F477206

General Info

Members Datasets Scaffolds Average Seq Length
718 406 1436 249

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2966598605|2966604224
Length 257
Sequence RDFEGLSALVTGGASGIGAAVAAQLLTRGARVAVLDLDPEGAPAGCLALRADVTDDDAVRDAVERAAAGLGGLHTVVSNAGIGSIGTVEDNADEEWTRVLDLNVLGMVRTARHALPHLRRAAAARPGAVSITQTCSIAATAGLPQRALYSASKGAVLSLTLAMAADHVREGIRVNCVNPGTADTPWIGRLLGQAEDPAAERAALDARQPLGRLVSADEVAAAVLYLASPAAASVTGTALAVDGGMQGLRLRPAPPRG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
169 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
170 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
171 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
174 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
175 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
176 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
179 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
321 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
322 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
323 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
324 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
325 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
326 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
327 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
328 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
329 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
332 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
333 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
334 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
335 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
338 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
339 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
340 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
342 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
343 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
344 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
345 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
346 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
347 2643221548 Streptomyces sp. Root55 Isolate Unclassified
348 2643221578 Streptomyces sp. Root63 Isolate Unclassified
349 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
350 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
351 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
352 2643221714 Streptomyces sp. Root264 Isolate Unclassified
353 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
354 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
355 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
356 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
357 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
358 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
359 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
360 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
361 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
362 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
363 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
364 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
365 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
366 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
367 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
368 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
369 2867428634 Streptomyces sp. RP5T Isolate Unclassified
370 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
371 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
372 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
373 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
374 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
375 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
376 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
377 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
378 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
379 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
380 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
381 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
382 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
383 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
384 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
385 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
386 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
387 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
388 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
389 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
390 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
