F477188
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 563 | 1436 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300046530|Ga0495654_0000130|Ga0495654_0000130_32016_32558 |
| Length | 180 |
| Sequence | MTRKQKRLAVIAGGMSFIIVAVFLVMFAFSQSVAYFFMPGDIAAANLQPGTRIRLGGLVEQGSVRRGQGSTVSFSVTDGKATVPVSYTGILPDLFREGQGVVTEGAFDAASHGFVADSVLAKHDENYMPKEVADRLKKDGVWEDGSGKGMAPAQDKAKAKGADGAEKTTEKDQVVGSTKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 59 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 80 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 81 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 82 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 138 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 151 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 152 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 153 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 154 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 155 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 156 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 157 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 158 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 159 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 160 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 163 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 164 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 165 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 166 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 167 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 184 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 185 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 186 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 187 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 188 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 189 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 205 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 206 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 207 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 208 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 209 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 210 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 215 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 216 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 217 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 218 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 220 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 221 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 222 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 223 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 224 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 225 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 226 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 228 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 229 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 230 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 231 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 232 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 233 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 234 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 235 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 236 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 237 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 238 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 241 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 242 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 243 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 244 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 245 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 246 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 247 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 248 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 249 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 250 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 251 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 252 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 253 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 254 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 255 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 256 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 257 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 258 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 259 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 260 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 261 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 262 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 263 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 264 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 265 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 266 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 267 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 268 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 269 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 270 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 271 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 272 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 273 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 274 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 275 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 276 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 277 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 278 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 279 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 280 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 281 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 282 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 283 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 284 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 285 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 286 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 287 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 288 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 289 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 290 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 291 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 292 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 293 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 294 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 295 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 296 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 297 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 298 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 299 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 300 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 301 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 302 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 303 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 304 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 305 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 306 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 307 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 308 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 309 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 310 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 311 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 312 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 313 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 314 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 315 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 316 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 317 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 318 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 319 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 320 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 321 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 322 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 323 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 324 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 325 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 326 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 327 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 328 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 329 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 330 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 331 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 332 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 333 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 334 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 335 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 336 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 337 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 338 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 339 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 340 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 341 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 342 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 343 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 344 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 345 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 346 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 347 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 348 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 349 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 350 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 351 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 352 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 353 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 354 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 355 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 356 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 357 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 358 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 359 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 360 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 361 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 362 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 363 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 364 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 365 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 366 