Ga0496111_0005007
988 Ga0496111_0153817
989 Ga0496111_0440266
990 Ga0496112_1072320
991 Ga0496113_0016544
992 Ga0496115_0113228
993 Ga0496116_0000036
994 Ga0496116_0028892
995 Ga0496116_0030413
996 Ga0496116_0122294
997 Ga0496117_0000002
998 Ga0496117_0006286
999 Ga0496117_0034950
1000 Ga0496118_0000084
1001 Ga0496118_0000396
1002 Ga0496118_0037022
1003 Ga0496119_0015105
1004 Ga0496119_0027835
1005 Ga0496119_0073005
1006 Ga0496119_0131286
1007 Ga0496120_0000087
1008 Ga0496120_0052565
1009 Ga0496120_0422386
1010 Ga0496121_0000001
1011 Ga0496121_0001010
1012 Ga0496121_0001141
1013 Ga0496121_0025166
1014 Ga0496121_0064478
1015 Ga0496121_0110909
1016 Ga0496121_0297016
1017 Ga0496122_0000001
1018 Ga0496122_0000009
1019 Ga0496122_0000106
1020 Ga0496122_0013058
1021 Ga0496122_0015206
1022 Ga0496122_0052205
1023 Ga0496122_0067194
1024 Ga0496122_0095049
1025 Ga0496122_0239159
1026 Ga0496123_0000001
1027 Ga0496123_0007453
1028 Ga0496123_0007860
1029 Ga0496123_0057243
1030 Ga0496123_0161009
1031 Ga0496124_0000133
1032 Ga0496124_0017643
1033 Ga0496124_0030507
1034 Ga0496124_0030549
1035 Ga0496124_0052164
1036 Ga0496124_0210195
1037 Ga0496124_0212805
1038 Ga0496124_0480062
1039 Ga0496124_0605693
1040 Ga0496125_0000001
1041 Ga0496125_0007816
1042 Ga0496125_0012245
1043 Ga0496125_0062106
1044 Ga0496126_0001111
1045 Ga0496126_0076529
1046 Ga0496126_0271404
1047 Ga0496126_0766130
1048 Ga0501032_0443016
1049 Ga0501033_0000038
1050 Ga0501073_0050372
1051 Ga0501073_0566135
1052 Ga0501074_0579567
1053 Ga0501238_009603
1054 Ga0501079_1033732
1055 Ga0501080_0327946
1056 Ga0501280_002457
1057 Ga0501280_021713
1058 Ga0501035_0000326
1059 Ga0501044_0374382
1060 nmdc:mga03n38_9588_c1
1061 nmdc:mga00v17_244489_c1
1062 nmdc:mga00v17_325606_c1
1063 nmdc:mga00v17_52_c1
1064 nmdc:mga0yw44_36498_c1
1065 nmdc:mga0yw44_36786_c1
1066 nmdc:mga0k408_87799_c1
1067 nmdc:mga06z11_308360_c1
1068 nmdc:mga07m45_208570_c1
1069 nmdc:mga06r32_33896_c1
1070 nmdc:mga08x19_121754_c1
1071 nmdc:mga0sz30_1906_c1
1072 nmdc:mga0sz30_70596_c1
1073 Ga0495619_0057278
1074 Ga0500643_004960
1075 Ga0500644_0000781
1076 Ga0500646_0044020
1077 Ga0500651_0214340
1078 Ga0500566_0012016
1079 Ga0500560_000501
1080 Ga0500569_013863
1081 Ga0500572_000194
1082 Ga0500595_000002
1083 Ga0500595_055022
1084 Ga0500607_045137
1085 Ga0500608_006049
1086 Ga0500614_090431
1087 Ga0500618_000055
1088 Ga0500618_000945
1089 Ga0500652_000062
1090 Ga0500652_013374
1091 Ga0500559_0000979
1092 Ga0500559_0007920
1093 Ga0500573_0000780
1094 Ga0500573_0089940
1095 Ga0500616_0000002
1096 Ga0500616_0002928
1097 Ga0500616_0206442
1098 Ga0500624_001959
1099 Ga0500624_047045
1100 Ga0500634_0002869
1101 Ga0500634_0023083
1102 Ga0500639_009890
1103 Ga0500636_0000004
1104 Ga0500636_0000820
1105 Ga0500636_0054912
1106 Ga0500576_025879
1107 Ga0500645_000012
1108 Ga0500565_001313
1109 Ga0587090_007679
1110 Ga0587072_014032
1111 Ga0466962_0027943
1112 2509107448
1113 2509374560
1114 2510304479
1115 2510842891
1116 2511133622
1117 2511173684
1118 2511500903
1119 2512532326
1120 2513583559
1121 2513617515
1122 2513882772
1123 2513905316
1124 2513999448
1125 2515608029
1126 2516208783
1127 2516892180
