F477196

General Info

Members Datasets Scaffolds Average Seq Length
718 659 1436 462

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0112404|Ga0501047_0112404_401_1855
Length 484
Sequence MGAGGGTGPLRMNDTLMAATDLQQPKSPSVETPGAVDTMRHAWRRFWRRVSLYMPKRLYARSLIIVIAPMFLLQSVVAFVFMERNWQTVTLLLSQSVVRDIAAIIDVMETYPHDADYANIIRIAQDRMQLKVDLLPPDPLPPPGPKPFFSTLDEPLSSEITRQINRPFWIDTVGNSKIIEVRIQLENKVLRVFVRRSQAYASNMQVFLLWMIGTSVVLLMIAIPFLRNQIKPILTLAEAAESFGKGRPMPQDFRPRGAEEVRRAGFAFIQMRERIERQIEQRTAMLTGVSHDLRTILTRFKLQLALTGKKGDIEAMNQDIDDMQSMLEGYIAFARGEAAEDTGRFDLNACLNKLTEEAALRKRTISTSLTGDSNVLVRPKAFARLLSNIVGNAFRYARTVEVKAVHGKGSLVVTVDDDGPGIAPAKREEVFKPFVRLDQARNLDSSGTGLGLAIARDIARSHGGDITLEDSPLGGLRAVIRIPA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
29 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
30 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
31 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
32 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
33 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
34 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
59 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
60 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
68 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
72 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
107 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
108 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
112 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
115 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
116 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
117 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
118 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
119 2509276019 Ensifer aridi TW10 Isolate Nodule
120 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
121 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
122 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
123 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
124 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
125 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
126 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
127 2512875024
128 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
129 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
130 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
131 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
132 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
133 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
134 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
135 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
136 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
137 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
138 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
139 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
140 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
141 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
142 2516143018 Ensifer sp. BR816 Isolate Nodule
143 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
144 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
145 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
146 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
147 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
148 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
149 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
150 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
151 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
152 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
153 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
154 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
155 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
156 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
157 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
158 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
159 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
160 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
161 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
162 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
163 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
164 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
165 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
166 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
167 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
168 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
169 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
170 2643221557 Ensifer sp. Root558 Isolate Unclassified
171 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
172 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
173 2643221607 Rhizobium sp. Root73 Isolate Unclassified
174 2643221610 Ensifer sp. Root74 Isolate Unclassified
175 2643221618 Ensifer sp. Root231 Isolate Unclassified
176 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
177 2643221626 Ensifer sp. Root31 Isolate Unclassified
178 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
179 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
180 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
181 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
182 2643221655 Ensifer sp. Root1252 Isolate Unclassified
183 2643221659 Ensifer sp. Root127 Isolate Unclassified
184 2643221668 Ensifer sp. Root423 Isolate Unclassified
185 2643221675 Ensifer sp. Root1298 Isolate Unclassified
186 2643221680 Ensifer sp. Root1312 Isolate Unclassified
187 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
188 2643221688 Rhizobium sp. Root482 Isolate Unclassified
189 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
190 2643221698 Ensifer sp. Root142 Isolate Unclassified
191 2643221712 Ensifer sp. Root258 Isolate Unclassified
192 2643221718 Rhizobium sp. Root268 Isolate Unclassified
193 2643221719 Rhizobium sp. Root274 Isolate Unclassified
194 2643221723 Ensifer sp. Root278 Isolate Unclassified
195 2643221726 Ensifer sp. Root954 Isolate Unclassified
196 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
197 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
198 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
199 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
200 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
201 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
202 2738543024 Aminobacter sp. AP02 Isolate Unclassified
203 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
204 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
205 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
206 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
207 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
208 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
209 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
210 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
211 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
212 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
213 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
214 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
215 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
216 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
217 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
218 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
219 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
220 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
221 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
222 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
223 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
224 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
225 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
226 2844163670 Ensifer sp. 1H6 Isolate Unclassified
227 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
228 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
229 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
230 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
231 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
232 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
233 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
234 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
235 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
236 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
237 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
238 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
239 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
240 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
241 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
242 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
243 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
244 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
245 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
246 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
247 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
248 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
249 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
250 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
251 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
252 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
253 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
254 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
255 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
256 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
257 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