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 367 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 368 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 369 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 370 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 371 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 372 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 373 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 374 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 375 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 376 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 377 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 378 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 379 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 380 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 381 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 382 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 383 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 384 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 385 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 386 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 387 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 388 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 389 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 390 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 391 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 392 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 393 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 394 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 395 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 396 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 397 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 398 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 399 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 400 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 401 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 402 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 403 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 404 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 405 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 406 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 407 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 408 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 409 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 410 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 411 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 412 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 413 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 414 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 415 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 416 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 417 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 418 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 419 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 420 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 421 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 422 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 423 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 424 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 425 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 426 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 427 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 428 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 429 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 430 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 431 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 432 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 433 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 434 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 435 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 436 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 437 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 438 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 439 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 440 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 441 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 442 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 443 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 444 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 445 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 446 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 447 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 448 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 449 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 450 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 451 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 452 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 453 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 454 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 455 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 456 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 457 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 458 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 459 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 460 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 461 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 462 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 463 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 464 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 465 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 466 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 467 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 468 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 469 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 470 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 471 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 472 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 473 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 474 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 475 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 476 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 477 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 478 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 479 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 480 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 481 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 482 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 483 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 484 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 485 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 486 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 487 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 488 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 489 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 490 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 491 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 492 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 493 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 494 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 495 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 496 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 497 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 498 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 499 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 500 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 501 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 502 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 503 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 504 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 505 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 506 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 507 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 508 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 509 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 510 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 511 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 512 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 513 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 514 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 515 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 516 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 517 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 518 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 519 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 520 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 521 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 522 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 523 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 524 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 525 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 526 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 527 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 528 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 529 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 530 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 531 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 532 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 533 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 534 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 535 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 536 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 537 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 538 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 539 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 540 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 541 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 542 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 543 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 544 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 545 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 546 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 547 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 548 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 549 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 550 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 551 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 552 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 553 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 554 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 555 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 556 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 557 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 558 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 559 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 560 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 561 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 562 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 563 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.46 |