391 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
392 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
393 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
394 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
395 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
396 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
397 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
398 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
399 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
400 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
401 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
402 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
403 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
404 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
405 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
406 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0.28
Isolates 9.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 0.42
Rhizoplane 3.48
Rhizosphere 78.97
Stem 0
Stem Tuber 0.14
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017128 3300001989 Bacteria 2617
2 JGI24739J22299_10042956 3300001989 Bacteria 1497
3 JGI24739J22299_10049648 3300001989 Bacteria 1360
4 JGI24738J21930_10009736 3300002075 Bacteria 2155
5 JGI25152J39213_1000109 3300002773 Bacteria 57724
6 JGI25406J46586_10041231 3300003203 Bacteria 1627
7 JGI25406J46586_10059721 3300003203 Bacteria 1237
8 rootH1_10005650 3300003316 Bacteria 2366
9 rootH1_10026697 3300003316 Bacteria 4176
10 rootH1_10055768 3300003316 Bacteria 7296
11 rootL2_10001330 3300003322 Bacteria 4188
12 rootH1_10015077 3300003323 Bacteria 5583
13 rootH1_10015078 3300003323 Bacteria 3268
14 Ga0070683_100115720 3300005329 Bacteria 2531
15 Ga0070683_100370914 3300005329 Bacteria 1363
16 Ga0070683_100846362 3300005329 Bacteria 877
17 Ga0068869_100123209 3300005334 Bacteria 1985
18 Ga0070680_100018278 3300005336 Bacteria 5537
19 Ga0070680_100065815 3300005336 Bacteria 2971
20 Ga0070682_100051982 3300005337 Bacteria 2563
21 Ga0070682_100268051 3300005337 Bacteria 1239
22 Ga0070660_100044202 3300005339 Bacteria 3406
23 Ga0070675_100392966 3300005354 Bacteria 1236
24 Ga0070709_10012890 3300005434 Bacteria 4685
25 Ga0070709_10052893 3300005434 Bacteria 2555
26 Ga0070709_10167460 3300005434 Bacteria 1533
27 Ga0070714_100051600 3300005435 Bacteria 3507
28 Ga0070714_100090715 3300005435 Bacteria 2677
29 Ga0070714_100226882 3300005435 Bacteria 1719
30 Ga0070713_100014860 3300005436 Bacteria 5795
31 Ga0070713_100103696 3300005436 Bacteria 2468
32 Ga0070713_100157475 3300005436 Bacteria 2025
33 Ga0070713_100236426 3300005436 Bacteria 1662
34 Ga0070713_100504083 3300005436 Bacteria 1142
35 Ga0070710_10004386 3300005437 Bacteria 6683
36 Ga0070710_10032628 3300005437 Unclassified 2822
37 Ga0070710_10064158 3300005437 Unclassified 2100
38 Ga0070711_100016186 3300005439 Bacteria 4732
39 Ga0070678_100075137 3300005456 Bacteria 2542
40 Ga0070681_10073741 3300005458 Bacteria 3375
41 Ga0070706_100262720 3300005467 Bacteria 1611
42 Ga0070707_100066294 3300005468 Bacteria 3470
43 Ga0070698_100009228 3300005471 Bacteria 10585
44 Ga0070699_100076467 3300005518 Bacteria 2914
45 Ga0070684_100065285 3300005535 Bacteria 3194
46 Ga0070684_100321456 3300005535 Bacteria 1421
47 Ga0068853_100095691 3300005539 Bacteria 2619
48 Ga0068853_100170450 3300005539 Bacteria 1969
49 Ga0068853_100302113 3300005539 Bacteria 1480
50 Ga0070672_100122245 3300005543 Bacteria 2132
51 Ga0070665_100111970 3300005548 Bacteria 2732
52 Ga0070665_100217797 3300005548 Bacteria 1910
53 Ga0068855_100009579 3300005563 Bacteria 11688
54 Ga0068855_100439186 3300005563 Bacteria 1425
55 Ga0068857_100627876 3300005577 Bacteria 1017
56 Ga0068857_100687266 3300005577 Bacteria 972
57 Ga0068854_100000781 3300005578 Bacteria 18916
58 Ga0068854_100054481 3300005578 Bacteria 2876
59 Ga0068856_100213535 3300005614 Bacteria 1945
60 Ga0068856_100502046 3300005614 Bacteria 1234
61 Ga0068856_100505448 3300005614 Bacteria 1230
62 Ga0068852_100113891 3300005616 Bacteria 2463
63 Ga0068852_100150038 3300005616 Bacteria 2167
64 Ga0068852_100197985 3300005616 Bacteria 1900
65 Ga0068851_10297548 3300005834 Bacteria 927
66 Ga0081455_10001079 3300005937 Bacteria 34337
67 Ga0081540_1002232 3300005983 Bacteria 15955
68 Ga0081539_10001103 3300005985 Bacteria 49011
69 Ga0081539_10003736 3300005985 Bacteria 18107
70 Ga0081539_10022636 3300005985 Bacteria 4148
71 Ga0081539_10038322 3300005985 Bacteria 2842
72 Ga0081539_10064219 3300005985 Bacteria 1999
73 Ga0070717_10241001 3300006028 Bacteria 1595
74 Ga0070717_10288394 3300006028 Bacteria 1457
75 Ga0075365_10101617 3300006038 Bacteria 1969