1128 2524450227
1129 2524457900
1130 2537874540
1131 2551676363
1132 2551687470
1133 2551693401
1134 2551699187
1135 2551714775
1136 2551719035
1137 2551730346
1138 2551734581
1139 2551745404
1140 2554247000
1141 2558863589
1142 2559294225
1143 2585266296
1144 2585275766
1145 2585278788
1146 2585325598
1147 2585329753
1148 2585387297
1149 2585397798
1150 2585535898
1151 2585554019
1152 2585559315
1153 2585901219
1154 2585905309
1155 2585994973
1156 2585999516
1157 2587979576
1158 2599603440
1159 2599724201
1160 2600191829
1161 2601608792
1162 2601745566
1163 2616305938
1164 2616553817
1165 2617381936
1166 2643807309
1167 2643856005
1168 2643918596
1169 2644046691
1170 2644069721
1171 2644109100
1172 2644151620
1173 2644202398
1174 2644206313
1175 2644296967
1176 2644311756
1177 2644330027
1178 2644380692
1179 2644414597
1180 2644448254
1181 2644479480
1182 2644493501
1183 2644518859
1184 2644543219
1185 2644617554
1186 2644649961
1187 2644655221
1188 2644673654
1189 2644689439
1190 2657682216
1191 2671112744
1192 2692316922
1193 2753458898
1194 2776912633
1195 2778177347
1196 2792584063
1197 2792622134
1198 2792628301
1199 2792638441
1200 2804751235
1201 2808985999
1202 2819242682
1203 2819556120
1204 2819613631
1205 2819639367
1206 2819684283
1207 2821124130
1208 2838031296
1209 2838076340
1210 2838676847
1211 2838715732
1212 2838720467
1213 2838726487
1214 2838738846
1215 2841842745
1216 2841847397
1217 2841860064
1218 2842126573
1219 2842131740
1220 2842142525
1221 2842153091
1222 2842171976
1223 2842176710
1224 2842188841
1225 2842213153
1226 2842225229
1227 2842300483
1228 2842358399
1229 2842478109
1230 2842482736
1231 2842504918
1232 2842509605
1233 2842514338
1234 2842516849
1235 2842525241
1236 2844163894
1237 2847418009
1238 2848992986
1239 2850080372
1240 2852388945
1241 2854898758
1242 2854921658
1243 2855831254
1244 2855840379
1245 2855879048
1246 2857531711
1247 2858800909
1248 2896386542
1249 2899792132
1250 2899806116
1251 2899846291
1252 2913297540
1253 2915993307
1254 2915997892
1255 2916005714
1256 2916012787
1257 2916020961
1258 2916022512
1259 2916034603
1260 2916035350
1261 2916043281
1262 2916052490
1263 2916057598
1264 2916072964
1265 2916076728
1266 2919115935
1267 2919167229
1268 2919171574
1269 2919409183
1270 2920762973
1271 2920823745
1272 2921201772
1273 2921209733
1274 2921243927
1275 2921245964
1276 2921269353
1277 2921286411
1278 2921294058
1279 2921302223
1280 2924146924
1281 2924156262
1282 2924160504
1283 2924166115
1284 2924178551
1285 2924181494
1286 2924190288
1287 2924195957
1288 2924204391
1289 2924207427
1290 2924216461
1291 2924224437
1292 2924234867
1293 2926756889
1294 2926761113
1295 2929139319
1296 2933007734
1297 2933012509
1298 2933594949
1299 2937000459
1300 2937009584
1301 2937010818
1302 2937020814
1303 2937049617
1304 2937052646
1305 2937061602
1306 2937066481
1307 2937073811
1308 2937098953
1309 2937103696
1310 2937111589
1311 2937118241
1312 2937121117
1313 2937130154
1314 2941500322
1315 2957385137
1316 2957389200
1317 2957402675
1318 2957415211
1319 2957418018
1320 2957425803
1321 2957433143
1322 2957449908
1323 2957453508
1324 2957457828
1325 2957466446