| Metatranscriptomes | 0.28 |
| Isolates | 45.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.7 |
| Bulb | 0 |
| Endosphere | 16.99 |
| Nodule | 31.06 |
| Rhizoplane | 2.37 |
| Rhizosphere | 28.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495654_0000130 | 3300046530 | Bacteria | 81643 |
| 2 | JGI24740J21852_10001706 | 3300001979 | Bacteria | 10085 |
| 3 | JGI25162J39368_1000243 | 3300002737 | Bacteria | 54503 |
| 4 | JGI25162J39368_1000372 | 3300002737 | Bacteria | 38119 |
| 5 | JGI25154J39366_1025527 | 3300002738 | Bacteria | 538 |
| 6 | JGI25159J45721_1000001 | 3300002987 | Bacteria | 303489 |
| 7 | JGI25159J45721_1007076 | 3300002987 | Bacteria | 3268 |
| 8 | JGI25151J46595_10014402 | 3300003187 | Bacteria | 3524 |
| 9 | JGI25151J46595_10036328 | 3300003187 | Bacteria | 1860 |
| 10 | JGI25165J46597_1000318 | 3300003214 | Bacteria | 57977 |
| 11 | JGI25165J46597_1000413 | 3300003214 | Bacteria | 44960 |
| 12 | rootH2_10088068 | 3300003320 | Bacteria | 2927 |
| 13 | rootL2_10004432 | 3300003322 | Bacteria | 5832 |
| 14 | rootL2_10004433 | 3300003322 | Bacteria | 1005 |
| 15 | rootH1_10018310 | 3300003323 | Bacteria | 3819 |
| 16 | rootH1_10066496 | 3300003323 | Bacteria | 4032 |
| 17 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 18 | JGI25160J50197_1011762 | 3300003354 | Bacteria | 3077 |
| 19 | JGI25161J50226_1000742 | 3300003374 | Bacteria | 12536 |
| 20 | JGI25161J50226_1004189 | 3300003374 | Bacteria | 3077 |
| 21 | Ga0055526_1000805 | 3300003771 | Bacteria | 23389 |
| 22 | Ga0055524_1046411 | 3300003775 | Bacteria | 1033 |
| 23 | Ga0055536_1000427 | 3300003781 | Bacteria | 30054 |
| 24 | Ga0055536_1002131 | 3300003781 | Bacteria | 11268 |
| 25 | Ga0055530_10004975 | 3300003791 | Bacteria | 6570 |
| 26 | Ga0055540_1003388 | 3300003792 | Bacteria | 7725 |
| 27 | Ga0055540_1022338 | 3300003792 | Bacteria | 1621 |
| 28 | Ga0055531_10003223 | 3300003794 | Bacteria | 10465 |
| 29 | Ga0055531_10019032 | 3300003794 | Bacteria | 2802 |
| 30 | Ga0055543_1005842 | 3300004625 | Bacteria | 3077 |
| 31 | Ga0055543_1008229 | 3300004625 | Bacteria | 2324 |
| 32 | Ga0065165_1000004 | 3300005262 | Bacteria | 377081 |
| 33 | Ga0065165_1006277 | 3300005262 | Bacteria | 6303 |
| 34 | Ga0065165_1015306 | 3300005262 | Bacteria | 2930 |
| 35 | Ga0070676_10118877 | 3300005328 | Bacteria | 1656 |
| 36 | Ga0070683_100689029 | 3300005329 | Bacteria | 978 |
| 37 | Ga0070680_100008482 | 3300005336 | Bacteria | 7869 |
| 38 | Ga0070680_100062152 | 3300005336 | Bacteria | 3058 |
| 39 | Ga0070660_100085737 | 3300005339 | Bacteria | 2477 |
| 40 | Ga0070661_100169973 | 3300005344 | Bacteria | 1655 |
| 41 | Ga0070668_100486269 | 3300005347 | Bacteria | 1067 |
| 42 | Ga0070669_100054894 | 3300005353 | Bacteria | 2919 |
| 43 | Ga0070659_100032152 | 3300005366 | Bacteria | 4068 |
| 44 | Ga0070659_101147645 | 3300005366 | Bacteria | 686 |
| 45 | Ga0070714_100024490 | 3300005435 | Bacteria | 4972 |
| 46 | Ga0070710_10389396 | 3300005437 | Bacteria | 931 |
| 47 | Ga0070711_100518830 | 3300005439 | Bacteria | 984 |
| 48 | Ga0070711_100747284 | 3300005439 | Bacteria | 826 |
| 49 | Ga0070679_100248409 | 3300005530 | Bacteria | 1735 |
| 50 | Ga0070684_100194099 | 3300005535 | Bacteria | 1848 |
| 51 | Ga0068853_100003501 | 3300005539 | Bacteria | 12013 |
| 52 | Ga0068853_100199143 | 3300005539 | Bacteria | 1822 |
| 53 | Ga0068853_100337428 | 3300005539 | Bacteria | 1400 |
| 54 | Ga0070693_100290156 | 3300005547 | Bacteria | 1099 |
| 55 | Ga0070665_100134095 | 3300005548 | Bacteria | 2478 |
| 56 | Ga0070665_100184170 | 3300005548 | Bacteria | 2089 |
| 57 | Ga0070665_100402121 | 3300005548 | Bacteria | 1378 |
| 58 | Ga0068855_100019140 | 3300005563 | Bacteria | 8227 |
| 59 | Ga0068855_100517370 | 3300005563 | Bacteria | 1295 |
| 60 | Ga0068855_102238740 | 3300005563 | Bacteria | 548 |
| 61 | Ga0070664_101407448 | 3300005564 | Bacteria | 659 |
| 62 | Ga0068857_100099392 | 3300005577 | Bacteria | 2610 |
| 63 | Ga0068854_100055705 | 3300005578 | Bacteria | 2848 |
| 64 | Ga0068854_100289276 | 3300005578 | Bacteria | 1322 |
| 65 | Ga0068854_100394108 | 3300005578 | Bacteria | 1144 |
| 66 | Ga0068856_100046878 | 3300005614 | Bacteria | 4257 |
| 67 | Ga0068852_100014111 | 3300005616 | Bacteria | 6135 |
| 68 | Ga0068852_100216600 | 3300005616 | Bacteria | 1819 |
| 69 | Ga0068851_10103600 | 3300005834 | Bacteria | 1512 |
| 70 | Ga0081455_10512935 | 3300005937 | Bacteria | 802 |
| 71 | Ga0081539_10273761 | 3300005985 | Bacteria | 738 |
| 72 | Ga0075365_10000488 | 3300006038 | Bacteria | 15084 |
| 73 | Ga0075368_10003865 | 3300006042 | Bacteria | 5040 |
| 74 | Ga0075363_100054797 | 3300006048 | Bacteria | 2134 |
| 75 | Ga0075364_10057050 | 3300006051 | Bacteria | 2557 |
| 76 | Ga0075364_10295213 | 3300006051 | Bacteria | 1103 |
| 77 | Ga0070712_100111918 | 3300006175 | Bacteria | 2039 |
| 78 | Ga0070712_100533098 | 3300006175 | Bacteria | 987 |
| 79 | Ga0075362_10001934 | 3300006177 | Bacteria | 6808 |
| 80 | Ga0075367_10028701 | 3300006178 | Bacteria | 3176 |
| 81 | Ga0075367_10296427 | 3300006178 | Bacteria | 1018 |
| 82 | Ga0075369_10015858 | 3300006186 | Bacteria | 3031 |
| 83 | Ga0075369_10040475 | 3300006186 | Bacteria | 1992 |
| 84 | Ga0075369_10309731 | 3300006186 | Bacteria | 738 |
| 85 | Ga0075370_10033815 | 3300006353 | Bacteria | 2864 |
| 86 | Ga0075370_10249191 | 3300006353 | Bacteria | 1052 |
| 87 | Ga0075431_100034414 | 3300006847 | Bacteria | 5219 |
| 88 | Ga0068865_100341634 | 3300006881 | Bacteria | 1210 |
| 89 | Ga0075436_100032738 | 3300006914 | Bacteria | 3583 |
| 90 | Ga0079104_1000010 | 3300006946 | Bacteria | 366021 |
| 91 | Ga0099826_10000030 | 3300006948 | Bacteria | 128684 |
| 92 | Ga0099826_10005897 | 3300006948 | Bacteria | 8850 |
| 93 | Ga0105240_10000027 | 3300009093 | Bacteria | 348486 |
| 94 | Ga0114129_10048144 | 3300009147 | Bacteria | 5990 |
| 95 | Ga0105243_10003211 | 3300009148 | Bacteria | 13374 |
| 96 | Ga0105243_10325071 | 3300009148 | Bacteria | 1403 |
| 97 | Ga0105242_10267060 | 3300009176 | Bacteria | 1548 |
| 98 | Ga0105248_10284786 | 3300009177 | Bacteria | 1861 |
| 99 | Ga0105237_10006371 | 3300009545 | Bacteria | 13105 |
| 100 | Ga0105238_10916640 | 3300009551 | Bacteria | 895 |
| 101 | Ga0105033_107133 | 3300009986 | Bacteria | 969 |
| 102 | Ga0105239_10031150 | 3300010375 | Bacteria | 5868 |
| 103 | Ga0105239_10847388 | 3300010375 | Bacteria | 1048 |
| 104 | Ga0105239_11284261 | 3300010375 | Bacteria | 844 |
| 105 | Ga0157373_10037216 | 3300013100 | Bacteria | 3489 |
| 106 | Ga0157373_10554686 | 3300013100 | Bacteria | 833 |
| 107 | Ga0157371_10000307 | 3300013102 | Bacteria | 63760 |
| 108 | Ga0157371_10194006 | 3300013102 | Bacteria | 1455 |
| 109 | Ga0157370_10000223 | 3300013104 | Bacteria | 72025 |
| 110 | Ga0157370_10000577 | 3300013104 | Bacteria | 45697 |
| 111 | Ga0157370_10164829 | 3300013104 | Bacteria | 2061 |
| 112 | Ga0157369_10306780 | 3300013105 | Bacteria | 1651 |
| 113 | Ga0157369_10442725 | 3300013105 | Bacteria | 1346 |
| 114 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 115 | Ga0157378_12629022 | 3300013297 | Bacteria | 556 |
| 116 | Ga0157372_10092379 | 3300013307 | Bacteria | 3443 |
| 117 | Ga0157380_10517191 | 3300014326 | Bacteria | 1163 |
| 118 | Ga0182007_10000805 | 3300015262 | Bacteria | 17521 |
| 119 | Ga0182005_1001955 | 3300015265 | Bacteria | 7751 |
| 120 | Ga0183363_1305 | 3300015690 | Bacteria | 6838 |
| 121 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 122 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 123 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 124 | Ga0209435_100036 | 3300025206 | Bacteria | 126970 |
| 125 | Ga0209435_106982 | 3300025206 | Bacteria | 1252 |
| 126 | Ga0209760_101252 | 3300025207 | Bacteria | 2813 |
| 127 | Ga0209436_103777 | 3300025208 | Bacteria | 3914 |
| 128 | Ga0209436_104773 | 3300025208 | Bacteria | 3273 |
| 129 | Ga0207427_117028 | 3300025231 | Bacteria | 675 |
| 130 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 131 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 132 | Ga0209646_1000132 | 3300025246 | Bacteria | 126859 |
| 133 | Ga0209646_1013311 | 3300025246 | Bacteria | 1252 |
| 134 | Ga0209646_1045463 | 3300025246 | Bacteria | 538 |
| 135 | Ga0209026_1015454 | 3300025250 | Bacteria | 1252 |
| 136 | Ga0209677_100419 | 3300025253 | Bacteria | 25164 |
| 137 | Ga0209148_1038824 | 3300025254 | Bacteria | 668 |
| 138 | Ga0209759_1025591 | 3300025256 | Bacteria | 1252 |
| 139 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 140 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 141 | Ga0209233_1000152 | 3300025261 | Bacteria | 175910 |
| 142 | Ga0209565_1046264 | 3300025263 | Bacteria | 794 |
| 143 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 144 | Ga0209130_1006133 | 3300025284 | Bacteria | 3970 |
| 145 | Ga0209676_1000885 | 3300025292 | Bacteria | 38361 |
| 146 | Ga0209676_1032958 | 3300025292 | Bacteria | 1550 |
| 147 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 148 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 149 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 150 | Ga0209025_1063801 | 3300025294 | Bacteria | 1357 |
| 151 | Ga0209025_1085903 | 3300025294 | Bacteria | 1048 |
| 152 | Ga0209564_1000104 | 3300025295 | Bacteria | 219017 |
| 153 | Ga0209758_1000121 | 3300025297 | Bacteria | 192028 |
| 154 | Ga0209758_1053900 | 3300025297 | Bacteria | 1378 |
| 155 | Ga0209758_1101417 | 3300025297 | Bacteria | 818 |
| 156 | Ga0209050_1001263 | 3300025298 | Bacteria | 29191 |
| 157 | Ga0209050_1002888 | 3300025298 | Bacteria | 13567 |
| 158 | Ga0209256_1001494 | 3300025299 | Bacteria | 23770 |
| 159 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 160 | Ga0207426_1012037 | 3300025302 | Bacteria | 3268 |
| 161 | Ga0209051_1000918 | 3300025303 | Bacteria | 29277 |
| 162 | Ga0209051_1001239 | 3300025303 | Bacteria | 22894 |
| 163 | Ga0209051_1137631 | 3300025303 | Bacteria | 592 |
| 164 | Ga0209257_1005831 | 3300025304 | Bacteria | 8356 |
| 165 | Ga0209257_1032555 | 3300025304 | Bacteria | 1651 |
| 166 | Ga0209257_1032558 | 3300025304 | Bacteria | 1651 |
| 167 | Ga0207645_10079055 | 3300025907 | Bacteria | 2108 |
| 168 | Ga0207707_10379544 | 3300025912 | Bacteria | 1215 |