258 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
259 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
260 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
261 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
262 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
263 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
264 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
265 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
266 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
267 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
268 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
269 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
270 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
271 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
272 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
273 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
274 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
275 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
276 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
277 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
278 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
279 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
280 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
281 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
282 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
283 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
284 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
285 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
286 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
287 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
288 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
289 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
290 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
291 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
292 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
293 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
294 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
295 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
296 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
297 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
298 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
299 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
300 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
301 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
302 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
303 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
304 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
305 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
306 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
307 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
308 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
309 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
310 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
311 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
312 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
313 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
314 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
315 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
316 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
317 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
318 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
319 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
320 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
321 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
322 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
323 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
324 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
325 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
326 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
327 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
328 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
329 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
330 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
331 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
332 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
333 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
334 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
335 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
336 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
337 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
338 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
339 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
340 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
341 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
342 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
343 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
344 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
345 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
346 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
347 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
348 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
349 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
350 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
351 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
352 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
353 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
354 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
355 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
356 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
357 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
358 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
359 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
360 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
361 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
362 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
363 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
364 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
365 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
366 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
367 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
368 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
369 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
370 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
371 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
372 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
373 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
374 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
375 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
376 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
377 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
378 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
379 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
380 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
381 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
382 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
383 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
384 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
385 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
386 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
387 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
388 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
389 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
390 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
391 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
392 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
393 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
394 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
395 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
396 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
397 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
398 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
399 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
400 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
401 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
402 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
403 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
404 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
405 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
406 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
407 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
408 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
409 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
410 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
411 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
412 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
413 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
414 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
415 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
416 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
417 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
418 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
419 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
420 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
421 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
422 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
423 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
424 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