1326 2957473983
1327 2957483731
1328 2957485858
1329 2957495927
1330 2957499810
1331 2957510303
1332 2960587126
1333 2960600643
1334 2960609420
1335 2960613798
1336 2960617638
1337 2960625480
1338 2960642343
1339 2960652778
1340 2960656797
1341 2960662315
1342 2960673857
1343 2960676136
1344 2960691072
1345 2964612094
1346 2964623233
1347 2964633185
1348 2964642114
1349 2964648742
1350 2964653034
1351 2964661096
1352 2964666041
1353 2964677680
1354 2964683678
1355 2964689155
1356 2964695773
1357 2964701881
1358 2964712390
1359 2964718630
1360 2964726204
1361 2967669707
1362 2967673703
1363 2967678856
1364 2967693177
1365 2967702590
1366 2967709235
1367 2967716598
1368 2967724790
1369 2967740966
1370 2967746063
1371 2967752173
1372 2967763751
1373 2967773125
1374 2967777195
1375 2970026002
1376 2970039146
1377 2970047626
1378 2970049987
1379 2970059676
1380 2970067858
1381 2970074952
1382 2970076432
1383 2970086619
1384 2970093471
1385 2970101672
1386 2970109887
1387 2970118036
1388 2970129450
1389 2970136959
1390 2970153882
1391 2970162382
1392 2970167436
1393 2970171537
1394 2970182202
1395 2970189424
1396 2970198392
1397 2977518637
1398 2977527207
1399 2977537921
1400 2977551918
1401 2977563130
1402 2977568911
1403 2977579029
1404 2977581562
1405 2978973655
1406 2979093603
1407 2979099009
1408 2979105583
1409 2984512569
1410 2984521070
1411 2984540364
1412 2984591929
1413 2984602561
1414 2989771932
1415 2989778051
1416 3005417727
1417 643824987
1418 648740535
1419 650739416
1420 8003570458
1421 8003992796
1422 8005246707
1423 8005315083
1424 8005318064
1425 8005485745
1426 8005648112
1427 8005660085
1428 8005684719
1429 8024489866
1430 8046767549
1431 8049293816
1432 8054461768
1433 8054563584
1434 8055434057
1435 8056880013
1436 8057579107

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8337 33 123
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8136 45 122
4gop-assembly2.cif.gz_Y structure and conformational change of a replication protein a heterotrimer bound to ssdna 0.8002 52 124
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.7951 33 132
8x70-assembly4.cif.gz_D the crystal structure of ifi16 from biortus. 0.777 47 124
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8337 33 123 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8136 45 122 2.40.50.140
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8002 52 124 2.40.50.140
1sr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7951 33 132 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7921 50 120 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2E1XJU7-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9197 3 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A6M4AVV0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9088 1 131 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A7J9WQ97-F1-model_v4 Cytochrome c maturation protein CcmE 0.894 1 131 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-L9XQI3-F1-model_v4 Cytochrome c-type biogenesis protein CcmE 0.8876 34 126 GO:0005886
GO:0017004
GO:0020037
AF-A0A383D8M9-F1-model_v4 Uncharacterized protein 0.8809 34 130 GO:0005886
GO:0017004
GO:0020037

Map