| 169 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 170 | Ga0207695_10836915 | 3300025913 | Bacteria | 800 |
| 171 | Ga0207671_10000986 | 3300025914 | Bacteria | 35178 |
| 172 | Ga0207693_10012816 | 3300025915 | Bacteria | 6764 |
| 173 | Ga0207693_10071773 | 3300025915 | Bacteria | 2711 |
| 174 | Ga0207663_10158114 | 3300025916 | Bacteria | 1597 |
| 175 | Ga0207660_10019044 | 3300025917 | Bacteria | 4585 |
| 176 | Ga0207660_10041434 | 3300025917 | Bacteria | 3227 |
| 177 | Ga0207657_10163197 | 3300025919 | Bacteria | 1809 |
| 178 | Ga0207649_10194352 | 3300025920 | Bacteria | 1429 |
| 179 | Ga0207652_10175794 | 3300025921 | Bacteria | 1923 |
| 180 | Ga0207681_10147047 | 3300025923 | Bacteria | 1762 |
| 181 | Ga0207681_10387676 | 3300025923 | Bacteria | 1126 |
| 182 | Ga0207650_10000567 | 3300025925 | Bacteria | 30017 |
| 183 | Ga0207664_10219165 | 3300025929 | Bacteria | 1649 |
| 184 | Ga0207690_11084353 | 3300025932 | Bacteria | 667 |
| 185 | Ga0207686_10281055 | 3300025934 | Bacteria | 1229 |
| 186 | Ga0207709_10134080 | 3300025935 | Bacteria | 1692 |
| 187 | Ga0207711_10192203 | 3300025941 | Bacteria | 1861 |
| 188 | Ga0207689_10186811 | 3300025942 | Bacteria | 1709 |
| 189 | Ga0207661_10058969 | 3300025944 | Bacteria | 3092 |
| 190 | Ga0207667_10096670 | 3300025949 | Bacteria | 3048 |
| 191 | Ga0207667_10163651 | 3300025949 | Bacteria | 2287 |
| 192 | Ga0207667_10241500 | 3300025949 | Bacteria | 1848 |
| 193 | Ga0207667_11950947 | 3300025949 | Bacteria | 548 |
| 194 | Ga0207640_10068813 | 3300025981 | Bacteria | 2374 |
| 195 | Ga0207640_10116982 | 3300025981 | Bacteria | 1902 |
| 196 | Ga0207658_11134507 | 3300025986 | Bacteria | 714 |
| 197 | Ga0207639_10189792 | 3300026041 | Bacteria | 1754 |
| 198 | Ga0207702_10425191 | 3300026078 | Bacteria | 1285 |
| 199 | Ga0207702_10501763 | 3300026078 | Bacteria | 1183 |
| 200 | Ga0207698_10159815 | 3300026142 | Bacteria | 1969 |
| 201 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 202 | Ga0209281_1000377 | 3300027111 | Bacteria | 71243 |
| 203 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 204 | Ga0209371_1001001 | 3300027312 | Bacteria | 21687 |
| 205 | Ga0209371_1007294 | 3300027312 | Bacteria | 3880 |
| 206 | Ga0209282_1001844 | 3300027666 | Bacteria | 11920 |
| 207 | Ga0209813_10010599 | 3300027866 | Bacteria | 2388 |
| 208 | Ga0268266_10077344 | 3300028379 | Bacteria | 2893 |
| 209 | Ga0268266_10151057 | 3300028379 | Bacteria | 2093 |
| 210 | Ga0268266_10518792 | 3300028379 | Bacteria | 1139 |
| 211 | Ga0268266_10755119 | 3300028379 | Bacteria | 939 |
| 212 | Ga0307515_10002710 | 3300028794 | Bacteria | 37898 |
| 213 | Ga0265338_10383584 | 3300028800 | Bacteria | 1005 |
| 214 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 215 | Ga0268256_1008343 | 3300030500 | Bacteria | 3560 |
| 216 | Ga0268256_1026173 | 3300030500 | Bacteria | 1470 |
| 217 | Ga0265325_10032431 | 3300031241 | Bacteria | 2789 |
| 218 | Ga0265339_10160866 | 3300031249 | Bacteria | 1130 |
| 219 | Ga0307408_100335795 | 3300031548 | Bacteria | 1278 |
| 220 | Ga0307408_100710404 | 3300031548 | Bacteria | 904 |
| 221 | Ga0307408_100863603 | 3300031548 | Bacteria | 826 |
| 222 | Ga0307508_10408162 | 3300031616 | Bacteria | 950 |
| 223 | Ga0265314_10002263 | 3300031711 | Bacteria | 19929 |
| 224 | Ga0307405_10057233 | 3300031731 | Bacteria | 2449 |
| 225 | Ga0307405_10153351 | 3300031731 | Bacteria | 1623 |
| 226 | Ga0307413_10730087 | 3300031824 | Bacteria | 826 |
| 227 | Ga0307406_10012978 | 3300031901 | Bacteria | 4762 |
| 228 | Ga0307412_10223405 | 3300031911 | Bacteria | 1445 |
| 229 | Ga0307416_102248550 | 3300032002 | Bacteria | 646 |
| 230 | Ga0307414_10218475 | 3300032004 | Bacteria | 1563 |
| 231 | Ga0307414_10488251 | 3300032004 | Bacteria | 1087 |
| 232 | Ga0307414_10927605 | 3300032004 | Bacteria | 799 |
| 233 | Ga0373939_0001378 | 3300035114 | Bacteria | 5884 |
| 234 | Ga0373933_0282428 | 3300035724 | Bacteria | 1073 |
| 235 | Ga0400485_00599 | 3300038735 | Bacteria | 2466 |
| 236 | Ga0400488_43485 | 3300038741 | Bacteria | 1268 |
| 237 | Ga0400486_12542 | 3300038742 | Bacteria | 1110 |
| 238 | Ga0439436_0002969 | 3300041404 | Bacteria | 5142 |
| 239 | Ga0439436_0081436 | 3300041404 | Bacteria | 901 |
| 240 | Ga0439438_029569 | 3300041405 | Bacteria | 1466 |
| 241 | Ga0439438_130062 | 3300041405 | Bacteria | 604 |
| 242 | Ga0439466_0090180 | 3300041411 | Bacteria | 961 |
| 243 | Ga0439466_0138362 | 3300041411 | Bacteria | 748 |
| 244 | Ga0439465_0042221 | 3300041413 | Bacteria | 1477 |
| 245 | Ga0451839_0390476 | 3300041496 | Bacteria | 529 |
| 246 | Ga0451851_0457214 | 3300041507 | Bacteria | 696 |
| 247 | Ga0439433_0086967 | 3300041999 | Bacteria | 765 |
| 248 | Ga0439445_0102546 | 3300042004 | Bacteria | 812 |
| 249 | Ga0439449_0009869 | 3300042007 | Bacteria | 3611 |
| 250 | Ga0439449_0038896 | 3300042007 | Bacteria | 1768 |
| 251 | Ga0439462_0009200 | 3300042015 | Bacteria | 2498 |
| 252 | Ga0450920_006043 | 3300042122 | Bacteria | 2167 |
| 253 | Ga0439458_0026517 | 3300042157 | Bacteria | 1364 |
| 254 | Ga0450909_015526 | 3300042185 | Bacteria | 1124 |
| 255 | Ga0439434_0167943 | 3300042435 | Bacteria | 731 |
| 256 | Ga0495606_0005820 | 3300046507 | Bacteria | 11630 |
| 257 | Ga0495643_0057328 | 3300046522 | Bacteria | 2076 |
| 258 | Ga0495648_0242839 | 3300046524 | Bacteria | 874 |
| 259 | Ga0495654_0117822 | 3300046530 | Bacteria | 1205 |
| 260 | Ga0495633_0037945 | 3300046558 | Bacteria | 2303 |
| 261 | Ga0495588_0000397 | 3300046674 | Bacteria | 24653 |
| 262 | Ga0495681_0011685 | 3300047470 | Bacteria | 5210 |
| 263 | Ga0495686_0000613 | 3300047472 | Bacteria | 49253 |
| 264 | Ga0496102_0011682 | 3300048905 | Bacteria | 7581 |
| 265 | Ga0496103_0008622 | 3300048906 | Bacteria | 6055 |
| 266 | Ga0496104_0110009 | 3300048907 | Bacteria | 2641 |
| 267 | Ga0496106_0135684 | 3300048909 | Bacteria | 1932 |
| 268 | Ga0496110_0140994 | 3300048913 | Bacteria | 2179 |
| 269 | Ga0496111_0005007 | 3300048914 | Bacteria | 8430 |
| 270 | Ga0496111_0153817 | 3300048914 | Bacteria | 1707 |
| 271 | Ga0496111_0440266 | 3300048914 | Bacteria | 962 |
| 272 | Ga0496112_1072320 | 3300048915 | Bacteria | 724 |
| 273 | Ga0496113_0016544 | 3300048916 | Bacteria | 5098 |
| 274 | Ga0496115_0113228 | 3300048918 | Bacteria | 2229 |
| 275 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 276 | Ga0496116_0028892 | 3300048919 | Bacteria | 4009 |
| 277 | Ga0496116_0030413 | 3300048919 | Bacteria | 3879 |
| 278 | Ga0496116_0122294 | 3300048919 | Bacteria | 1503 |
| 279 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 280 | Ga0496117_0006286 | 3300048920 | Bacteria | 12091 |
| 281 | Ga0496117_0034950 | 3300048920 | Bacteria | 3780 |
| 282 | Ga0496118_0000084 | 3300048921 | Bacteria | 181733 |
| 283 | Ga0496118_0000396 | 3300048921 | Bacteria | 73830 |
| 284 | Ga0496118_0037022 | 3300048921 | Bacteria | 3934 |
| 285 | Ga0496119_0015105 | 3300048922 | Bacteria | 5976 |
| 286 | Ga0496119_0027835 | 3300048922 | Bacteria | 3872 |
| 287 | Ga0496119_0073005 | 3300048922 | Bacteria | 2002 |
| 288 | Ga0496119_0131286 | 3300048922 | Bacteria | 1365 |
| 289 | Ga0496120_0000087 | 3300048923 | Bacteria | 152857 |
| 290 | Ga0496120_0052565 | 3300048923 | Bacteria | 2319 |
| 291 | Ga0496120_0422386 | 3300048923 | Bacteria | 585 |
| 292 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 293 | Ga0496121_0001010 | 3300048924 | Bacteria | 50285 |
| 294 | Ga0496121_0001141 | 3300048924 | Bacteria | 46594 |
| 295 | Ga0496121_0025166 | 3300048924 | Bacteria | 5661 |
| 296 | Ga0496121_0064478 | 3300048924 | Bacteria | 2987 |
| 297 | Ga0496121_0110909 | 3300048924 | Bacteria | 2093 |
| 298 | Ga0496121_0297016 | 3300048924 | Bacteria | 1098 |
| 299 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 300 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 301 | Ga0496122_0000106 | 3300048925 | Bacteria | 193672 |
| 302 | Ga0496122_0013058 | 3300048925 | Bacteria | 8180 |
| 303 | Ga0496122_0015206 | 3300048925 | Bacteria | 7367 |
| 304 | Ga0496122_0052205 | 3300048925 | Bacteria | 3097 |
| 305 | Ga0496122_0067194 | 3300048925 | Bacteria | 2584 |
| 306 | Ga0496122_0095049 | 3300048925 | Bacteria | 2015 |
| 307 | Ga0496122_0239159 | 3300048925 | Bacteria | 1025 |
| 308 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 309 | Ga0496123_0007453 | 3300048926 | Bacteria | 10298 |
| 310 | Ga0496123_0007860 | 3300048926 | Bacteria | 9917 |
| 311 | Ga0496123_0057243 | 3300048926 | Bacteria | 2539 |
| 312 | Ga0496123_0161009 | 3300048926 | Bacteria | 1196 |
| 313 | Ga0496124_0000133 | 3300048927 | Bacteria | 154328 |
| 314 | Ga0496124_0017643 | 3300048927 | Bacteria | 6720 |
| 315 | Ga0496124_0030507 | 3300048927 | Bacteria | 4785 |
| 316 | Ga0496124_0030549 | 3300048927 | Bacteria | 4780 |
| 317 | Ga0496124_0052164 | 3300048927 | Bacteria | 3476 |
| 318 | Ga0496124_0210195 | 3300048927 | Bacteria | 1473 |
| 319 | Ga0496124_0212805 | 3300048927 | Bacteria | 1461 |
| 320 | Ga0496124_0480062 | 3300048927 | Bacteria | 839 |
| 321 | Ga0496124_0605693 | 3300048927 | Bacteria | 711 |
| 322 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 323 | Ga0496125_0007816 | 3300048928 | Bacteria | 11305 |
| 324 | Ga0496125_0012245 | 3300048928 | Bacteria | 8532 |
| 325 | Ga0496125_0062106 | 3300048928 | Bacteria | 2990 |
| 326 | Ga0496126_0001111 | 3300048929 | Bacteria | 45099 |
| 327 | Ga0496126_0076529 | 3300048929 | Bacteria | 2968 |
| 328 | Ga0496126_0271404 | 3300048929 | Bacteria | 1407 |
| 329 | Ga0496126_0766130 | 3300048929 | Bacteria | 744 |
| 330 | Ga0501032_0443016 | 3300049569 | Bacteria | 832 |
| 331 | Ga0501033_0000038 | 3300049570 | Bacteria | 144438 |
| 332 | Ga0501073_0050372 | 3300049589 | Bacteria | 2918 |
| 333 | Ga0501073_0566135 | 3300049589 | Bacteria | 785 |
| 334 | Ga0501074_0579567 | 3300049590 | Bacteria | 794 |
| 335 | Ga0501238_009603 | 3300049671 | Bacteria | 1284 |
| 336 | Ga0501079_1033732 | 3300049741 | Bacteria | 647 |
| 337 | Ga0501080_0327946 | 3300049742 | Bacteria | 1385 |
| 338 | Ga0501280_002457 | 3300049776 | Bacteria | 3081 |
| 339 | Ga0501280_021713 | 3300049776 | Bacteria | 959 |
| 340 | Ga0501035_0000326 | 3300049822 | Bacteria | 55174 |
| 341 | Ga0501044_0374382 | 3300049823 | Bacteria | 1340 |
| 342 | nmdc:mga03n38_9588_c1 | 3300050490 | Bacteria | 3529 |
| 343 | nmdc:mga00v17_244489_c1 | 3300050491 | Bacteria | 1164 |
| 344 | nmdc:mga00v17_325606_c1 | 3300050491 | Bacteria | 998 |
| 345 | nmdc:mga00v17_52_c1 | 3300050491 | Bacteria | 72738 |
| 346 | nmdc:mga0yw44_36498_c1 | 3300050492 | Bacteria | 2896 |
| 347 | nmdc:mga0yw44_36786_c1 | 3300050492 | Bacteria | 2887 |
| 348 | nmdc:mga0k408_87799_c1 | 3300050493 | Bacteria | 1827 |
| 349 | nmdc:mga06z11_308360_c1 | 3300050494 | Bacteria | 942 |
| 350 | nmdc:mga07m45_208570_c1 | 3300050496 | Bacteria | 1137 |
| 351 | nmdc:mga06r32_33896_c1 | 3300050510 | Bacteria | 4812 |