425 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
426 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
427 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
428 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
429 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
430 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
431 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
432 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
433 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
434 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
435 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
436 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
437 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
438 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
439 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
440 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
441 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
442 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
443 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
444 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
445 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
446 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
447 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
448 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
449 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
450 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
451 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
452 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
453 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
454 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
455 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
456 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
457 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
458 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
459 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
460 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
461 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
462 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
463 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
464 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
465 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
466 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
467 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
468 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
469 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
470 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
471 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
472 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
473 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
474 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
475 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
476 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
477 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
478 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
479 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
480 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
481 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
482 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
483 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
484 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
485 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
486 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
487 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
488 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
489 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
490 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
491 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
492 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
493 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
494 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
495 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
496 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
497 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
498 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
499 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
500 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
501 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
502 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
503 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
504 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
505 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
506 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
507 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
508 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
509 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
510 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
511 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
512 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
513 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
514 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
515 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
516 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
517 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
518 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
519 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
520 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
521 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
522 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
523 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
524 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
525 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
526 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
527 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
528 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
529 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
530 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
531 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
532 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
533 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
534 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
535 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
536 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
537 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
538 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
539 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
540 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
541 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
542 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
543 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
544 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
545 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
546 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
547 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
548 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
549 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
550 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
551 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
552 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
553 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
554 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
555 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
556 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
557 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
558 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
559 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
560 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
561 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
562 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
563 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
564 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
565 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
566 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
567 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
568 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
569 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
570 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
571 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
572 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
573 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
574 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
575 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
576 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
577 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
578 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
579 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
580 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
581 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
582 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
583 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
584 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
585 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
586 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
587 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
588 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
589 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
590 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
591 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