| 352 | nmdc:mga08x19_121754_c1 | 3300050514 | Bacteria | 1749 |
| 353 | nmdc:mga0sz30_1906_c1 | 3300050516 | Bacteria | 7447 |
| 354 | nmdc:mga0sz30_70596_c1 | 3300050516 | Bacteria | 1503 |
| 355 | Ga0495619_0057278 | 3300053085 | Bacteria | 2586 |
| 356 | Ga0500643_004960 | 3300053087 | Bacteria | 5853 |
| 357 | Ga0500644_0000781 | 3300053088 | Bacteria | 10867 |
| 358 | Ga0500646_0044020 | 3300053090 | Bacteria | 1266 |
| 359 | Ga0500651_0214340 | 3300053093 | Bacteria | 1131 |
| 360 | Ga0500566_0012016 | 3300053094 | Bacteria | 5099 |
| 361 | Ga0500560_000501 | 3300053107 | Bacteria | 5485 |
| 362 | Ga0500569_013863 | 3300053109 | Bacteria | 1984 |
| 363 | Ga0500572_000194 | 3300053111 | Bacteria | 21418 |
| 364 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 365 | Ga0500595_055022 | 3300053119 | Bacteria | 1219 |
| 366 | Ga0500607_045137 | 3300053121 | Bacteria | 2367 |
| 367 | Ga0500608_006049 | 3300053122 | Bacteria | 4882 |
| 368 | Ga0500614_090431 | 3300053123 | Bacteria | 869 |
| 369 | Ga0500618_000055 | 3300053125 | Bacteria | 99876 |
| 370 | Ga0500618_000945 | 3300053125 | Bacteria | 14881 |
| 371 | Ga0500652_000062 | 3300053131 | Bacteria | 47514 |
| 372 | Ga0500652_013374 | 3300053131 | Bacteria | 2904 |
| 373 | Ga0500559_0000979 | 3300053136 | Bacteria | 17809 |
| 374 | Ga0500559_0007920 | 3300053136 | Bacteria | 4685 |
| 375 | Ga0500573_0000780 | 3300053140 | Bacteria | 14326 |
| 376 | Ga0500573_0089940 | 3300053140 | Bacteria | 1735 |
| 377 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 378 | Ga0500616_0002928 | 3300053153 | Bacteria | 13602 |
| 379 | Ga0500616_0206442 | 3300053153 | Bacteria | 866 |
| 380 | Ga0500624_001959 | 3300053157 | Bacteria | 2939 |
| 381 | Ga0500624_047045 | 3300053157 | Bacteria | 793 |
| 382 | Ga0500634_0002869 | 3300053161 | Bacteria | 7461 |
| 383 | Ga0500634_0023083 | 3300053161 | Bacteria | 3381 |
| 384 | Ga0500639_009890 | 3300053163 | Bacteria | 4990 |
| 385 | Ga0500636_0000004 | 3300053177 | Bacteria | 202392 |
| 386 | Ga0500636_0000820 | 3300053177 | Bacteria | 16724 |
| 387 | Ga0500636_0054912 | 3300053177 | Bacteria | 2335 |
| 388 | Ga0500576_025879 | 3300053725 | Bacteria | 2675 |
| 389 | Ga0500645_000012 | 3300053730 | Bacteria | 168579 |
| 390 | Ga0500565_001313 | 3300053734 | Bacteria | 1640 |
| 391 | Ga0587090_007679 | 3300059510 | Bacteria | 1423 |
| 392 | Ga0587072_014032 | 3300059643 | Bacteria | 1346 |
| 393 | Ga0466962_0027943 | 3300061719 | Bacteria | 2704 |
| 394 | 2509107448 | 2508501122 | Bacteria | 6292184 |
| 395 | 2509374560 | 2509276019 | Bacteria | 6802256 |
| 396 | 2510304479 | 2510065057 | Bacteria | 6649661 |
| 397 | 2510842891 | 2510461069 | Bacteria | 5505000 |
| 398 | 2511133622 | 2510917022 | Bacteria | 6504556 |
| 399 | 2511173684 | 2510917026 | Bacteria | 7046020 |
| 400 | 2511500903 | 2511231052 | Bacteria | 6974333 |
| 401 | 2512532326 | 2512047086 | Bacteria | 6850303 |
| 402 | 2513583559 | 2513237086 | Bacteria | 7265287 |
| 403 | 2513617515 | 2513237091 | Bacteria | 6900273 |
| 404 | 2513882772 | 2513237140 | Bacteria | 7076289 |
| 405 | 2513905316 | 2513237143 | Bacteria | 6664116 |
| 406 | 2513999448 | 2513237159 | Bacteria | 6810126 |
| 407 | 2515608029 | 2515154107 | Bacteria | 6795637 |
| 408 | 2516208783 | 2516143018 | Bacteria | 6951533 |
| 409 | 2516892180 | 2516653046 | Bacteria | 6989037 |
| 410 | 2524450227 | 2524023207 | Bacteria | 6813453 |
| 411 | 2524457900 | 2524023209 | Bacteria | 6679728 |
| 412 | 2537874540 | 2537561587 | Bacteria | 5425293 |
| 413 | 2551676363 | 2551306084 | Bacteria | 8942552 |
| 414 | 2551687470 | 2551306085 | Bacteria | 7347181 |
| 415 | 2551693401 | 2551306086 | Bacteria | 6843938 |
| 416 | 2551699187 | 2551306087 | Bacteria | 7351905 |
| 417 | 2551714775 | 2551306089 | Bacteria | 7162724 |
| 418 | 2551719035 | 2551306090 | Bacteria | 7953713 |
| 419 | 2551730346 | 2551306091 | Bacteria | 7086830 |
| 420 | 2551734581 | 2551306092 | Bacteria | 6992595 |
| 421 | 2551745404 | 2551306093 | Bacteria | 7064773 |
| 422 | 2554247000 | 2554235003 | Bacteria | 5877155 |
| 423 | 2558863589 | 2558860100 | Bacteria | 8458965 |
| 424 | 2559294225 | 2558860242 | Bacteria | 5568029 |
| 425 | 2585266296 | 2582581306 | Bacteria | 6450535 |
| 426 | 2585275766 | 2582581307 | Bacteria | 6597605 |
| 427 | 2585278788 | 2582581308 | Bacteria | 7413247 |
| 428 | 2585325598 | 2582581315 | Bacteria | 7318924 |
| 429 | 2585329753 | 2582581316 | Bacteria | 7774528 |
| 430 | 2585387297 | 2582581865 | Bacteria | 6644329 |
| 431 | 2585397798 | 2582581866 | Bacteria | 6859583 |
| 432 | 2585535898 | 2585427527 | Bacteria | 7273426 |
| 433 | 2585554019 | 2585427530 | Bacteria | 7383882 |
| 434 | 2585559315 | 2585427531 | Bacteria | 6992870 |
| 435 | 2585901219 | 2585427608 | Bacteria | 6544331 |
| 436 | 2585905309 | 2585427609 | Bacteria | 6667127 |
| 437 | 2585994973 | 2585427633 | Bacteria | 6413184 |
| 438 | 2585999516 | 2585427634 | Bacteria | 6455027 |
| 439 | 2587979576 | 2585428125 | Bacteria | 6662905 |
| 440 | 2599603440 | 2599185210 | Bacteria | 5624189 |
| 441 | 2599724201 | 2599185236 | Bacteria | 6875203 |
| 442 | 2600191829 | 2599185352 | Bacteria | 7228948 |
| 443 | 2601608792 | 2600255279 | Bacteria | 5605316 |
| 444 | 2601745566 | 2600255308 | Bacteria | 5611129 |
| 445 | 2616305938 | 2615840626 | Bacteria | 7921970 |
| 446 | 2616553817 | 2615840698 | Bacteria | 7319877 |
| 447 | 2617381936 | 2617270742 | Bacteria | 6808054 |
| 448 | 2643807309 | 2643221557 | Bacteria | 7184309 |
| 449 | 2643856005 | 2643221568 | Bacteria | 5187270 |
| 450 | 2643918596 | 2643221582 | Bacteria | 5804683 |
| 451 | 2644046691 | 2643221607 | Bacteria | 6314006 |
| 452 | 2644069721 | 2643221610 | Bacteria | 7480339 |
| 453 | 2644109100 | 2643221618 | Bacteria | 7717186 |
| 454 | 2644151620 | 2643221626 | Bacteria | 8069654 |
| 455 | 2644202398 | 2643221636 | Bacteria | 6583769 |
| 456 | 2644206313 | 2643221637 | Bacteria | 5345260 |
| 457 | 2644296967 | 2643221653 | Bacteria | 4569637 |
| 458 | 2644311756 | 2643221655 | Bacteria | 7722067 |
| 459 | 2644330027 | 2643221659 | Bacteria | 7890716 |
| 460 | 2644380692 | 2643221668 | Bacteria | 7306521 |
| 461 | 2644414597 | 2643221675 | Bacteria | 7473456 |
| 462 | 2644448254 | 2643221680 | Bacteria | 7473610 |
| 463 | 2644479480 | 2643221686 | Bacteria | 6310811 |
| 464 | 2644493501 | 2643221688 | Bacteria | 5260751 |
| 465 | 2644518859 | 2643221693 | Bacteria | 5513853 |
| 466 | 2644543219 | 2643221698 | Bacteria | 7756764 |
| 467 | 2644617554 | 2643221712 | Bacteria | 7729434 |
| 468 | 2644649961 | 2643221718 | Bacteria | 5345506 |
| 469 | 2644655221 | 2643221719 | Bacteria | 4568197 |
| 470 | 2644673654 | 2643221723 | Bacteria | 7095460 |
| 471 | 2644689439 | 2643221726 | Bacteria | 7455827 |
| 472 | 2657682216 | 2657244999 | Bacteria | 5946535 |
| 473 | 2671112744 | 2667528174 | Bacteria | 6435400 |
| 474 | 2692316922 | 2690316117 | Bacteria | 6800650 |
| 475 | 2753458898 | 2751185821 | Bacteria | 6189929 |
| 476 | 2776912633 | 2775507049 | Bacteria | 6284736 |
| 477 | 2778177347 | 2775507266 | Bacteria | 7392367 |
| 478 | 2792584063 | 2791355082 | Bacteria | 5973319 |
| 479 | 2792622134 | 2791355091 | Bacteria | 6135441 |
| 480 | 2792628301 | 2791355092 | Bacteria | 6248105 |
| 481 | 2792638441 | 2791355094 | Bacteria | 7011481 |
| 482 | 2804751235 | 2802429268 | Bacteria | 6094027 |
| 483 | 2808985999 | 2808606387 | Bacteria | 5697198 |
| 484 | 2819242682 | 2818991272 | Bacteria | 4622173 |
| 485 | 2819556120 | 2818991439 | Bacteria | 6907412 |
| 486 | 2819613631 | 2818991448 | Bacteria | 6772224 |
| 487 | 2819639367 | 2818991453 | Bacteria | 7181617 |
| 488 | 2819684283 | 2818991461 | Bacteria | 7026071 |
| 489 | 2821124130 | 2821123053 | Bacteria | 7836056 |
| 490 | 2838031296 | 2838029111 | Bacteria | 6603031 |
| 491 | 2838076340 | 2838074704 | Bacteria | 6785777 |
| 492 | 2838676847 | 2838675328 | Bacteria | 4909118 |
| 493 | 2838715732 | 2838714209 | Bacteria | 5525906 |
| 494 | 2838720467 | 2838719591 | Bacteria | 5523910 |
| 495 | 2838726487 | 2838724970 | Bacteria | 4908691 |
| 496 | 2838738846 | 2838736955 | Bacteria | 5760694 |
| 497 | 2841842745 | 2841840854 | Bacteria | 5761912 |
| 498 | 2841847397 | 2841846520 | Bacteria | 5345850 |
| 499 | 2841860064 | 2841859092 | Bacteria | 5436171 |
| 500 | 2842126573 | 2842124991 | Bacteria | 5346824 |
| 501 | 2842131740 | 2842130223 | Bacteria | 4909145 |
| 502 | 2842142525 | 2842140634 | Bacteria | 5759631 |
| 503 | 2842153091 | 2842152218 | Bacteria | 4908957 |
| 504 | 2842171976 | 2842170452 | Bacteria | 5525737 |
| 505 | 2842176710 | 2842175837 | Bacteria | 4908771 |
| 506 | 2842188841 | 2842187318 | Bacteria | 5524014 |
| 507 | 2842213153 | 2842211629 | Bacteria | 5523832 |
| 508 | 2842225229 | 2842224351 | Bacteria | 5524473 |
| 509 | 2842300483 | 2842298080 | Bacteria | 6123127 |
| 510 | 2842358399 | 2842357229 | Bacteria | 6485165 |
| 511 | 2842478109 | 2842475841 | Bacteria | 6603183 |
| 512 | 2842482736 | 2842482326 | Bacteria | 7212537 |
| 513 | 2842504918 | 2842502639 | Bacteria | 6604161 |
| 514 | 2842509605 | 2842509118 | Bacteria | 6850950 |
| 515 | 2842514338 | 2842509118 | Bacteria | 6850950 |
| 516 | 2842516849 | 2842515876 | Bacteria | 5436280 |
| 517 | 2842525241 | 2842521101 | Bacteria | 6569494 |
| 518 | 2844163894 | 2844163670 | Bacteria | 7266046 |
| 519 | 2847418009 | 2847417321 | Bacteria | 6913799 |
| 520 | 2848992986 | 2848992105 | Bacteria | 6810864 |
| 521 | 2850080372 | 2850079185 | Bacteria | 6848280 |
| 522 | 2852388945 | 2852387548 | Bacteria | 8025568 |
| 523 | 2854898758 | 2854896431 | Bacteria | 5869725 |
| 524 | 2854921658 | 2854916844 | Bacteria | 5725939 |
| 525 | 2855831254 | 2855825444 | Bacteria | 6785811 |
| 526 | 2855840379 | 2855839649 | Bacteria | 7135830 |
| 527 | 2855879048 | 2855872281 | Bacteria | 6964271 |
| 528 | 2857531711 | 2857531043 | Bacteria | 6754041 |
| 529 | 2858800909 | 2858800743 | Bacteria | 6603254 |
| 530 | 2896386542 | 2896384573 | Bacteria | 7700774 |
| 531 | 2899792132 | 2899792073 | Bacteria | 4926588 |
| 532 | 2899806116 | 2899803654 | Bacteria | 5577784 |
| 533 | 2899846291 | 2899845264 | Bacteria | 5672268 |
| 534 | 2913297540 | 2913295892 | Bacteria | 6333755 |
| 535 | 2915993307 | 2915986958 | Bacteria | 6739310 |
| 536 | 2915997892 | 2915993759 | Bacteria | 7016183 |
| 537 | 2916005714 | 2916000859 | Bacteria | 6865702 |
| 538 | 2916012787 | 2916007675 | Bacteria | 6898660 |
| 539 | 2916020961 | 2916014648 | Bacteria | 6946486 |
| 540 | 2916022512 | 2916021584 | Bacteria | 6854472 |
| 541 | 2916034603 | 2916028427 | Bacteria | 6748433 |
| 542 | 2916035350 | 2916035215 | Bacteria | 6755766 |
| 543 | 2916043281 | 2916041962 | Bacteria | 6820487 |
| 544 | 2916052490 | 2916048683 | Bacteria | 6543552 |
| 545 | 2916057598 | 2916055098 | Bacteria | 6758838 |
| 546 | 2916072964 | 2916068649 | Bacteria | 6943657 |
| 547 | 2916076728 | 2916076590 | Bacteria | 6596108 |
| 548 | 2919115935 | 2919114240 | Bacteria | 5700270 |
| 549 | 2919167229 | 2919166419 | Bacteria | 4952238 |
| 550 | 2919171574 | 2919171160 | Bacteria | 6499771 |
| 551 | 2919409183 | 2919408235 | Bacteria | 6149349 |
| 552 | 2920762973 | 2920760137 | Bacteria | 7427611 |
| 553 | 2920823745 | 2920822456 | Bacteria | 6897201 |
| 554 | 2921201772 | 2921201388 | Bacteria | 6926299 |
| 555 | 2921209733 | 2921208531 | Bacteria | 6745326 |
| 556 | 2921243927 | 2921237296 | Bacteria | 6876710 |
| 557 | 2921245964 | 2921244191 | Bacteria | 6568419 |
| 558 | 2921269353 | 2921263974 | Bacteria | 6864552 |
| 559 | 2921286411 | 2921282425 | Bacteria | 6826397 |
| 560 | 2921294058 | 2921289301 | Bacteria | 7316391 |
| 561 | 2921302223 | 2921296804 | Bacteria | 7176999 |
| 562 | 2924146924 | 2924144063 | Bacteria | 6883928 |
| 563 | 2924156262 | 2924150972 | Bacteria | 7169444 |
| 564 | 2924160504 | 2924158325 | Bacteria | 7188855 |
| 565 | 2924166115 | 2924165586 | Bacteria | 7260590 |
| 566 | 2924178551 | 2924172951 | Bacteria | 6749356 |
| 567 | 2924181494 | 2924179722 | Bacteria | 6843264 |
| 568 | 2924190288 | 2924186466 | Bacteria | 6876637 |
| 569 | 2924195957 | 2924193448 | Bacteria | 6955718 |
| 570 | 2924204391 | 2924200457 | Bacteria | 6757188 |
| 571 | 2924207427 | 2924207177 | Bacteria | 6917007 |
| 572 | 2924216461 | 2924214083 | Bacteria | 7080103 |
| 573 | 2924224437 | 2924221636 | Bacteria | 7113495 |
| 574 | 2924234867 | 2924228884 | Bacteria | 6633132 |
| 575 | 2926756889 | 2926754445 | Bacteria | 5964435 |
| 576 | 2926761113 | 2926760298 | Bacteria | 5505990 |
| 577 | 2929139319 | 2929138655 | Bacteria | 5810547 |
| 578 | 2933007734 | 2933006813 | Bacteria | 4912075 |
| 579 | 2933012509 | 2933011516 | Bacteria | 5439334 |
| 580 | 2933594949 | 2933594066 | Bacteria | 5594265 |
| 581 | 2937000459 | 2936996657 | Bacteria | 6298727 |
| 582 | 2937009584 | 2937002841 | Bacteria | 6934057 |
| 583 | 2937010818 | 2937009748 | Bacteria | 6746052 |
| 584 | 2937020814 | 2937016420 | Bacteria | 6782579 |
| 585 | 2937049617 | 2937042894 | Bacteria | 6741576 |
| 586 | 2937052646 | 2937049772 | Bacteria | 6757901 |
| 587 | 2937061602 | 2937056579 | Bacteria | 7107896 |
| 588 | 2937066481 | 2937063883 | Bacteria | 7199456 |
| 589 | 2937073811 | 2937071275 | Bacteria | 6984483 |
| 590 | 2937098953 | 2937091812 | Bacteria | 6979387 |
| 591 | 2937103696 | 2937098957 | Bacteria | 7249374 |
| 592 | 2937111589 | 2937106411 | Bacteria | 6947143 |
| 593 | 2937118241 | 2937113482 | Bacteria | 6505872 |
| 594 | 2937121117 | 2937119839 | Bacteria | 6597547 |
| 595 | 2937130154 | 2937126314 | Bacteria | 6771275 |
| 596 | 2941500322 | 2941499720 | Bacteria | 7599444 |
| 597 | 2957385137 | 2957382221 | Bacteria | 6737050 |
| 598 | 2957389200 | 2957388812 | Bacteria | 6778072 |
| 599 | 2957402675 | 2957402308 | Bacteria | 6741770 |
| 600 | 2957415211 | 2957408893 | Bacteria | 6558585 |
| 601 | 2957418018 | 2957415311 | Bacteria | 6991633 |
| 602 | 2957425803 | 2957422303 | Bacteria | 7172205 |
| 603 | 2957433143 | 2957430029 | Bacteria | 7022557 |
| 604 | 2957449908 | 2957443900 | Bacteria | 6869977 |
| 605 | 2957453508 | 2957450854 | Bacteria | 6765715 |
| 606 | 2957457828 | 2957457609 | Bacteria | 6967680 |
| 607 | 2957466446 | 2957464669 | Bacteria | 6568877 |
| 608 | 2957473983 | 2957471148 | Bacteria | 6797643 |
| 609 | 2957483731 | 2957478035 | Bacteria | 6756658 |
| 610 | 2957485858 | 2957484790 | Bacteria | 6703082 |
| 611 | 2957495927 | 2957491536 | Bacteria | 6695180 |
| 612 | 2957499810 | 2957498199 | Bacteria | 7126688 |
| 613 | 2957510303 | 2957505466 | Bacteria | 7253085 |
| 614 | 2960587126 | 2960584000 | Bacteria | 6864594 |
| 615 | 2960600643 | 2960597568 | Bacteria | 6550735 |
| 616 | 2960609420 | 2960603979 | Bacteria | 6898737 |
| 617 | 2960613798 | 2960610863 | Bacteria | 6691244 |
| 618 | 2960617638 | 2960617483 | Bacteria | 6727748 |
| 619 | 2960625480 | 2960624210 | Bacteria | 6875384 |
| 620 | 2960642343 | 2960637947 | Bacteria | 7296468 |
| 621 | 2960652778 | 2960645483 | Bacteria | 7211087 |
| 622 | 2960656797 | 2960652885 | Bacteria | 7083688 |
| 623 | 2960662315 | 2960660292 | Bacteria | 7041660 |
| 624 | 2960673857 | 2960667422 | Bacteria | 6763020 |
| 625 | 2960676136 | 2960674078 | Bacteria | 6609048 |
| 626 | 2960691072 | 2960687367 | Bacteria | 6535474 |
| 627 | 2964612094 | 2964607997 | Bacteria | 7101408 |
| 628 | 2964623233 | 2964621998 | Bacteria | 6834995 |
| 629 | 2964633185 | 2964628898 | Bacteria | 7083044 |
| 630 | 2964642114 | 2964636051 | Bacteria | 7091832 |
| 631 | 2964648742 | 2964643177 | Bacteria | 6820887 |
| 632 | 2964653034 | 2964649959 | Bacteria | 6675118 |
| 633 | 2964661096 | 2964656573 | Bacteria | 7100150 |
| 634 | 2964666041 | 2964663802 | Bacteria | 7019362 |
| 635 | 2964677680 | 2964670856 | Bacteria | 6851364 |
| 636 | 2964683678 | 2964678106 | Bacteria | 6792020 |
| 637 | 2964689155 | 2964685014 | Bacteria | 6839111 |
| 638 | 2964695773 | 2964691889 | Bacteria | 6802758 |
| 639 | 2964701881 | 2964698721 | Bacteria | 6765331 |
| 640 | 2964712390 | 2964705432 | Bacteria | 7114648 |
| 641 | 2964718630 | 2964712639 | Bacteria | 6695970 |
| 642 | 2964726204 | 2964719344 | Bacteria | 7286602 |
| 643 | 2967669707 | 2967664464 | Bacteria | 6948836 |
| 644 | 2967673703 | 2967671571 | Bacteria | 7021409 |
| 645 | 2967678856 | 2967678726 | Bacteria | 7264382 |
| 646 | 2967693177 | 2967693043 | Bacteria | 6804451 |
| 647 | 2967702590 | 2967699805 | Bacteria | 6854538 |
| 648 | 2967709235 | 2967706974 | Bacteria | 7186053 |
| 649 | 2967716598 | 2967714385 | Bacteria | 7000047 |
| 650 | 2967724790 | 2967721400 | Bacteria | 7073753 |
| 651 | 2967740966 | 2967735183 | Bacteria | 6827012 |
| 652 | 2967746063 | 2967742019 | Bacteria | 6794534 |
| 653 | 2967752173 | 2967748971 | Bacteria | 6733771 |
| 654 | 2967763751 | 2967762386 | Bacteria | 6923502 |
| 655 | 2967773125 | 2967769361 | Bacteria | 6587838 |
| 656 | 2967777195 | 2967775926 | Bacteria | 6738189 |
| 657 | 2970026002 | 2970019648 | Bacteria | 7072033 |
| 658 | 2970039146 | 2970033650 | Bacteria | 7118744 |
| 659 | 2970047626 | 2970040964 | Bacteria | 6731123 |
| 660 | 2970049987 | 2970047711 | Bacteria | 7088379 |
| 661 | 2970059676 | 2970054988 | Bacteria | 6611507 |
| 662 | 2970067858 | 2970061556 | Bacteria | 7099761 |
| 663 | 2970074952 | 2970068827 | Bacteria | 7123112 |
| 664 | 2970076432 | 2970076120 | Bacteria | 6697332 |
| 665 | 2970086619 | 2970082768 | Bacteria | 6183754 |
| 666 | 2970093471 | 2970088815 | Bacteria | 6933825 |
| 667 | 2970101672 | 2970095765 | Bacteria | 6936963 |
| 668 | 2970109887 | 2970109326 | Bacteria | 6863976 |
| 669 | 2970118036 | 2970116247 | Bacteria | 6501857 |
| 670 | 2970129450 | 2970129317 | Bacteria | 6806560 |
| 671 | 2970136959 | 2970136068 | Bacteria | 7207982 |
| 672 | 2970153882 | 2970149975 | Bacteria | 6779706 |
| 673 | 2970162382 | 2970156795 | Bacteria | 7168044 |
| 674 | 2970167436 | 2970164137 | Bacteria | 6861252 |
| 675 | 2970171537 | 2970170962 | Bacteria | 6876229 |
| 676 | 2970182202 | 2970177841 | Bacteria | 6768001 |
| 677 | 2970189424 | 2970184632 | Bacteria | 7054431 |
| 678 | 2970198392 | 2970191845 | Bacteria | 7032787 |
| 679 | 2977518637 | 2977516862 | Bacteria | 6940108 |
| 680 | 2977527207 | 2977523885 | Bacteria | 6960446 |
| 681 | 2977537921 | 2977537788 | Bacteria | 6929320 |
| 682 | 2977551918 | 2977551784 | Bacteria | 7125765 |
| 683 | 2977563130 | 2977558990 | Bacteria | 6863948 |
| 684 | 2977568911 | 2977565890 | Bacteria | 6901543 |
| 685 | 2977579029 | 2977572785 | Bacteria | 6763888 |
| 686 | 2977581562 | 2977579622 | Bacteria | 6772100 |
| 687 | 2978973655 | 2978969890 | Bacteria | 5400756 |
| 688 | 2979093603 | 2979089926 | Bacteria | 5670289 |
| 689 | 2979099009 | 2979095461 | Bacteria | 5669583 |
| 690 | 2979105583 | 2979100975 | Bacteria | 5423623 |
| 691 | 2984512569 | 2984509177 | Bacteria | 5274802 |
| 692 | 2984521070 | 2984518228 | Bacteria | 5277463 |
| 693 | 2984540364 | 2984537506 | Bacteria | 5277481 |
| 694 | 2984591929 | 2984587000 | Bacteria | 5263363 |
| 695 | 2984602561 | 2984601300 | Bacteria | 5455244 |
| 696 | 2989771932 | 2989771324 | Bacteria | 5605128 |
| 697 | 2989778051 | 2989776772 | Bacteria | 4843317 |
| 698 | 3005417727 | 3005416602 | Bacteria | 7064308 |
| 699 | 643824987 | 643692032 | Bacteria | 6891900 |
| 700 | 648740535 | 648276728 | Bacteria | 6968865 |
| 701 | 650739416 | 650716007 | Bacteria | 5573770 |
| 702 | 8003570458 | 8003570095 | Bacteria | 5747666 |
| 703 | 8003992796 | 8003992118 | Bacteria | 7266902 |
| 704 | 8005246707 | 8005246636 | Bacteria | 4933972 |
| 705 | 8005315083 | 8005314921 | Bacteria | 7072929 |
| 706 | 8005318064 | 8005314921 | Bacteria | 7072929 |
| 707 | 8005485745 | 8005484373 | Bacteria | 6297373 |
| 708 | 8005648112 | 8005645114 | Bacteria | 6950293 |
| 709 | 8005660085 | 8005658619 | Bacteria | 4500593 |
| 710 | 8005684719 | 8005682033 | Bacteria | 6726518 |
| 711 | 8024489866 | 8024486573 | Bacteria | 6540512 |
| 712 | 8046767549 | 8046767195 | Bacteria | 7547379 |
| 713 | 8049293816 | 8049293176 | Bacteria | 6128433 |
| 714 | 8054461768 | 8054460903 | Bacteria | 4872905 |
| 715 | 8054563584 | 8054558443 | Bacteria | 5204801 |
| 716 | 8055434057 | 8055431914 | Bacteria | 4551896 |
| 717 | 8056880013 | 8056875544 | Bacteria | 4355797 |
| 718 | 8057579107 | 8057575449 | Bacteria | 7367519 |
| 719 | Ga0495654_0000130 | |||
| 720 | JGI24740J21852_10001706 | |||
| 721 | JGI25162J39368_1000243 | |||
| 722 | JGI25162J39368_1000372 | |||
| 723 | JGI25154J39366_1025527 | |||
| 724 | JGI25159J45721_1000001 | |||
| 725 | JGI25159J45721_1007076 | |||
| 726 | JGI25151J46595_10014402 | |||
| 727 | JGI25151J46595_10036328 | |||
| 728 | JGI25165J46597_1000318 | |||
| 729 | JGI25165J46597_1000413 | |||
| 730 | rootH2_10088068 | |||
| 731 | rootL2_10004432 | |||
| 732 | rootL2_10004433 | |||
| 733 | rootH1_10018310 | |||
| 734 | rootH1_10066496 | |||
| 735 | JGI25160J50197_1000002 | |||
| 736 | JGI25160J50197_1011762 | |||
| 737 | JGI25161J50226_1000742 | |||
| 738 | JGI25161J50226_1004189 | |||
| 739 | Ga0055526_1000805 | |||
| 740 | Ga0055524_1046411 | |||
| 741 | Ga0055536_1000427 | |||
| 742 | Ga0055536_1002131 | |||
| 743 | Ga0055530_10004975 | |||
| 744 | Ga0055540_1003388 | |||
| 745 | Ga0055540_1022338 | |||
| 746 | Ga0055531_10003223 | |||
| 747 | Ga0055531_10019032 | |||
| 748 | Ga0055543_1005842 | |||
| 749 | Ga0055543_1008229 | |||
| 750 | Ga0065165_1000004 | |||
| 751 | Ga0065165_1006277 | |||
| 752 | Ga0065165_1015306 | |||
| 753 | Ga0070676_10118877 | |||
| 754 | Ga0070683_100689029 | |||
| 755 | Ga0070680_100008482 | |||
| 756 | Ga0070680_100062152 | |||
| 757 | Ga0070660_100085737 | |||