592 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
593 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
594 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
595 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
596 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
597 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
598 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
599 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
600 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
601 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
602 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
603 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
604 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
605 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
606 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
607 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
608 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
609 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
610 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
611 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
612 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
613 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
614 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
615 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
616 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
617 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
618 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
619 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
620 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
621 3004167301 Mesorhizobium loti 582 Isolate Unclassified
622 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
623 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
624 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
625 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
626 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
627 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
628 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
629 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
630 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
631 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
632 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
633 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
634 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
635 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
636 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
637 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
638 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
639 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
640 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
641 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
642 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
643 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
644 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
645 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
646 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
647 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
648 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
649 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
650 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
651 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
652 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
653 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
654 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
655 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
656 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
657 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
658 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
659 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 23.68
Metatranscriptomes 0
Isolates 76.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 64.76
Rhizoplane 0.56
Rhizosphere 15.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0112404 3300049581 Bacteria 2606
2 JGI24740J21852_10007252 3300001979 Bacteria 4519
3 JGI25156J39149_1003391 3300002705 Bacteria 5241
4 JGI25157J39369_1000755 3300002741 Bacteria 16931
5 JGI25159J45721_1000004 3300002987 Bacteria 215789
6 JGI25165J46597_1000006 3300003214 Bacteria 529784
7 JGI25160J50197_1000021 3300003354 Bacteria 215789
8 JGI25161J50226_1000218 3300003374 Bacteria 36216
9 Ga0055542_1001018 3300003762 Bacteria 17783
10 Ga0055526_1001422 3300003771 Bacteria 17040
11 Ga0055524_1002001 3300003775 Bacteria 10883
12 Ga0055536_1000269 3300003781 Bacteria 39889
13 Ga0055536_1003316 3300003781 Bacteria 8710
14 Ga0055531_10003470 3300003794 Bacteria 10028
15 Ga0055543_1000164 3300004625 Bacteria 55304
16 Ga0065165_1000033 3300005262 Bacteria 215827
17 Ga0068853_100013522 3300005539 Bacteria 6667
18 Ga0075365_10005021 3300006038 Bacteria 7093
19 Ga0075365_10029064 3300006038 Bacteria 3528
20 Ga0075365_10055068 3300006038 Bacteria 2639
21 Ga0075364_10008358 3300006051 Bacteria 6183
22 Ga0075364_10025707 3300006051 Bacteria 3749
23 Ga0075367_10018362 3300006178 Bacteria 3857
24 Ga0075369_10018746 3300006186 Bacteria 2820
25 Ga0105248_10324855 3300009177 Bacteria 1733
26 Ga0105237_10091801 3300009545 Bacteria 3026
27 Ga0105239_10086611 3300010375 Bacteria 3453
28 Ga0105239_10196942 3300010375 Bacteria 2256
29 Ga0157371_10002714 3300013102 Bacteria 16710
30 Ga0157369_10149071 3300013105 Bacteria 2473
31 Ga0171463_1017 3300013249 Bacteria 48649
32 Ga0157374_10322690 3300013296 Bacteria 1530
33 Ga0183363_1050 3300015690 Bacteria 38817
34 Ga0214544_1000010 3300021320 Bacteria 270164
35 Ga0214542_1000023 3300021321 Bacteria 191557
36 Ga0214542_1028547 3300021321 Bacteria 2397
37 Ga0214543_1000019 3300021327 Bacteria 267908
38 Ga0214543_1000022 3300021327 Bacteria 241930
39 Ga0228711_1000026 3300022739 Bacteria 101497
40 Ga0228710_1000005 3300022740 Bacteria 233531
41 Ga0209436_100276 3300025208 Bacteria 23572
42 Ga0209026_1000089 3300025250 Bacteria 175907
43 Ga0209148_1000124 3300025254 Bacteria 185123
44 Ga0209759_1000903 3300025256 Bacteria 22112
45 Ga0209759_1014776 3300025256 Bacteria 2047
46 Ga0209233_1000010 3300025261 Bacteria 1194329
47 Ga0209455_1000062 3300025272 Bacteria 335169
48 Ga0209130_1000017 3300025284 Bacteria 388431
49 Ga0209676_1000876 3300025292 Bacteria 38530
50 Ga0209025_1000161 3300025294 Bacteria 166506
51 Ga0209564_1000013 3300025295 Bacteria 775755
52 Ga0209050_1006499 3300025298 Bacteria 6896
53 Ga0209256_1000153 3300025299 Bacteria 144736
54 Ga0209256_1002058 3300025299 Bacteria 17780
55 Ga0207426_1000006 3300025302 Bacteria 1025969
56 Ga0209257_1008374 3300025304 Bacteria 5900
57 Ga0209257_1021721 3300025304 Bacteria 2320
58 Ga0207647_10005131 3300025904 Bacteria 9642
59 Ga0207695_10069593 3300025913 Bacteria 3601
60 Ga0207695_10078627 3300025913 Bacteria 3346
61 Ga0207671_10076843 3300025914 Bacteria 2499
62 Ga0207639_10014018 3300026041 Bacteria 5625
63 Ga0207678_10108430 3300026067 Bacteria 2369
64 Ga0207678_10146031 3300026067 Bacteria 2019
65 Ga0209281_1000380 3300027111 Bacteria 70330
66 Ga0209281_1000790 3300027111 Bacteria 29937
67 Ga0209282_1000006 3300027666 Bacteria 276998
68 Ga0307515_10000017 3300028794 Bacteria 550465
69 Ga0307515_10001903 3300028794 Bacteria 46429
70 Ga0307515_10016193 3300028794 Bacteria 13668
71 Ga0307515_10193729 3300028794 Bacteria 1933
72 Ga0307513_10002030 3300031456 Bacteria 28510
73 Ga0307513_10085993 3300031456 Bacteria 3226
74 Ga0307408_100074293 3300031548 Bacteria 2522
75 Ga0315914_1000003 3300031967 Bacteria 314370
76 Ga0315913_1000001 3300033430 Bacteria 284459
77 Ga0315915_1000150 3300033464 Bacteria 55572
78 Ga0373925_0007826 3300037068 Bacteria 7782
79 Ga0395899_0000242 3300037312 Bacteria 72733
80 Ga0395900_0000318 3300037418 Bacteria 71328
81 Ga0395898_0000547 3300037466 Bacteria 71322
82 Ga0395905_0000305 3300037471 Bacteria 71315
83 Ga0395905_0000571 3300037471 Bacteria 49947
84 Ga0395905_0007862 3300037471 Bacteria 10560
85 Ga0395905_0062728 3300037471 Bacteria 3476
86 Ga0395901_0000093 3300038443 Bacteria 120300
87 Ga0395901_0051420 3300038443 Bacteria 4284
88 Ga0439436_0000675 3300041404 Bacteria 9161
89 Ga0439438_017582 3300041405 Bacteria 2053
90 Ga0439439_0006761 3300041406 Bacteria 2660
91 Ga0439465_0001804 3300041413 Bacteria 7010
92 Ga0450906_000779 3300042145 Bacteria 6947
93 Ga0439434_0026948 3300042435 Bacteria 1736
94 Ga0466972_0009870 3300044658 Bacteria 4792
95 Ga0466960_0003996 3300044901 Bacteria 5733
96 Ga0495638_0011460 3300046460 Bacteria 6108
97 Ga0495638_0051458 3300046460 Bacteria 2569
98 Ga0495625_0018879 3300046660 Bacteria 5369
99 Ga0495625_0041874 3300046660 Bacteria 3331
100 Ga0496104_0155608 3300048907 Bacteria 2194
101 Ga0496116_0000345 3300048919 Bacteria 73956
102 Ga0496119_0081379 3300048922 Bacteria 1865
103 Ga0496120_0004279 3300048923 Bacteria 12121
104 Ga0496121_0001531 3300048924 Bacteria 38692
105 Ga0496126_0000166 3300048929 Bacteria 152470
106 Ga0496126_0033096 3300048929 Bacteria 4865
107 Ga0496126_0120893 3300048929 Bacteria 2271
108 Ga0501031_0000021 3300049568 Bacteria 95923
109 Ga0501031_0039441 3300049568 Bacteria 3081
110 Ga0501032_0000053 3300049569 Bacteria 100933
111 Ga0501032_0003703 3300049569 Bacteria 11604
112 Ga0501033_0000135 3300049570 Bacteria 71278
113 Ga0501033_0000706 3300049570 Bacteria 30703
114 Ga0501033_0000761 3300049570 Bacteria 29642
115 Ga0501033_0001973 3300049570 Bacteria 17875
116 Ga0501034_0000317 3300049571 Bacteria 85341
117 Ga0501034_0009472 3300049571 Bacteria 10192