| 758 | Ga0070661_100169973 | |||
| 759 | Ga0070668_100486269 | |||
| 760 | Ga0070669_100054894 | |||
| 761 | Ga0070659_100032152 | |||
| 762 | Ga0070659_101147645 | |||
| 763 | Ga0070714_100024490 | |||
| 764 | Ga0070710_10389396 | |||
| 765 | Ga0070711_100518830 | |||
| 766 | Ga0070711_100747284 | |||
| 767 | Ga0070679_100248409 | |||
| 768 | Ga0070684_100194099 | |||
| 769 | Ga0068853_100003501 | |||
| 770 | Ga0068853_100199143 | |||
| 771 | Ga0068853_100337428 | |||
| 772 | Ga0070693_100290156 | |||
| 773 | Ga0070665_100134095 | |||
| 774 | Ga0070665_100184170 | |||
| 775 | Ga0070665_100402121 | |||
| 776 | Ga0068855_100019140 | |||
| 777 | Ga0068855_100517370 | |||
| 778 | Ga0068855_102238740 | |||
| 779 | Ga0070664_101407448 | |||
| 780 | Ga0068857_100099392 | |||
| 781 | Ga0068854_100055705 | |||
| 782 | Ga0068854_100289276 | |||
| 783 | Ga0068854_100394108 | |||
| 784 | Ga0068856_100046878 | |||
| 785 | Ga0068852_100014111 | |||
| 786 | Ga0068852_100216600 | |||
| 787 | Ga0068851_10103600 | |||
| 788 | Ga0081455_10512935 | |||
| 789 | Ga0081539_10273761 | |||
| 790 | Ga0075365_10000488 | |||
| 791 | Ga0075368_10003865 | |||
| 792 | Ga0075363_100054797 | |||
| 793 | Ga0075364_10057050 | |||
| 794 | Ga0075364_10295213 | |||
| 795 | Ga0070712_100111918 | |||
| 796 | Ga0070712_100533098 | |||
| 797 | Ga0075362_10001934 | |||
| 798 | Ga0075367_10028701 | |||
| 799 | Ga0075367_10296427 | |||
| 800 | Ga0075369_10015858 | |||
| 801 | Ga0075369_10040475 | |||
| 802 | Ga0075369_10309731 | |||
| 803 | Ga0075370_10033815 | |||
| 804 | Ga0075370_10249191 | |||
| 805 | Ga0075431_100034414 | |||
| 806 | Ga0068865_100341634 | |||
| 807 | Ga0075436_100032738 | |||
| 808 | Ga0079104_1000010 | |||
| 809 | Ga0099826_10000030 | |||
| 810 | Ga0099826_10005897 | |||
| 811 | Ga0105240_10000027 | |||
| 812 | Ga0114129_10048144 | |||
| 813 | Ga0105243_10003211 | |||
| 814 | Ga0105243_10325071 | |||
| 815 | Ga0105242_10267060 | |||
| 816 | Ga0105248_10284786 | |||
| 817 | Ga0105237_10006371 | |||
| 818 | Ga0105238_10916640 | |||
| 819 | Ga0105033_107133 | |||
| 820 | Ga0105239_10031150 | |||
| 821 | Ga0105239_10847388 | |||
| 822 | Ga0105239_11284261 | |||
| 823 | Ga0157373_10037216 | |||
| 824 | Ga0157373_10554686 | |||
| 825 | Ga0157371_10000307 | |||
| 826 | Ga0157371_10194006 | |||
| 827 | Ga0157370_10000223 | |||
| 828 | Ga0157370_10000577 | |||
| 829 | Ga0157370_10164829 | |||
| 830 | Ga0157369_10306780 | |||
| 831 | Ga0157369_10442725 | |||
| 832 | Ga0171463_1001 | |||
| 833 | Ga0157378_12629022 | |||
| 834 | Ga0157372_10092379 | |||
| 835 | Ga0157380_10517191 | |||
| 836 | Ga0182007_10000805 | |||
| 837 | Ga0182005_1001955 | |||
| 838 | Ga0183363_1305 | |||
| 839 | Ga0214542_1000010 | |||
| 840 | Ga0214543_1000003 | |||
| 841 | Ga0214543_1000004 | |||
| 842 | Ga0209435_100036 | |||
| 843 | Ga0209435_106982 | |||
| 844 | Ga0209760_101252 | |||
| 845 | Ga0209436_103777 | |||
| 846 | Ga0209436_104773 | |||
| 847 | Ga0207427_117028 | |||
| 848 | Ga0209437_100033 | |||
| 849 | Ga0209437_100036 | |||
| 850 | Ga0209646_1000132 | |||
| 851 | Ga0209646_1013311 | |||
| 852 | Ga0209646_1045463 | |||
| 853 | Ga0209026_1015454 | |||
| 854 | Ga0209677_100419 | |||
| 855 | Ga0209148_1038824 | |||
| 856 | Ga0209759_1025591 | |||
| 857 | Ga0209233_1000056 | |||
| 858 | Ga0209233_1000064 | |||
| 859 | Ga0209233_1000152 | |||
| 860 | Ga0209565_1046264 | |||
| 861 | Ga0209130_1000008 | |||
| 862 | Ga0209130_1006133 | |||
| 863 | Ga0209676_1000885 | |||
| 864 | Ga0209676_1032958 | |||
| 865 | Ga0209025_1000074 | |||
| 866 | Ga0209025_1000080 | |||
| 867 | Ga0209025_1000100 | |||
| 868 | Ga0209025_1063801 | |||
| 869 | Ga0209025_1085903 | |||
| 870 | Ga0209564_1000104 | |||
| 871 | Ga0209758_1000121 | |||
| 872 | Ga0209758_1053900 | |||
| 873 | Ga0209758_1101417 | |||
| 874 | Ga0209050_1001263 | |||
| 875 | Ga0209050_1002888 | |||
| 876 | Ga0209256_1001494 | |||
| 877 | Ga0207426_1000016 | |||
| 878 | Ga0207426_1012037 | |||
| 879 | Ga0209051_1000918 | |||
| 880 | Ga0209051_1001239 | |||
| 881 | Ga0209051_1137631 | |||
| 882 | Ga0209257_1005831 | |||
| 883 | Ga0209257_1032555 | |||
| 884 | Ga0209257_1032558 | |||
| 885 | Ga0207645_10079055 | |||
| 886 | Ga0207707_10379544 | |||
| 887 | Ga0207695_10000024 | |||
| 888 | Ga0207695_10836915 | |||
| 889 | Ga0207671_10000986 | |||
| 890 | Ga0207693_10012816 | |||
| 891 | Ga0207693_10071773 | |||
| 892 | Ga0207663_10158114 | |||
| 893 | Ga0207660_10019044 | |||
| 894 | Ga0207660_10041434 | |||
| 895 | Ga0207657_10163197 | |||
| 896 | Ga0207649_10194352 | |||
| 897 | Ga0207652_10175794 | |||
| 898 | Ga0207681_10147047 | |||
| 899 | Ga0207681_10387676 | |||
| 900 | Ga0207650_10000567 | |||
| 901 | Ga0207664_10219165 | |||
| 902 | Ga0207690_11084353 | |||
| 903 | Ga0207686_10281055 | |||
| 904 | Ga0207709_10134080 | |||
| 905 | Ga0207711_10192203 | |||
| 906 | Ga0207689_10186811 | |||
| 907 | Ga0207661_10058969 | |||
| 908 | Ga0207667_10096670 | |||
| 909 | Ga0207667_10163651 | |||
| 910 | Ga0207667_10241500 | |||
| 911 | Ga0207667_11950947 | |||
| 912 | Ga0207640_10068813 | |||
| 913 | Ga0207640_10116982 | |||
| 914 | Ga0207658_11134507 | |||
| 915 | Ga0207639_10189792 | |||
| 916 | Ga0207702_10425191 | |||
| 917 | Ga0207702_10501763 | |||
| 918 | Ga0207698_10159815 | |||
| 919 | Ga0209281_1000053 | |||
| 920 | Ga0209281_1000377 | |||
| 921 | Ga0209371_1000009 | |||
| 922 | Ga0209371_1001001 | |||
| 923 | Ga0209371_1007294 | |||
| 924 | Ga0209282_1001844 | |||
| 925 | Ga0209813_10010599 | |||
| 926 | Ga0268266_10077344 | |||
| 927 | Ga0268266_10151057 | |||
| 928 | Ga0268266_10518792 | |||
| 929 | Ga0268266_10755119 | |||
| 930 | Ga0307515_10002710 | |||
| 931 | Ga0265338_10383584 | |||
| 932 | Ga0268256_1000010 | |||
| 933 | Ga0268256_1008343 | |||
| 934 | Ga0268256_1026173 | |||
| 935 | Ga0265325_10032431 | |||
| 936 | Ga0265339_10160866 | |||
| 937 | Ga0307408_100335795 | |||
| 938 | Ga0307408_100710404 | |||
| 939 | Ga0307408_100863603 | |||
| 940 | Ga0307508_10408162 | |||
| 941 | Ga0265314_10002263 | |||
| 942 | Ga0307405_10057233 | |||
| 943 | Ga0307405_10153351 | |||
| 944 | Ga0307413_10730087 | |||
| 945 | Ga0307406_10012978 | |||
| 946 | Ga0307412_10223405 | |||
| 947 | Ga0307416_102248550 | |||
| 948 | Ga0307414_10218475 | |||
| 949 | Ga0307414_10488251 | |||
| 950 | Ga0307414_10927605 | |||
| 951 | Ga0373939_0001378 | |||
| 952 | Ga0373933_0282428 | |||
| 953 | Ga0400485_00599 | |||
| 954 | Ga0400488_43485 | |||
| 955 | Ga0400486_12542 | |||
| 956 | Ga0439436_0002969 | |||
| 957 | Ga0439436_0081436 | |||
| 958 | Ga0439438_029569 | |||
| 959 | Ga0439438_130062 | |||
| 960 | Ga0439466_0090180 | |||
| 961 | Ga0439466_0138362 | |||
| 962 | Ga0439465_0042221 | |||
| 963 | Ga0451839_0390476 | |||
| 964 | Ga0451851_0457214 | |||
| 965 | Ga0439433_0086967 | |||
| 966 | Ga0439445_0102546 | |||
| 967 | Ga0439449_0009869 | |||
| 968 | Ga0439449_0038896 | |||
| 969 | Ga0439462_0009200 | |||
| 970 | Ga0450920_006043 | |||
| 971 | Ga0439458_0026517 | |||
| 972 | Ga0450909_015526 | |||
| 973 | Ga0439434_0167943 | |||
| 974 | Ga0495606_0005820 | |||
| 975 | Ga0495643_0057328 | |||
| 976 | Ga0495648_0242839 | |||
| 977 | Ga0495654_0117822 | |||
| 978 | Ga0495633_0037945 | |||
| 979 | Ga0495588_0000397 | |||
| 980 | Ga0495681_0011685 | |||
| 981 | Ga0495686_0000613 | |||
| 982 | Ga0496102_0011682 | |||
| 983 | Ga0496103_0008622 | |||
| 984 | Ga0496104_0110009 | |||
| 985 | Ga0496106_0135684 | |||
| 986 | Ga0496110_0140994 | |||
| 987 | Ga0496111_0005007 | |||
| 988 | Ga0496111_0153817 | |||
| 989 | Ga0496111_0440266 | |||
| 990 | Ga0496112_1072320 | |||
| 991 | Ga0496113_0016544 | |||
| 992 | Ga0496115_0113228 | |||
| 993 | Ga0496116_0000036 | |||
| 994 | Ga0496116_0028892 | |||
| 995 | Ga0496116_0030413 | |||
| 996 | Ga0496116_0122294 | |||
| 997 | Ga0496117_0000002 | |||
| 998 | Ga0496117_0006286 | |||
| 999 | Ga0496117_0034950 | |||
| 1000 | Ga0496118_0000084 | |||
| 1001 | Ga0496118_0000396 | |||
| 1002 | Ga0496118_0037022 | |||
| 1003 | Ga0496119_0015105 | |||
| 1004 | Ga0496119_0027835 | |||
| 1005 | Ga0496119_0073005 | |||
| 1006 | Ga0496119_0131286 | |||
| 1007 | Ga0496120_0000087 | |||
| 1008 | Ga0496120_0052565 | |||
| 1009 | Ga0496120_0422386 | |||
| 1010 | Ga0496121_0000001 | |||
| 1011 | Ga0496121_0001010 | |||
| 1012 | Ga0496121_0001141 | |||
| 1013 | Ga0496121_0025166 | |||
| 1014 | Ga0496121_0064478 | |||
| 1015 | Ga0496121_0110909 | |||
| 1016 | Ga0496121_0297016 | |||
| 1017 | Ga0496122_0000001 | |||
| 1018 | Ga0496122_0000009 | |||
| 1019 | Ga0496122_0000106 | |||
| 1020 | Ga0496122_0013058 | |||
| 1021 | Ga0496122_0015206 | |||
| 1022 | Ga0496122_0052205 | |||
| 1023 | Ga0496122_0067194 | |||
| 1024 | Ga0496122_0095049 | |||
| 1025 | Ga0496122_0239159 | |||
| 1026 | Ga0496123_0000001 | |||
| 1027 | Ga0496123_0007453 | |||
| 1028 | Ga0496123_0007860 | |||
| 1029 | Ga0496123_0057243 | |||
| 1030 | Ga0496123_0161009 | |||
| 1031 | Ga0496124_0000133 | |||
| 1032 | Ga0496124_0017643 | |||
| 1033 | Ga0496124_0030507 | |||
| 1034 | Ga0496124_0030549 | |||
| 1035 | Ga0496124_0052164 | |||
| 1036 | Ga0496124_0210195 | |||
| 1037 | Ga0496124_0212805 | |||
| 1038 | Ga0496124_0480062 | |||
| 1039 | Ga0496124_0605693 | |||
| 1040 | Ga0496125_0000001 | |||
| 1041 | Ga0496125_0007816 | |||
| 1042 | Ga0496125_0012245 | |||
| 1043 | Ga0496125_0062106 | |||
| 1044 | Ga0496126_0001111 | |||
| 1045 | Ga0496126_0076529 | |||
| 1046 | Ga0496126_0271404 | |||
| 1047 | Ga0496126_0766130 | |||
| 1048 | Ga0501032_0443016 | |||
| 1049 | Ga0501033_0000038 | |||
| 1050 | Ga0501073_0050372 | |||
| 1051 | Ga0501073_0566135 | |||
| 1052 | Ga0501074_0579567 | |||
| 1053 | Ga0501238_009603 | |||
| 1054 | Ga0501079_1033732 | |||
| 1055 | Ga0501080_0327946 | |||
| 1056 | Ga0501280_002457 | |||
| 1057 | Ga0501280_021713 | |||
| 1058 | Ga0501035_0000326 | |||
| 1059 | Ga0501044_0374382 | |||
| 1060 | nmdc:mga03n38_9588_c1 | |||
| 1061 | nmdc:mga00v17_244489_c1 | |||
| 1062 | nmdc:mga00v17_325606_c1 | |||
| 1063 | nmdc:mga00v17_52_c1 | |||
| 1064 | nmdc:mga0yw44_36498_c1 | |||
| 1065 | nmdc:mga0yw44_36786_c1 | |||
| 1066 | nmdc:mga0k408_87799_c1 | |||
| 1067 | nmdc:mga06z11_308360_c1 | |||
| 1068 | nmdc:mga07m45_208570_c1 | |||
| 1069 | nmdc:mga06r32_33896_c1 | |||
| 1070 | nmdc:mga08x19_121754_c1 | |||
| 1071 | nmdc:mga0sz30_1906_c1 | |||
| 1072 | nmdc:mga0sz30_70596_c1 | |||
| 1073 | Ga0495619_0057278 | |||
| 1074 | Ga0500643_004960 | |||
| 1075 | Ga0500644_0000781 | |||
| 1076 | Ga0500646_0044020 | |||
| 1077 | Ga0500651_0214340 | |||
| 1078 | Ga0500566_0012016 | |||
| 1079 | Ga0500560_000501 | |||
| 1080 | Ga0500569_013863 | |||
| 1081 | Ga0500572_000194 | |||
| 1082 | Ga0500595_000002 | |||
| 1083 | Ga0500595_055022 | |||
| 1084 | Ga0500607_045137 | |||
| 1085 | Ga0500608_006049 | |||
| 1086 | Ga0500614_090431 | |||
| 1087 | Ga0500618_000055 | |||
| 1088 | Ga0500618_000945 | |||