118 Ga0501036_0000026 3300049572 Bacteria 100963
119 Ga0501037_0000140 3300049573 Bacteria 67467
120 Ga0501037_0000818 3300049573 Bacteria 23265
121 Ga0501038_0000022 3300049574 Bacteria 151623
122 Ga0501039_0000030 3300049575 Bacteria 130049
123 Ga0501043_0000124 3300049579 Bacteria 70977
124 Ga0501043_0000967 3300049579 Bacteria 25402
125 Ga0501043_0015871 3300049579 Bacteria 5903
126 Ga0501043_0090233 3300049579 Bacteria 2409
127 Ga0501047_0002052 3300049581 Bacteria 19253
128 Ga0501047_0002661 3300049581 Bacteria 16996
129 Ga0501047_0015713 3300049581 Bacteria 7212
130 Ga0501067_0025622 3300049583 Bacteria 3269
131 Ga0501068_0010248 3300049584 Bacteria 5260
132 Ga0501069_0000004 3300049585 Bacteria 192353
133 Ga0501069_0001931 3300049585 Bacteria 10354
134 Ga0501070_0000148 3300049586 Bacteria 64874
135 Ga0501070_0000694 3300049586 Bacteria 30882
136 Ga0501070_0001919 3300049586 Bacteria 18354
137 Ga0501070_0024847 3300049586 Bacteria 5024
138 Ga0501070_0142628 3300049586 Bacteria 1978
139 Ga0501070_0204109 3300049586 Bacteria 1623
140 Ga0501071_0025002 3300049587 Bacteria 4181
141 Ga0501071_0026559 3300049587 Bacteria 4066
142 Ga0501073_0073715 3300049589 Bacteria 2377
143 Ga0501074_0000006 3300049590 Bacteria 112293
144 Ga0501074_0020074 3300049590 Bacteria 4856
145 Ga0501080_0003339 3300049742 Bacteria 14170
146 Ga0501080_0005406 3300049742 Bacteria 11390
147 Ga0501080_0048480 3300049742 Bacteria 3953
148 Ga0501083_0000066 3300049744 Bacteria 71496
149 Ga0501035_0000011 3300049822 Bacteria 305794
150 Ga0501035_0000065 3300049822 Bacteria 129986
151 Ga0501035_0001755 3300049822 Bacteria 21897
152 Ga0501035_0001833 3300049822 Bacteria 21395
153 Ga0501035_0005312 3300049822 Bacteria 12184
154 Ga0501044_0000043 3300049823 Bacteria 151623
155 Ga0501044_0000803 3300049823 Bacteria 37863
156 Ga0501044_0006671 3300049823 Bacteria 12724
157 Ga0501044_0014696 3300049823 Bacteria 8442
158 Ga0501044_0019335 3300049823 Bacteria 7288
159 Ga0501045_0003000 3300049824 Bacteria 11554
160 nmdc:mga00v17_241_c1 3300050491 Bacteria 32423
161 nmdc:mga0yw44_33403_c1 3300050492 Bacteria 3006
162 nmdc:mga0yw44_9634_c1 3300050492 Bacteria 4899
163 nmdc:mga0sz30_52859_c1 3300050516 Bacteria 1725
164 Ga0500559_0003305 3300053136 Bacteria 7999
165 Ga0500573_0000897 3300053140 Bacteria 13507
166 Ga0500616_0015042 3300053153 Bacteria 4434
167 Ga0500620_006007 3300053155 Bacteria 2867
168 Ga0500622_0002353 3300053156 Bacteria 13743
169 Ga0500636_0000003 3300053177 Bacteria 240189
170 Ga0501082_0053386 3300060353 Bacteria 3484
171 2503200333 2503198000 Bacteria 6884444
172 2509108206 2508501122 Bacteria 6292184
173 2509115038 2508501123 Bacteria 6283661
174 2509139560 2508501127 Bacteria 7037543
175 2509373791 2509276018 Bacteria 6910194
176 2509376616 2509276019 Bacteria 6802256
177 2509395139 2509276022 Bacteria 6200534
178 2510305271 2510065057 Bacteria 6649661
179 2510314127 2510065059 Bacteria 6847884
180 2510839557 2510461069 Bacteria 5505000
181 2511502409 2511231052 Bacteria 6974333
182 2512533789 2512047086 Bacteria 6850303
183 2512932301 2512875016 Bacteria 6529530
184 2512960308 2512875024 Bacteria 7195110
185 2512970465 2512875026 Bacteria 6861065
186 2513585055 2513237086 Bacteria 7265287
187 2513601530 2513237089 Bacteria 6553624
188 2513614240 2513237090 Bacteria 7096802
189 2513618100 2513237091 Bacteria 6900273
190 2513884522 2513237140 Bacteria 7076289
191 2513904436 2513237143 Bacteria 6664116
192 2513986566 2513237156 Bacteria 6402557
193 2513997744 2513237159 Bacteria 6810126
194 2514003025 2513237160 Bacteria 6650282
195 2514034588 2513237164 Bacteria 7563725
196 2514419414 2513237305 Bacteria 7293571
197 2514587744 2513237351 Bacteria 6968952
198 2515609208 2515154107 Bacteria 6795637
199 2516206245 2516143018 Bacteria 6951533
200 2516893786 2516653046 Bacteria 6989037
201 2517570497 2517487022 Bacteria 7227575
202 2524448391 2524023207 Bacteria 6813453
203 2551679423 2551306084 Bacteria 8942552
204 2551683551 2551306085 Bacteria 7347181
205 2551688241 2551306085 Bacteria 7347181
206 2551691760 2551306086 Bacteria 6843938
207 2551700906 2551306087 Bacteria 7351905
208 2551713306 2551306089 Bacteria 7162724
209 2551718979 2551306090 Bacteria 7953713
210 2551726821 2551306091 Bacteria 7086830
211 2551737030 2551306092 Bacteria 6992595
212 2551745735 2551306093 Bacteria 7064773
213 2558864023 2558860100 Bacteria 8458965
214 2585167382 2582581283 Bacteria 6030556
215 2585265603 2582581306 Bacteria 6450535
216 2585388808 2582581865 Bacteria 6644329
217 2585395488 2582581866 Bacteria 6859583
218 2585996593 2585427633 Bacteria 6413184
219 2586001121 2585427634 Bacteria 6455027
220 2588518365 2588253730 Bacteria 6881675
221 2597812330 2597489875 Bacteria 7010078
222 2599331955 2599185156 Bacteria 5403036
223 2599936188 2599185301 Bacteria 6161860
224 2600194773 2599185352 Bacteria 7228948
225 2643770802 2643221550 Bacteria 4619371
226 2643776329 2643221551 Bacteria 3750538
227 2643794776 2643221555 Bacteria 3749717
228 2643804267 2643221557 Bacteria 7184309
229 2643839229 2643221564 Bacteria 4193379
230 2643985576 2643221595 Bacteria 6565519
231 2644050295 2643221607 Bacteria 6314006
232 2644064959 2643221610 Bacteria 7480339
233 2644106985 2643221618 Bacteria 7717186
234 2644129674 2643221623 Bacteria 5239945
235 2644148729 2643221626 Bacteria 8069654
236 2644158284 2643221627 Bacteria 6761570
237 2644204643 2643221636 Bacteria 6583769
238 2644208850 2643221637 Bacteria 5345260
239 2644298786 2643221653 Bacteria 4569637
240 2644309945 2643221655 Bacteria 7722067
241 2644331091 2643221659 Bacteria 7890716
242 2644376632 2643221668 Bacteria 7306521
243 2644416632 2643221675 Bacteria 7473456
244 2644449672 2643221680 Bacteria 7473610
245 2644483215 2643221686 Bacteria 6310811
246 2644494362 2643221688 Bacteria 5260751
247 2644499773 2643221689 Bacteria 6042950
248 2644543821 2643221698 Bacteria 7756764
249 2644616400 2643221712 Bacteria 7729434
250 2644652380 2643221718 Bacteria 5345506
251 2644657015 2643221719 Bacteria 4568197
252 2644675895 2643221723 Bacteria 7095460
253 2644689804 2643221726 Bacteria 7455827
254 2657681670 2657244999 Bacteria 5946535
255 2688597503 2687453392 Bacteria 6880454
256 2692315364 2690316117 Bacteria 6800650
257 2694631260 2693429783 Bacteria 7019804
258 2694638742 2693429784 Bacteria 7241525
259 2723574735 2721755686 Bacteria 7343952
260 2739310108 2738543024 Bacteria 5603683
261 2753462303 2751185821 Bacteria 6189929
262 2756671797 2756170246 Bacteria 7451806
263 2776914100 2775507049 Bacteria 6284736
264 2792585012 2791355082 Bacteria 5973319
265 2792620630 2791355091 Bacteria 6135441
266 2792625989 2791355092 Bacteria 6248105
267 2792638930 2791355094 Bacteria 7011481
268 2792751997 2791355123 Bacteria 8049106
269 2793280168 2791355253 Bacteria 5171699
270 2802716822 2802428858 Bacteria 6636079
271 2802725634 2802428859 Bacteria 6667919
272 2802730276 2802428860 Bacteria 6525526
273 2802737753 2802428861 Bacteria 6534206
274 2802742857 2802428862 Bacteria 6633353
275 2802750281 2802428863 Bacteria 6410669
276 2804752858 2802429268 Bacteria 6094027
277 2819241213 2818991272 Bacteria 4622173
278 2838076708 2838074704 Bacteria 6785777
279 2841738338 2841734538 Bacteria 6784580
280 2842522008 2842521101 Bacteria 6569494
281 2842924290 2842922631 Bacteria 5824079
282 2844008269 2844002411 Bacteria 7168230
283 2844012882 2844009547 Bacteria 6728125
284 2844164093 2844163670 Bacteria 7266046
285 2847419575 2847417321 Bacteria 6913799
286 2847675232 2847670302 Bacteria 6165597
287 2847691414 2847686936 Bacteria 6278406
288 2848994577 2848992105 Bacteria 6810864
289 2850081615 2850079185 Bacteria 6848280
290 2855826511 2855825444 Bacteria 6785811
291 2855841902 2855839649 Bacteria 7135830
292 2855872325 2855872281 Bacteria 6964271
293 2856314960 2856314179 Bacteria 6477897
294 2856323408 2856320880 Bacteria 7263508
295 2856329285 2856328259 Bacteria 6528202
296 2856336394 2856334872 Bacteria 7037011
297 2856342078 2856342000 Bacteria 7176905
298 2856353676 2856349417 Bacteria 6230045
299 2856361165 2856356410 Bacteria 6297484
300 2856368292 2856364286 Bacteria 6939991
301 2857351516 2857349434 Bacteria 7926032
302 2857375487 2857367948 Bacteria 6965560
303 2858803701 2858800743 Bacteria 6603254
304 2869163976 2869162929 Bacteria 6399702
305 2869174047 2869169390 Bacteria 6659796
306 2869253318 2869249662 Bacteria 6868783
307 2869261875 2869256925 Bacteria 6981691
308 2869266490 2869264136 Bacteria 6880765
309 2869275398 2869271264 Bacteria 6908218
310 2869282887 2869278585 Bacteria 7077053
311 2869290089 2869285874 Bacteria 6901219
312 2871432373 2871429161 Bacteria 6547891
313 2871436724 2871435913 Bacteria 6880295
314 2871450986 2871444079 Bacteria 6423508
315 2871456658 2871451962 Bacteria 7336357
316 2871462030 2871459585 Bacteria 6866887
317 2871469033 2871466892 Bacteria 6923287
318 2871474888 2871474448 Bacteria 6806570
319 2871492994 2871488783 Bacteria 6929816
320 2871502549 2871495908 Bacteria 6935695
321 2874105627 2874102143 Bacteria 6342645
322 2874127028 2874123672 Bacteria 7238285
323 2874133968 2874131515 Bacteria 6820270
324 2874142548 2874139085 Bacteria 7021506
325 2874152337 2874146452 Bacteria 7533118
326 2874159740 2874155637 Bacteria 6724144
327 2874162849 2874162495 Bacteria 6174670
328 2874168942 2874168670 Bacteria 8062617
329 2876367666 2876363079 Bacteria 6544991
330 2876374924 2876369609 Bacteria 6807521
331 2876389094 2876386047 Bacteria 6698674
332 2876393967 2876392853 Bacteria 6660880
333 2876404156 2876399893 Bacteria 6927900
334 2876409070 2876406927 Bacteria 6191900
335 2876418256 2876413966 Bacteria 6831344
336 2876424247 2876420981 Bacteria 6687741
337 2878042203 2878035449 Bacteria 6555736
338 2878735354 2878730984 Bacteria 6380721
339 2878739210 2878738818 Bacteria 7136951
340 2878749986 2878745973 Bacteria 6867388
341 2878757040 2878753008 Bacteria 6922523
342 2878766441 2878760144 Bacteria 6823465
343 2878773637 2878767105 Bacteria 6898628
344 2878779254 2878774303 Bacteria 6108671
345 2878783698 2878781027 Bacteria 6834456
346 2878795542 2878788777 Bacteria 6567085
347 2881150810 2881147464 Bacteria 7779814
348 2881161343 2881155292 Bacteria 6461656
349 2881167083 2881161766 Bacteria 7127907
350 2881849978 2881845957 Bacteria 6611900
351 2881860590 2881853255 Bacteria 6698367
352 2881866636 2881861095 Bacteria 7128710
353 2882640706 2882632389 Bacteria 8154593
354 2882919579 2882912400 Bacteria 6801539
355 2885308592 2885305155 Bacteria 7348390
356 2885312643 2885312484 Bacteria 6415165
357 2885321457 2885318864 Bacteria 6729568
358 2885331835 2885326080 Bacteria 7134805
359 2885341651 2885334103 Bacteria 7216818
360 2885351611 2885350715 Bacteria 6787678
361 2888338569 2888337043 Bacteria 6629336
362 2888346074 2888343758 Bacteria 6611049
363 2888355392 2888350351 Bacteria 7372807
364 2889010371 2889010040 Bacteria 6749192
365 2889017964 2889016732 Bacteria 6700763
366 2896392149 2896384573 Bacteria 7700774
367 2899804215 2899803654 Bacteria 5577784
368 2903450444 2903448605 Bacteria 7357801
369 2903500766 2903492973 Bacteria 13473544
370 2903503291 2903492973 Bacteria 13473544
371 2903515404 2903513507 Bacteria 6344008
372 2903521817 2903521522 Bacteria 6525694
373 2903528194 2903528002 Bacteria 6586099
374 2903547590 2903540706 Bacteria 7062119
375 2904660298 2904659560 Bacteria 6685615
376 2906312345 2906308376 Bacteria 6841989
377 2906325054 2906321335 Bacteria 6579571
378 2906330404 2906328253 Bacteria 6585166
379 2906356567 2906354277 Bacteria 6991324
380 2906365956 2906363423 Bacteria 6856682
381 2906376399 2906370794 Bacteria 6881062
382 2906378926 2906378014 Bacteria 6911440
383 2906392907 2906386501 Bacteria 5977019
384 2906398034 2906393657 Bacteria 6790866
385 2906405941 2906401398 Bacteria 6693206
386 2906411937 2906408224 Bacteria 6162342
387 2906419604 2906414383 Bacteria 6580790
388 2906432944 2906427513 Bacteria 6375796
389 2913299182 2913295892 Bacteria 6333755
390 2915653242 2915650412 Bacteria 4288180
391 2915982934 2915980308 Bacteria 6624279
392 2915989534 2915986958 Bacteria 6739310
393 2915998399 2915993759 Bacteria 7016183
394 2916003860 2916000859 Bacteria 6865702
395 2916011784 2916007675 Bacteria 6898660
396 2916019622 2916014648 Bacteria 6946486
397 2916023776 2916021584 Bacteria 6854472
398 2916031924 2916028427 Bacteria 6748433
399 2916037630 2916035215 Bacteria 6755766
400 2916046101 2916041962 Bacteria 6820487
401 2916050326 2916048683 Bacteria 6543552
402 2916058015 2916055098 Bacteria 6758838
403 2916066392 2916061851 Bacteria 6737736
404 2916068825 2916068649 Bacteria 6943657
405 2916082312 2916076590 Bacteria 6596108
406 2920761368 2920760137 Bacteria 7427611
407 2920825417 2920822456 Bacteria 6897201
408 2921203896 2921201388 Bacteria 6926299
409 2921211782 2921208531 Bacteria 6745326
410 2921243004 2921237296 Bacteria 6876710
411 2921246047 2921244191 Bacteria 6568419
412 2921253783 2921250672 Bacteria 6677771
413 2921260856 2921257292 Bacteria 6808382
414 2921266876 2921263974 Bacteria 6864552
415 2921286475 2921282425 Bacteria 6826397
416 2921294996 2921289301 Bacteria 7316391
417 2921300199 2921296804 Bacteria 7176999
418 2922133849 2922130491 Bacteria 7173936
419 2922155862 2922151315 Bacteria 6902399
420 2922164921 2922158528 Bacteria 6573167
421 2922173627 2922172374 Bacteria 6167644
422 2922180772 2922178524 Bacteria 6025201
423 2922187203 2922185730 Bacteria 7113964
424 2924147476 2924144063 Bacteria 6883928
425 2924156806 2924150972 Bacteria 7169444
426 2924160905 2924158325 Bacteria 7188855
427 2924171520 2924165586 Bacteria 7260590
428 2924175396 2924172951 Bacteria 6749356
429 2924182595 2924179722 Bacteria 6843264
430 2924189187 2924186466 Bacteria 6876637
431 2924197023 2924193448 Bacteria 6955718
432 2924206938 2924200457 Bacteria 6757188
433 2924208028 2924207177 Bacteria 6917007
434 2924214420 2924214083 Bacteria 7080103
435 2924228472 2924221636 Bacteria 7113495
436 2924232244 2924228884 Bacteria 6633132
437 2924710639 2924710171 Bacteria 6752351
438 2924720483 2924718760 Bacteria 6331356
439 2924740611 2924733363 Bacteria 7574837
440 2924744948 2924741084 Bacteria 6661321
441 2924753352 2924748358 Bacteria 6154725
442 2924755892 2924754689 Bacteria 6774424
443 2924763758 2924762789 Bacteria 6561353
444 2924776675 2924776078 Bacteria 7492003
445 2924786343 2924784321 Bacteria 7416538
446 2937002671 2936996657 Bacteria 6298727
447 2937005684 2937002841 Bacteria 6934057
448 2937012261 2937009748 Bacteria 6746052
449 2937019256 2937016420 Bacteria 6782579
450 2937027535 2937023124 Bacteria 6815156
451 2937030985 2937029754 Bacteria 6424026
452 2937038382 2937036028 Bacteria 6846469
453 2937048148 2937042894 Bacteria 6741576
454 2937054159 2937049772 Bacteria 6757901
455 2937061112 2937056579 Bacteria 7107896
456 2937069002 2937063883 Bacteria 7199456
457 2937074573 2937071275 Bacteria 6984483
458 2937080589 2937078374 Bacteria 6610289
459 2937090762 2937084907 Bacteria 6618516
460 2937098021 2937091812 Bacteria 6979387
461 2937102364 2937098957 Bacteria 7249374
462 2937111983 2937106411 Bacteria 6947143
463 2937117785 2937113482 Bacteria 6505872
464 2937122961 2937119839 Bacteria 6597547
465 2937131782 2937126314 Bacteria 6771275
466 2937819513 2937813078 Bacteria 7783518
467 2937829032 2937822353 Bacteria 7290551
468 2937839600 2937836603 Bacteria 6811263
469 2937850948 2937848649 Bacteria 6983481
470 2937863496 2937861824 Bacteria 6660327
471 2937880835 2937877337 Bacteria 7246526
472 2937897457 2937891427 Bacteria 6357007
473 2937977027 2937972304 Bacteria 7532020
474 2938001465 2937994558 Bacteria 7036190
475 2938019523 2938014810 Bacteria 6700592
476 2939671822 2939669807 Bacteria 5028511
477 2941504802 2941499720 Bacteria 7599444
478 2957380797 2957375807 Bacteria 6425588
479 2957385382 2957382221 Bacteria 6737050
480 2957392038 2957388812 Bacteria 6778072
481 2957401816 2957395598 Bacteria 6822399
482 2957405848 2957402308 Bacteria 6741770
483 2957414407 2957408893 Bacteria 6558585
484 2957420408 2957415311 Bacteria 6991633
485 2957425430 2957422303 Bacteria 7172205
486 2957433436 2957430029 Bacteria 7022557
487 2957440618 2957437181 Bacteria 6568994
488 2957445616 2957443900 Bacteria 6869977
489 2957457158 2957450854 Bacteria 6765715
490 2957460527 2957457609 Bacteria 6967680
491 2957469009 2957464669 Bacteria 6568877
492 2957473005 2957471148 Bacteria 6797643
493 2957481380 2957478035 Bacteria 6756658
494 2957487889 2957484790 Bacteria 6703082
495 2957493060 2957491536 Bacteria 6695180
496 2957500004 2957498199 Bacteria 7126688
497 2957512152 2957505466 Bacteria 7253085
498 2958039670 2958034702 Bacteria 6989922
499 2958052701 2958041894 Bacteria 13082850
500 2958069379 2958064165 Bacteria 7158582
501 2958073971 2958071322 Bacteria 6815895
502 2958088609 2958084443 Bacteria 7312792
503 2958097975 2958092219 Bacteria 6861151
504 2958107920 2958100919 Bacteria 6800575
505 2958113038 2958108152 Bacteria 6681128
506 2958116437 2958115193 Bacteria 6923548
507 2958125697 2958122699 Bacteria 7280457
508 2958134476 2958130278 Bacteria 6897202
509 2958148218 2958144490 Bacteria 6677056
510 2958159338 2958158011 Bacteria 6058449
511 2958171619 2958165035 Bacteria 6906348
512 2958178084 2958172287 Bacteria 6716688
513 2958180957 2958179912 Bacteria 6874908
514 2960590659 2960584000 Bacteria 6864594
515 2960594122 2960591022 Bacteria 6622873
516 2960603778 2960597568 Bacteria 6550735
517 2960606368 2960603979 Bacteria 6898737
518 2960615751 2960610863 Bacteria 6691244
519 2960619776 2960617483 Bacteria 6727748
520 2960627328 2960624210 Bacteria 6875384
521 2960635119 2960631154 Bacteria 6732508
522 2960643866 2960637947 Bacteria 7296468
523 2960648935 2960645483 Bacteria 7211087
524 2960658228 2960652885 Bacteria 7083688
525 2960662989 2960660292 Bacteria 7041660
526 2960668103 2960667422 Bacteria 6763020
527 2960677866 2960674078 Bacteria 6609048
528 2960680913 2960680706 Bacteria 6624464
529 2960690991 2960687367 Bacteria 6535474
530 2960698352 2960693952 Bacteria 6749742
531 2961078794 2961077736 Bacteria 7079850
532 2961115622 2961114664 Bacteria 6680456
533 2961131370 2961127735 Bacteria 7196641
534 2961137962 2961136820 Bacteria 6775228
535 2961170060 2961163497 Bacteria 6901077
536 2961175632 2961170736 Bacteria 7072258
537 2961186909 2961183825 Bacteria 6688536
538 2963646903 2963644680 Bacteria 6530403
539 2964608835 2964607997 Bacteria 7101408
540 2964620782 2964615318 Bacteria 6809089
541 2964625588 2964621998 Bacteria 6834995
542 2964631345 2964628898 Bacteria 7083044
543 2964642881 2964636051 Bacteria 7091832
544 2964643827 2964643177 Bacteria 6820887
545 2964652384 2964649959 Bacteria 6675118
546 2964659926 2964656573 Bacteria 7100150
547 2964665400 2964663802 Bacteria 7019362
548 2964675492 2964670856 Bacteria 6851364
549 2964679672 2964678106 Bacteria 6792020
550 2964685403 2964685014 Bacteria 6839111
551 2964697498 2964691889 Bacteria 6802758
552 2964700916 2964698721 Bacteria 6765331
553 2964707834 2964705432 Bacteria 7114648
554 2964718106 2964712639 Bacteria 6695970
555 2964724205 2964719344 Bacteria 7286602
556 2965024811 2965018300 Bacteria 6883036
557 2965029744 2965025482 Bacteria 6532201
558 2965032302 2965032056 Bacteria 6887443
559 2965043227 2965040258 Bacteria 6855979
560 2965055370 2965047637 Bacteria 6623551
561 2965065221 2965062239 Bacteria 7412989