| 1089 | Ga0500652_000062 | |||
| 1090 | Ga0500652_013374 | |||
| 1091 | Ga0500559_0000979 | |||
| 1092 | Ga0500559_0007920 | |||
| 1093 | Ga0500573_0000780 | |||
| 1094 | Ga0500573_0089940 | |||
| 1095 | Ga0500616_0000002 | |||
| 1096 | Ga0500616_0002928 | |||
| 1097 | Ga0500616_0206442 | |||
| 1098 | Ga0500624_001959 | |||
| 1099 | Ga0500624_047045 | |||
| 1100 | Ga0500634_0002869 | |||
| 1101 | Ga0500634_0023083 | |||
| 1102 | Ga0500639_009890 | |||
| 1103 | Ga0500636_0000004 | |||
| 1104 | Ga0500636_0000820 | |||
| 1105 | Ga0500636_0054912 | |||
| 1106 | Ga0500576_025879 | |||
| 1107 | Ga0500645_000012 | |||
| 1108 | Ga0500565_001313 | |||
| 1109 | Ga0587090_007679 | |||
| 1110 | Ga0587072_014032 | |||
| 1111 | Ga0466962_0027943 | |||
| 1112 | 2509107448 | |||
| 1113 | 2509374560 | |||
| 1114 | 2510304479 | |||
| 1115 | 2510842891 | |||
| 1116 | 2511133622 | |||
| 1117 | 2511173684 | |||
| 1118 | 2511500903 | |||
| 1119 | 2512532326 | |||
| 1120 | 2513583559 | |||
| 1121 | 2513617515 | |||
| 1122 | 2513882772 | |||
| 1123 | 2513905316 | |||
| 1124 | 2513999448 | |||
| 1125 | 2515608029 | |||
| 1126 | 2516208783 | |||
| 1127 | 2516892180 | |||
| 1128 | 2524450227 | |||
| 1129 | 2524457900 | |||
| 1130 | 2537874540 | |||
| 1131 | 2551676363 | |||
| 1132 | 2551687470 | |||
| 1133 | 2551693401 | |||
| 1134 | 2551699187 | |||
| 1135 | 2551714775 | |||
| 1136 | 2551719035 | |||
| 1137 | 2551730346 | |||
| 1138 | 2551734581 | |||
| 1139 | 2551745404 | |||
| 1140 | 2554247000 | |||
| 1141 | 2558863589 | |||
| 1142 | 2559294225 | |||
| 1143 | 2585266296 | |||
| 1144 | 2585275766 | |||
| 1145 | 2585278788 | |||
| 1146 | 2585325598 | |||
| 1147 | 2585329753 | |||
| 1148 | 2585387297 | |||
| 1149 | 2585397798 | |||
| 1150 | 2585535898 | |||
| 1151 | 2585554019 | |||
| 1152 | 2585559315 | |||
| 1153 | 2585901219 | |||
| 1154 | 2585905309 | |||
| 1155 | 2585994973 | |||
| 1156 | 2585999516 | |||
| 1157 | 2587979576 | |||
| 1158 | 2599603440 | |||
| 1159 | 2599724201 | |||
| 1160 | 2600191829 | |||
| 1161 | 2601608792 | |||
| 1162 | 2601745566 | |||
| 1163 | 2616305938 | |||
| 1164 | 2616553817 | |||
| 1165 | 2617381936 | |||
| 1166 | 2643807309 | |||
| 1167 | 2643856005 | |||
| 1168 | 2643918596 | |||
| 1169 | 2644046691 | |||
| 1170 | 2644069721 | |||
| 1171 | 2644109100 | |||
| 1172 | 2644151620 | |||
| 1173 | 2644202398 | |||
| 1174 | 2644206313 | |||
| 1175 | 2644296967 | |||
| 1176 | 2644311756 | |||
| 1177 | 2644330027 | |||
| 1178 | 2644380692 | |||
| 1179 | 2644414597 | |||
| 1180 | 2644448254 | |||
| 1181 | 2644479480 | |||
| 1182 | 2644493501 | |||
| 1183 | 2644518859 | |||
| 1184 | 2644543219 | |||
| 1185 | 2644617554 | |||
| 1186 | 2644649961 | |||
| 1187 | 2644655221 | |||
| 1188 | 2644673654 | |||
| 1189 | 2644689439 | |||
| 1190 | 2657682216 | |||
| 1191 | 2671112744 | |||
| 1192 | 2692316922 | |||
| 1193 | 2753458898 | |||
| 1194 | 2776912633 | |||
| 1195 | 2778177347 | |||
| 1196 | 2792584063 | |||
| 1197 | 2792622134 | |||
| 1198 | 2792628301 | |||
| 1199 | 2792638441 | |||
| 1200 | 2804751235 | |||
| 1201 | 2808985999 | |||
| 1202 | 2819242682 | |||
| 1203 | 2819556120 | |||
| 1204 | 2819613631 | |||
| 1205 | 2819639367 | |||
| 1206 | 2819684283 | |||
| 1207 | 2821124130 | |||
| 1208 | 2838031296 | |||
| 1209 | 2838076340 | |||
| 1210 | 2838676847 | |||
| 1211 | 2838715732 | |||
| 1212 | 2838720467 | |||
| 1213 | 2838726487 | |||
| 1214 | 2838738846 | |||
| 1215 | 2841842745 | |||
| 1216 | 2841847397 | |||
| 1217 | 2841860064 | |||
| 1218 | 2842126573 | |||
| 1219 | 2842131740 | |||
| 1220 | 2842142525 | |||
| 1221 | 2842153091 | |||
| 1222 | 2842171976 | |||
| 1223 | 2842176710 | |||
| 1224 | 2842188841 | |||
| 1225 | 2842213153 | |||
| 1226 | 2842225229 | |||
| 1227 | 2842300483 | |||
| 1228 | 2842358399 | |||
| 1229 | 2842478109 | |||
| 1230 | 2842482736 | |||
| 1231 | 2842504918 | |||
| 1232 | 2842509605 | |||
| 1233 | 2842514338 | |||
| 1234 | 2842516849 | |||
| 1235 | 2842525241 | |||
| 1236 | 2844163894 | |||
| 1237 | 2847418009 | |||
| 1238 | 2848992986 | |||
| 1239 | 2850080372 | |||
| 1240 | 2852388945 | |||
| 1241 | 2854898758 | |||
| 1242 | 2854921658 | |||
| 1243 | 2855831254 | |||
| 1244 | 2855840379 | |||
| 1245 | 2855879048 | |||
| 1246 | 2857531711 | |||
| 1247 | 2858800909 | |||
| 1248 | 2896386542 | |||
| 1249 | 2899792132 | |||
| 1250 | 2899806116 | |||
| 1251 | 2899846291 | |||
| 1252 | 2913297540 | |||
| 1253 | 2915993307 | |||
| 1254 | 2915997892 | |||
| 1255 | 2916005714 | |||
| 1256 | 2916012787 | |||
| 1257 | 2916020961 | |||
| 1258 | 2916022512 | |||
| 1259 | 2916034603 | |||
| 1260 | 2916035350 | |||
| 1261 | 2916043281 | |||
| 1262 | 2916052490 | |||
| 1263 | 2916057598 | |||
| 1264 | 2916072964 | |||
| 1265 | 2916076728 | |||
| 1266 | 2919115935 | |||
| 1267 | 2919167229 | |||
| 1268 | 2919171574 | |||
| 1269 | 2919409183 | |||
| 1270 | 2920762973 | |||
| 1271 | 2920823745 | |||
| 1272 | 2921201772 | |||
| 1273 | 2921209733 | |||
| 1274 | 2921243927 | |||
| 1275 | 2921245964 | |||
| 1276 | 2921269353 | |||
| 1277 | 2921286411 | |||
| 1278 | 2921294058 | |||
| 1279 | 2921302223 | |||
| 1280 | 2924146924 | |||
| 1281 | 2924156262 | |||
| 1282 | 2924160504 | |||
| 1283 | 2924166115 | |||
| 1284 | 2924178551 | |||
| 1285 | 2924181494 | |||
| 1286 | 2924190288 | |||
| 1287 | 2924195957 | |||
| 1288 | 2924204391 | |||
| 1289 | 2924207427 | |||
| 1290 | 2924216461 | |||
| 1291 | 2924224437 | |||
| 1292 | 2924234867 | |||
| 1293 | 2926756889 | |||
| 1294 | 2926761113 | |||
| 1295 | 2929139319 | |||
| 1296 | 2933007734 | |||
| 1297 | 2933012509 | |||
| 1298 | 2933594949 | |||
| 1299 | 2937000459 | |||
| 1300 | 2937009584 | |||
| 1301 | 2937010818 | |||
| 1302 | 2937020814 | |||
| 1303 | 2937049617 | |||
| 1304 | 2937052646 | |||
| 1305 | 2937061602 | |||
| 1306 | 2937066481 | |||
| 1307 | 2937073811 | |||
| 1308 | 2937098953 | |||
| 1309 | 2937103696 | |||
| 1310 | 2937111589 | |||
| 1311 | 2937118241 | |||
| 1312 | 2937121117 | |||
| 1313 | 2937130154 | |||
| 1314 | 2941500322 | |||
| 1315 | 2957385137 | |||
| 1316 | 2957389200 | |||
| 1317 | 2957402675 | |||
| 1318 | 2957415211 | |||
| 1319 | 2957418018 | |||
| 1320 | 2957425803 | |||
| 1321 | 2957433143 | |||
| 1322 | 2957449908 | |||
| 1323 | 2957453508 | |||
| 1324 | 2957457828 | |||
| 1325 | 2957466446 | |||
| 1326 | 2957473983 | |||
| 1327 | 2957483731 | |||
| 1328 | 2957485858 | |||
| 1329 | 2957495927 | |||
| 1330 | 2957499810 | |||
| 1331 | 2957510303 | |||
| 1332 | 2960587126 | |||
| 1333 | 2960600643 | |||
| 1334 | 2960609420 | |||
| 1335 | 2960613798 | |||
| 1336 | 2960617638 | |||
| 1337 | 2960625480 | |||
| 1338 | 2960642343 | |||
| 1339 | 2960652778 | |||
| 1340 | 2960656797 | |||
| 1341 | 2960662315 | |||
| 1342 | 2960673857 | |||
| 1343 | 2960676136 | |||
| 1344 | 2960691072 | |||
| 1345 | 2964612094 | |||
| 1346 | 2964623233 | |||
| 1347 | 2964633185 | |||
| 1348 | 2964642114 | |||
| 1349 | 2964648742 | |||
| 1350 | 2964653034 | |||
| 1351 | 2964661096 | |||
| 1352 | 2964666041 | |||
| 1353 | 2964677680 | |||
| 1354 | 2964683678 | |||
| 1355 | 2964689155 | |||
| 1356 | 2964695773 | |||
| 1357 | 2964701881 | |||
| 1358 | 2964712390 | |||
| 1359 | 2964718630 | |||
| 1360 | 2964726204 | |||
| 1361 | 2967669707 | |||
| 1362 | 2967673703 | |||
| 1363 | 2967678856 | |||
| 1364 | 2967693177 | |||
| 1365 | 2967702590 | |||
| 1366 | 2967709235 | |||
| 1367 | 2967716598 | |||
| 1368 | 2967724790 | |||
| 1369 | 2967740966 | |||
| 1370 | 2967746063 | |||
| 1371 | 2967752173 | |||
| 1372 | 2967763751 | |||
| 1373 | 2967773125 | |||
| 1374 | 2967777195 | |||
| 1375 | 2970026002 | |||
| 1376 | 2970039146 | |||
| 1377 | 2970047626 | |||
| 1378 | 2970049987 | |||
| 1379 | 2970059676 | |||
| 1380 | 2970067858 | |||
| 1381 | 2970074952 | |||
| 1382 | 2970076432 | |||
| 1383 | 2970086619 | |||
| 1384 | 2970093471 | |||
| 1385 | 2970101672 | |||
| 1386 | 2970109887 | |||
| 1387 | 2970118036 | |||
| 1388 | 2970129450 | |||
| 1389 | 2970136959 | |||
| 1390 | 2970153882 | |||
| 1391 | 2970162382 | |||
| 1392 | 2970167436 | |||
| 1393 | 2970171537 | |||
| 1394 | 2970182202 | |||
| 1395 | 2970189424 | |||
| 1396 | 2970198392 | |||
| 1397 | 2977518637 | |||
| 1398 | 2977527207 | |||
| 1399 | 2977537921 | |||
| 1400 | 2977551918 | |||
| 1401 | 2977563130 | |||
| 1402 | 2977568911 | |||
| 1403 | 2977579029 | |||
| 1404 | 2977581562 | |||
| 1405 | 2978973655 | |||
| 1406 | 2979093603 | |||
| 1407 | 2979099009 | |||
| 1408 | 2979105583 | |||
| 1409 | 2984512569 | |||
| 1410 | 2984521070 | |||
| 1411 | 2984540364 | |||
| 1412 | 2984591929 | |||
| 1413 | 2984602561 | |||
| 1414 | 2989771932 | |||
| 1415 | 2989778051 | |||
| 1416 | 3005417727 | |||
| 1417 | 643824987 | |||
| 1418 | 648740535 | |||
| 1419 | 650739416 | |||
| 1420 | 8003570458 | |||
| 1421 | 8003992796 | |||
| 1422 | 8005246707 | |||
| 1423 | 8005315083 | |||
| 1424 | 8005318064 | |||
| 1425 | 8005485745 | |||
| 1426 | 8005648112 | |||
| 1427 | 8005660085 | |||
| 1428 | 8005684719 | |||
| 1429 | 8024489866 | |||
| 1430 | 8046767549 | |||
| 1431 | 8049293816 | |||
| 1432 | 8054461768 | |||
| 1433 | 8054563584 | |||
| 1434 | 8055434057 | |||
| 1435 | 8056880013 | |||
| 1436 | 8057579107 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.8337 | 33 | 123 |
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.8136 | 45 | 122 |
| 4gop-assembly2.cif.gz_Y | structure and conformational change of a replication protein a heterotrimer bound to ssdna | 0.8002 | 52 | 124 |
| 1sr3-assembly1.cif.gz_A | solution structure of the heme chaperone ccme of escherichia coli | 0.7951 | 33 | 132 |
| 8x70-assembly4.cif.gz_D | the crystal structure of ifi16 from biortus. | 0.777 | 47 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8337 | 33 | 123 | 2.40.50.140 |
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8136 | 45 | 122 | 2.40.50.140 |
| 4gopY00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8002 | 52 | 124 | 2.40.50.140 |
| 1sr3A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7951 | 33 | 132 | 2.40.50.140 |
| af_P04994_10_103_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7921 | 50 | 120 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E1XJU7-F1-model_v4 | Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) | 0.9197 | 3 | 132 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A6M4AVV0-F1-model_v4 | Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) | 0.9088 | 1 | 131 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A7J9WQ97-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.894 | 1 | 131 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-L9XQI3-F1-model_v4 | Cytochrome c-type biogenesis protein CcmE | 0.8876 | 34 | 126 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A383D8M9-F1-model_v4 | Uncharacterized protein | 0.8809 | 34 | 130 |
GO:0005886
GO:0017004 GO:0020037 |