562 2965093329 2965089291 Bacteria 6866420
563 2965107037 2965102966 Bacteria 6800987
564 2965113197 2965110997 Bacteria 6693150
565 2965119543 2965119406 Bacteria 6956431
566 2967669021 2967664464 Bacteria 6948836
567 2967673882 2967671571 Bacteria 7021409
568 2967680410 2967678726 Bacteria 7264382
569 2967691157 2967686174 Bacteria 6678622
570 2967695937 2967693043 Bacteria 6804451
571 2967701718 2967699805 Bacteria 6854538
572 2967711922 2967706974 Bacteria 7186053
573 2967717419 2967714385 Bacteria 7000047
574 2967725497 2967721400 Bacteria 7073753
575 2967729391 2967728569 Bacteria 6641507
576 2967735830 2967735183 Bacteria 6827012
577 2967748036 2967742019 Bacteria 6794534
578 2967750761 2967748971 Bacteria 6733771
579 2967758605 2967755722 Bacteria 6814706
580 2967764920 2967762386 Bacteria 6923502
581 2967774986 2967769361 Bacteria 6587838
582 2967780971 2967775926 Bacteria 6738189
583 2967999311 2967996073 Bacteria 6787468
584 2968007724 2968003550 Bacteria 6929263
585 2968021000 2968016561 Bacteria 7022047
586 2968088296 2968083720 Bacteria 7351627
587 2968095051 2968091066 Bacteria 6052692
588 2968101484 2968097103 Bacteria 6107094
589 2968111355 2968110612 Bacteria 6814636
590 2968119621 2968117919 Bacteria 6536078
591 2968130609 2968128360 Bacteria 6270294
592 2968143061 2968138860 Bacteria 6605449
593 2968178452 2968171901 Bacteria 6894245
594 2970025562 2970019648 Bacteria 7072033
595 2970028119 2970026789 Bacteria 6785236
596 2970036875 2970033650 Bacteria 7118744
597 2970043771 2970040964 Bacteria 6731123
598 2970053311 2970047711 Bacteria 7088379
599 2970058550 2970054988 Bacteria 6611507
600 2970068700 2970061556 Bacteria 7099761
601 2970074793 2970068827 Bacteria 7123112
602 2970078569 2970076120 Bacteria 6697332
603 2970086552 2970082768 Bacteria 6183754
604 2970090561 2970088815 Bacteria 6933825
605 2970098509 2970095765 Bacteria 6936963
606 2970104068 2970102677 Bacteria 6812532
607 2970111728 2970109326 Bacteria 6863976
608 2970118819 2970116247 Bacteria 6501857
609 2970126548 2970122695 Bacteria 6625855
610 2970132000 2970129317 Bacteria 6806560
611 2970137623 2970136068 Bacteria 7207982
612 2970145786 2970143518 Bacteria 6446480
613 2970152387 2970149975 Bacteria 6779706
614 2970161497 2970156795 Bacteria 7168044
615 2970164468 2970164137 Bacteria 6861252
616 2970175273 2970170962 Bacteria 6876229
617 2970180614 2970177841 Bacteria 6768001
618 2970188859 2970184632 Bacteria 7054431
619 2970194738 2970191845 Bacteria 7032787
620 2970474297 2970469710 Bacteria 6969209
621 2970494466 2970489779 Bacteria 6517260
622 2970508220 2970503327 Bacteria 7099517
623 2970511457 2970510686 Bacteria 7006402
624 2970527591 2970524798 Bacteria 6840927
625 2970534904 2970532167 Bacteria 6553173
626 2970544211 2970540015 Bacteria 6977556
627 2970554178 2970547951 Bacteria 6931819
628 2970561297 2970554993 Bacteria 6814252
629 2970597496 2970593180 Bacteria 7073582
630 2970624416 2970619444 Bacteria 6986144
631 2970628597 2970627176 Bacteria 6680862
632 2977523146 2977516862 Bacteria 6940108
633 2977524799 2977523885 Bacteria 6960446
634 2977535661 2977530762 Bacteria 6951399
635 2977541146 2977537788 Bacteria 6929320
636 2977549362 2977544691 Bacteria 6875412
637 2977553722 2977551784 Bacteria 7125765
638 2977562550 2977558990 Bacteria 6863948
639 2977566640 2977565890 Bacteria 6901543
640 2977576010 2977572785 Bacteria 6763888
641 2977584605 2977579622 Bacteria 6772100
642 2977826199 2977821940 Bacteria 6906439
643 2977848133 2977843712 Bacteria 6753583
644 2977853698 2977851361 Bacteria 6694324
645 2977864635 2977858184 Bacteria 6215359
646 2977869074 2977864932 Bacteria 7534097
647 2977878070 2977872689 Bacteria 7270173
648 2977905248 2977898635 Bacteria 6675551
649 2977913203 2977907340 Bacteria 6577984
650 2977919949 2977915119 Bacteria 6829656
651 2977923630 2977922695 Bacteria 6956781
652 2977936534 2977935797 Bacteria 6252826
653 2977944501 2977942078 Bacteria 7570577
654 2977952784 2977950692 Bacteria 6893264
655 2977959186 2977957713 Bacteria 6877875
656 2977976515 2977971508 Bacteria 7472917
657 2977990463 2977986579 Bacteria 6581278
658 2979710591 2979710463 Bacteria 6785254
659 2979745886 2979742915 Bacteria 7301278
660 2979771306 2979764755 Bacteria 6610066
661 2979777912 2979772303 Bacteria 6618277
662 2979786235 2979779861 Bacteria 6219781
663 2979795832 2979793036 Bacteria 6808957
664 2979813404 2979808191 Bacteria 7179355
665 2987638700 2987636660 Bacteria 8088555
666 2987646520 2987645492 Bacteria 6117018
667 2987654265 2987652177 Bacteria 6969023
668 2987666301 2987659509 Bacteria 6966464
669 2987669930 2987666974 Bacteria 6509233
670 2987676208 2987673487 Bacteria 6884027
671 2989775724 2989771324 Bacteria 5605128
672 2989779343 2989776772 Bacteria 4843317
673 2996314393 2996310559 Bacteria 6357320
674 2996339894 2996336353 Bacteria 5511628
675 2996343704 2996341866 Bacteria 6643098
676 2996352367 2996348954 Bacteria 7239054
677 2996390292 2996386984 Bacteria 6978667
678 3000139875 3000135777 Bacteria 6891109
679 3003934380 3003930520 Bacteria 5667563
680 3004167934 3004167301 Bacteria 8330599
681 3004195307 3004188549 Bacteria 6952365
682 3004197145 3004195979 Bacteria 6776956
683 3004205057 3004203850 Bacteria 7307914
684 3004215311 3004211236 Bacteria 7417683
685 3004225846 3004218560 Bacteria 7421728
686 3004236680 3004232784 Bacteria 6662140
687 3004244593 3004239961 Bacteria 6892290
688 3004255550 3004248173 Bacteria 6563236
689 3004275555 3004268573 Bacteria 7043476
690 3004279049 3004275668 Bacteria 7114440
691 3004295304 3004289098 Bacteria 6135450
692 3004335427 3004334049 Bacteria 8449246
693 637075401 637000159 Bacteria 7596297
694 643826483 643692032 Bacteria 6891900
695 648738134 648276728 Bacteria 6968865
696 649872052 649633066 Bacteria 6690028
697 8002289313 8002285264 Bacteria 6717907
698 8003994333 8003992118 Bacteria 7266902
699 8004002032 8003999396 Bacteria 7063185
700 8004301122 8004300914 Bacteria 6132239
701 8004315602 8004312739 Bacteria 7444653
702 8004378615 8004374579 Bacteria 6898112
703 8004392294 8004387939 Bacteria 7049250
704 8004395662 8004395343 Bacteria 6620908
705 8004449202 8004445564 Bacteria 6322258
706 8004638701 8004633249 Bacteria 6723080
707 8004641134 8004640170 Bacteria 6723001
708 8004700688 8004695233 Bacteria 6731676
709 8004708872 8004703790 Bacteria 8006957
710 8004718604 8004714634 Bacteria 6776161
711 8004733554 8004727605 Bacteria 6643904
712 8005248889 8005246636 Bacteria 4933972
713 8005658922 8005658619 Bacteria 4500593
714 8018152778 8018150411 Bacteria 5549903
715 8049295442 8049293176 Bacteria 6128433
716 8055432465 8055431914 Bacteria 4551896
717 8055619803 8055617313 Bacteria 7548464
718 8056875704 8056875544 Bacteria 4355797
719 Ga0501047_0112404
720 JGI24740J21852_10007252
721 JGI25156J39149_1003391
722 JGI25157J39369_1000755
723 JGI25159J45721_1000004
724 JGI25165J46597_1000006
725 JGI25160J50197_1000021
726 JGI25161J50226_1000218
727 Ga0055542_1001018
728 Ga0055526_1001422
729 Ga0055524_1002001
730 Ga0055536_1000269
731 Ga0055536_1003316
732 Ga0055531_10003470
733 Ga0055543_1000164
734 Ga0065165_1000033
735 Ga0068853_100013522
736 Ga0075365_10005021
737 Ga0075365_10029064
738 Ga0075365_10055068
739 Ga0075364_10008358
740 Ga0075364_10025707
741 Ga0075367_10018362
742 Ga0075369_10018746
743 Ga0105248_10324855
744 Ga0105237_10091801
745 Ga0105239_10086611
746 Ga0105239_10196942
747 Ga0157371_10002714
748 Ga0157369_10149071
749 Ga0171463_1017
750 Ga0157374_10322690
751 Ga0183363_1050
752 Ga0214544_1000010
753 Ga0214542_1000023
754 Ga0214542_1028547
755 Ga0214543_1000019
756 Ga0214543_1000022
757 Ga0228711_1000026
758 Ga0228710_1000005
759 Ga0209436_100276
760 Ga0209026_1000089
761 Ga0209148_1000124
762 Ga0209759_1000903
763 Ga0209759_1014776
764 Ga0209233_1000010
765 Ga0209455_1000062
766 Ga0209130_1000017
767 Ga0209676_1000876
768 Ga0209025_1000161
769 Ga0209564_1000013
770 Ga0209050_1006499
771 Ga0209256_1000153
772 Ga0209256_1002058
773 Ga0207426_1000006
774 Ga0209257_1008374
775 Ga0209257_1021721
776 Ga0207647_10005131
777 Ga0207695_10069593
778 Ga0207695_10078627
779 Ga0207671_10076843
780 Ga0207639_10014018
781 Ga0207678_10108430
782 Ga0207678_10146031
783 Ga0209281_1000380
784 Ga0209281_1000790
785 Ga0209282_1000006
786 Ga0307515_10000017
787 Ga0307515_10001903
788 Ga0307515_10016193
789 Ga0307515_10193729
790 Ga0307513_10002030
791 Ga0307513_10085993
792 Ga0307408_100074293
793 Ga0315914_1000003
794 Ga0315913_1000001
795 Ga0315915_1000150
796 Ga0373925_0007826
797 Ga0395899_0000242
798 Ga0395900_0000318
799 Ga0395898_0000547
800 Ga0395905_0000305
801 Ga0395905_0000571
802 Ga0395905_0007862
803 Ga0395905_0062728
804 Ga0395901_0000093
805 Ga0395901_0051420
806 Ga0439436_0000675
807 Ga0439438_017582
808 Ga0439439_0006761
809 Ga0439465_0001804
810 Ga0450906_000779
811 Ga0439434_0026948
812 Ga0466972_0009870
813 Ga0466960_0003996
814 Ga0495638_0011460
815 Ga0495638_0051458
816 Ga0495625_0018879
817 Ga0495625_0041874
818 Ga0496104_0155608
819 Ga0496116_0000345
820 Ga0496119_0081379
821 Ga0496120_0004279
822 Ga0496121_0001531
823 Ga0496126_0000166
824 Ga0496126_0033096
825 Ga0496126_0120893
826 Ga0501031_0000021
827 Ga0501031_0039441
828 Ga0501032_0000053
829 Ga0501032_0003703
830 Ga0501033_0000135
831 Ga0501033_0000706
832 Ga0501033_0000761
833 Ga0501033_0001973
834 Ga0501034_0000317
835 Ga0501034_0009472
836 Ga0501036_0000026
837 Ga0501037_0000140
838 Ga0501037_0000818
839 Ga0501038_0000022
840 Ga0501039_0000030
841 Ga0501043_0000124
842 Ga0501043_0000967
843 Ga0501043_0015871
844 Ga0501043_0090233
845 Ga0501047_0002052
846 Ga0501047_0002661
847 Ga0501047_0015713
848 Ga0501067_0025622
849 Ga0501068_0010248
850 Ga0501069_0000004
851 Ga0501069_0001931
852 Ga0501070_0000148
853 Ga0501070_0000694
854 Ga0501070_0001919
855 Ga0501070_0024847
856 Ga0501070_0142628
857 Ga0501070_0204109
858 Ga0501071_0025002
859 Ga0501071_0026559
860 Ga0501073_0073715
861 Ga0501074_0000006
862 Ga0501074_0020074
863 Ga0501080_0003339
864 Ga0501080_0005406
865 Ga0501080_0048480
866 Ga0501083_0000066
867 Ga0501035_0000011
868 Ga0501035_0000065
869 Ga0501035_0001755
870 Ga0501035_0001833
871 Ga0501035_0005312
872 Ga0501044_0000043
873 Ga0501044_0000803
874 Ga0501044_0006671
875 Ga0501044_0014696
876 Ga0501044_0019335
877 Ga0501045_0003000
878 nmdc:mga00v17_241_c1
879 nmdc:mga0yw44_33403_c1
880 nmdc:mga0yw44_9634_c1
881 nmdc:mga0sz30_52859_c1
882 Ga0500559_0003305
883 Ga0500573_0000897
884 Ga0500616_0015042
885 Ga0500620_006007
886 Ga0500622_0002353
887 Ga0500636_0000003
888 Ga0501082_0053386
889 2503200333
890 2509108206
891 2509115038
892 2509139560
893 2509373791
894 2509376616
895 2509395139
896 2510305271
897 2510314127
898 2510839557
899 2511502409
900 2512533789
901 2512932301
902 2512960308
903 2512970465
904 2513585055
905 2513601530
906 2513614240
907 2513618100
908 2513884522
909 2513904436
910 2513986566
911 2513997744
912 2514003025
913 2514034588
914 2514419414
915 2514587744
916 2515609208
917 2516206245
918 2516893786
919 2517570497
920 2524448391
921 2551679423
922 2551683551
923 2551688241
924 2551691760
925 2551700906
926 2551713306
927 2551718979
928 2551726821
929 2551737030
930 2551745735
931 2558864023
932 2585167382
933 2585265603
934 2585388808
935 2585395488
936 2585996593
937 2586001121
938 2588518365
939 2597812330
940 2599331955
941 2599936188
942 2600194773
943 2643770802
944 2643776329
945 2643794776
946 2643804267
947 2643839229
948 2643985576
949 2644050295
950 2644064959
951 2644106985
952 2644129674
953 2644148729
954 2644158284
955 2644204643
956 2644208850
957 2644298786
958 2644309945
959 2644331091
960 2644376632
961 2644416632
962 2644449672
963 2644483215
964 2644494362
965 2644499773
966 2644543821
967 2644616400
968 2644652380
969 2644657015
970 2644675895
971 2644689804
972 2657681670
973 2688597503
974 2692315364
975 2694631260
976 2694638742
977 2723574735
978 2739310108
979 2753462303
980 2756671797
981 2776914100
982 2792585012
983 2792620630
984 2792625989
985 2792638930
986 2792751997
987 2793280168
988 2802716822
989 2802725634
990 2802730276
991 2802737753
992 2802742857
993 2802750281
994 2804752858
995 2819241213
996 2838076708
997 2841738338
998 2842522008
999 2842924290
1000 2844008269
1001 2844012882
1002 2844164093
1003 2847419575
1004 2847675232
1005 2847691414
1006 2848994577
1007 2850081615
1008 2855826511
1009 2855841902
1010 2855872325
1011 2856314960
1012 2856323408
1013 2856329285
1014 2856336394
1015 2856342078
1016 2856353676
1017 2856361165
1018 2856368292
1019 2857351516
1020 2857375487
1021 2858803701
1022 2869163976
1023 2869174047
1024 2869253318
1025 2869261875
1026 2869266490
1027 2869275398
1028 2869282887
1029 2869290089
1030 2871432373
1031 2871436724
1032 2871450986
1033 2871456658
1034 2871462030
1035 2871469033
1036 2871474888
1037 2871492994
1038 2871502549
1039 2874105627
1040 2874127028
1041 2874133968
1042 2874142548
1043 2874152337
1044 2874159740
1045 2874162849
1046 2874168942
1047 2876367666
1048 2876374924
1049 2876389094
1050 2876393967
1051 2876404156
1052 2876409070
1053 2876418256
1054 2876424247
1055 2878042203
1056 2878735354
1057 2878739210
1058 2878749986
1059 2878757040
1060 2878766441
1061 2878773637
1062 2878779254
1063 2878783698
1064 2878795542
1065 2881150810
1066 2881161343
1067 2881167083
1068 2881849978
1069 2881860590
1070 2881866636
1071 2882640706
1072 2882919579
1073 2885308592
1074 2885312643
1075 2885321457
1076 2885331835
1077 2885341651
1078 2885351611
1079 2888338569
1080 2888346074
1081 2888355392
1082 2889010371
1083 2889017964
1084 2896392149
1085 2899804215
1086 2903450444
1087 2903500766
1088 2903503291
1089 2903515404
1090 2903521817
1091 2903528194
1092 2903547590
1093 2904660298
1094 2906312345
1095 2906325054
1096 2906330404
1097 2906356567
1098 2906365956
1099 2906376399
1100 2906378926
1101 2906392907
1102 2906398034
1103 2906405941
1104 2906411937
1105 2906419604
1106 2906432944
1107 2913299182
1108 2915653242
1109 2915982934
1110 2915989534
1111 2915998399
1112 2916003860
1113 2916011784
1114 2916019622
1115 2916023776
1116 2916031924
1117 2916037630
1118 2916046101
1119 2916050326
1120 2916058015
1121 2916066392
1122 2916068825
1123 2916082312
1124 2920761368
1125 2920825417
1126 2921203896
1127 2921211782
1128 2921243004
1129 2921246047
1130 2921253783
1131 2921260856
1132 2921266876
1133 2921286475
1134 2921294996
1135 2921300199
1136 2922133849
1137 2922155862
1138 2922164921
1139 2922173627
1140 2922180772
1141 2922187203
1142 2924147476
1143 2924156806
1144 2924160905
1145 2924171520
1146 2924175396
1147 2924182595
1148 2924189187
1149 2924197023
1150 2924206938
1151 2924208028
1152 2924214420
1153 2924228472
1154 2924232244
1155 2924710639
1156 2924720483
1157 2924740611
1158 2924744948
1159 2924753352
1160 2924755892
1161 2924763758
1162 2924776675
1163 2924786343
1164 2937002671
1165 2937005684
1166 2937012261
1167 2937019256
1168 2937027535
1169 2937030985
1170 2937038382
1171 2937048148
1172 2937054159
1173 2937061112
1174 2937069002
1175 2937074573
1176 2937080589
1177 2937090762
1178 2937098021
1179 2937102364
1180 2937111983
1181 2937117785
1182 2937122961
1183 2937131782
1184 2937819513
1185 2937829032
1186 2937839600
1187 2937850948
1188 2937863496
1189 2937880835
1190 2937897457
1191 2937977027
1192 2938001465
1193 2938019523
1194 2939671822
1195 2941504802
1196 2957380797
1197 2957385382
1198 2957392038
1199 2957401816
1200 2957405848
1201 2957414407
1202 2957420408
1203 2957425430
1204 2957433436
1205 2957440618
1206 2957445616
1207 2957457158
1208 2957460527
1209 2957469009
1210 2957473005
1211 2957481380
1212 2957487889
1213 2957493060
1214 2957500004
1215 2957512152
1216 2958039670
1217 2958052701
1218 2958069379
1219 2958073971
1220 2958088609
1221 2958097975
1222 2958107920
1223 2958113038
1224 2958116437
1225 2958125697
1226 2958134476
1227 2958148218
1228 2958159338
1229 2958171619
1230 2958178084
1231 2958180957
1232 2960590659
1233 2960594122
1234 2960603778
1235 2960606368
1236 2960615751
1237 2960619776
1238 2960627328
1239 2960635119
1240 2960643866
1241 2960648935
1242 2960658228
1243 2960662989
1244 2960668103
1245 2960677866
1246 2960680913
1247 2960690991
1248 2960698352
1249 2961078794
1250 2961115622
1251 2961131370
1252 2961137962
1253 2961170060
1254 2961175632
1255 2961186909
1256 2963646903
1257 2964608835
1258 2964620782
1259 2964625588
1260 2964631345
1261 2964642881
1262 2964643827
1263 2964652384
1264 2964659926
1265 2964665400
1266 2964675492
1267 2964679672
1268 2964685403
1269 2964697498
1270 2964700916
1271 2964707834
1272 2964718106
1273 2964724205
1274 2965024811
1275 2965029744
1276 2965032302
1277 2965043227
1278 2965055370
1279 2965065221
1280 2965093329
1281 2965107037
1282 2965113197
1283 2965119543
1284 2967669021
1285 2967673882
1286 2967680410
1287 2967691157
1288 2967695937
1289 2967701718
1290 2967711922
1291 2967717419
1292 2967725497
1293 2967729391
1294 2967735830
1295 2967748036
1296 2967750761
1297 2967758605
1298 2967764920
1299 2967774986
1300 2967780971
1301 2967999311
1302 2968007724
1303 2968021000
1304 2968088296
1305 2968095051
1306 2968101484
1307 2968111355
1308 2968119621
1309 2968130609
1310 2968143061
1311 2968178452
1312 2970025562
1313 2970028119
1314 2970036875
1315 2970043771
1316 2970053311
1317 2970058550
1318 2970068700
1319 2970074793
1320 2970078569
1321 2970086552
1322 2970090561
1323 2970098509
1324 2970104068
1325 2970111728
1326 2970118819
1327 2970126548
1328 2970132000
1329 2970137623
1330 2970145786
1331 2970152387
1332 2970161497
1333 2970164468
1334 2970175273
1335 2970180614
1336 2970188859
1337 2970194738
1338 2970474297
1339 2970494466
1340 2970508220
1341 2970511457
1342 2970527591
1343 2970534904
1344 2970544211
1345 2970554178
1346 2970561297
1347 2970597496
1348 2970624416
1349 2970628597
1350 2977523146
1351 2977524799
1352 2977535661
1353 2977541146
1354 2977549362
1355 2977553722
1356 2977562550
1357 2977566640
1358 2977576010
1359 2977584605
1360 2977826199
1361 2977848133
1362 2977853698
1363 2977864635
1364 2977869074
1365 2977878070
1366 2977905248
1367 2977913203
1368 2977919949
1369 2977923630
1370 2977936534
1371 2977944501
1372 2977952784
1373 2977959186
1374 2977976515
1375 2977990463
1376 2979710591
1377 2979745886
1378 2979771306
1379 2979777912
1380 2979786235
1381 2979795832
1382 2979813404
1383 2987638700
1384 2987646520
1385 2987654265
1386 2987666301
1387 2987669930
1388 2987676208
1389 2989775724
1390 2989779343
1391 2996314393
1392 2996339894
1393 2996343704
1394 2996352367
1395 2996390292
1396 3000139875
1397 3003934380
1398 3004167934
1399 3004195307
1400 3004197145
1401 3004205057
1402 3004215311
1403 3004225846
1404 3004236680
1405 3004244593
1406 3004255550
1407 3004275555
1408 3004279049
1409 3004295304
1410 3004335427
1411 637075401
1412 643826483
1413 648738134
1414 649872052
1415 8002289313
1416 8003994333
1417 8004002032
1418 8004301122
1419 8004315602
1420 8004378615
1421 8004392294
1422 8004395662
1423 8004449202
1424 8004638701
1425 8004641134
1426 8004700688
1427 8004708872
1428 8004718604
1429 8004733554
1430 8005248889
1431 8005658922
1432 8018152778
1433 8049295442
1434 8055432465
1435 8055619803
1436 8056875704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00672

HAMP

HAMP domain

225

277

0.94

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

377

484

0.91

Map