76 Ga0075368_10005280 3300006042 Bacteria 4434
77 Ga0075363_100123438 3300006048 Bacteria 1448
78 Ga0075363_100141625 3300006048 Bacteria 1354
79 Ga0075364_10130113 3300006051 Bacteria 1689
80 Ga0070716_100034547 3300006173 Bacteria 2773
81 Ga0070712_100005494 3300006175 Bacteria 7847
82 Ga0075367_10005258 3300006178 Bacteria 6399
83 Ga0075367_10078717 3300006178 Bacteria 1991
84 Ga0075430_100035704 3300006846 Bacteria 4216
85 Ga0075431_100005354 3300006847 Bacteria 12664
86 Ga0075431_100258992 3300006847 Bacteria 1766
87 Ga0075431_100485878 3300006847 Bacteria 1227
88 Ga0075429_100035883 3300006880 Bacteria 4312
89 Ga0099826_10049670 3300006948 Bacteria 2828
90 Ga0105244_10006177 3300009036 Bacteria 7813
91 Ga0105244_10054056 3300009036 Bacteria 2038
92 Ga0105240_10011484 3300009093 Bacteria 12333
93 Ga0114129_10000681 3300009147 Bacteria 42861
94 Ga0105243_10009399 3300009148 Bacteria 7450
95 Ga0105241_10003035 3300009174 Bacteria 12527
96 Ga0105249_10264363 3300009553 Bacteria 1711
97 Ga0105239_10014794 3300010375 Bacteria 8654
98 Ga0105239_10131203 3300010375 Bacteria 2787
99 Ga0105246_10043073 3300011119 Bacteria 3061
100 Ga0105246_10531960 3300011119 Bacteria 1004
101 Ga0105246_10602434 3300011119 Bacteria 950
102 Ga0157370_10057608 3300013104 Bacteria 3693
103 Ga0157369_10114233 3300013105 Bacteria 2868
104 Ga0157369_10129576 3300013105 Bacteria 2674
105 Ga0157369_10457542 3300013105 Bacteria 1321
106 Ga0157374_10122188 3300013296 Bacteria 2514
107 Ga0157372_10137066 3300013307 Bacteria 2819
108 Ga0157372_10360691 3300013307 Bacteria 1693
109 Ga0182008_10000552 3300014497 Bacteria 27794
110 Ga0182008_10000777 3300014497 Bacteria 22348
111 Ga0182007_10000554 3300015262 Bacteria 22069
112 Ga0182007_10000661 3300015262 Bacteria 19773
113 Ga0183367_1011 3300015688 Bacteria 397353
114 Ga0183367_1016 3300015688 Bacteria 290198
115 Ga0206356_10357540 3300020070 Bacteria 1423
116 Ga0224712_10091684 3300022467 Bacteria 1274
117 Ga0209129_1000180 3300025258 Bacteria 90882
118 Ga0209025_1001362 3300025294 Bacteria 32778
119 Ga0209051_1004857 3300025303 Bacteria 8079
120 Ga0207697_10004439 3300025315 Bacteria 6702
121 Ga0207692_10005516 3300025898 Bacteria 5075
122 Ga0207692_10121735 3300025898 Unclassified 1462
123 Ga0207647_10005581 3300025904 Bacteria 9201
124 Ga0207647_10005686 3300025904 Bacteria 9103
125 Ga0207647_10010531 3300025904 Bacteria 6527
126 Ga0207647_10013528 3300025904 Bacteria 5651
127 Ga0207647_10032455 3300025904 Bacteria 3354
128 Ga0207647_10090575 3300025904 Bacteria 1824
129 Ga0207647_10096689 3300025904 Bacteria 1757
130 Ga0207699_10003554 3300025906 Bacteria 7436
131 Ga0207699_10281098 3300025906 Bacteria 1156
132 Ga0207705_10313041 3300025909 Bacteria 1205
133 Ga0207654_10003921 3300025911 Bacteria 7491
134 Ga0207707_10050349 3300025912 Bacteria 3629
135 Ga0207695_10003004 3300025913 Bacteria 24248
136 Ga0207671_10000488 3300025914 Bacteria 53807
137 Ga0207693_10012884 3300025915 Bacteria 6748
138 Ga0207693_10022336 3300025915 Bacteria 5028
139 Ga0207693_10051422 3300025915 Bacteria 3233
140 Ga0207663_10060410 3300025916 Bacteria 2402
141 Ga0207663_10214767 3300025916 Bacteria 1396
142 Ga0207660_10064154 3300025917 Bacteria 2650
143 Ga0207657_10025688 3300025919 Bacteria 5425
144 Ga0207657_10112922 3300025919 Bacteria 2242
145 Ga0207646_10106023 3300025922 Bacteria 2521
146 Ga0207694_10001572 3300025924 Bacteria 19329
147 Ga0207700_10007329 3300025928 Bacteria 6735
148 Ga0207700_10046153 3300025928 Bacteria 3220
149 Ga0207700_10078808 3300025928 Bacteria 2564
150 Ga0207700_10086278 3300025928 Bacteria 2466
151 Ga0207700_10138432 3300025928 Bacteria 1997
152 Ga0207664_10012624 3300025929 Bacteria 6044
153 Ga0207664_10125027 3300025929 Bacteria 2158
154 Ga0207664_10342427 3300025929 Bacteria 1322
155 Ga0207664_10731517 3300025929 Bacteria 890
156 Ga0207690_10098864 3300025932 Bacteria 2079
157 Ga0207706_10051112 3300025933 Bacteria 3651
158 Ga0207665_10045607 3300025939 Bacteria 2935
159 Ga0207665_10135810 3300025939 Bacteria 1750
160 Ga0207689_10180457 3300025942 Bacteria 1741
161 Ga0207689_10621902 3300025942 Bacteria 909
162 Ga0207661_10027634 3300025944 Bacteria 4336
163 Ga0207661_10188297 3300025944 Bacteria 1808
164 Ga0207661_10250823 3300025944 Bacteria 1573
165 Ga0207667_10293489 3300025949 Bacteria 1661
166 Ga0207640_10010341 3300025981 Bacteria 5254
167 Ga0207640_10121888 3300025981 Bacteria 1870
168 Ga0207640_10145475 3300025981 Bacteria 1734
169 Ga0207677_10217350 3300026023 Bacteria 1530
170 Ga0207639_10136666 3300026041 Bacteria 2037
171 Ga0207639_10146051 3300026041 Bacteria 1976
172 Ga0207639_10177159 3300026041 Bacteria 1811
173 Ga0207678_10007418 3300026067 Bacteria 9711
174 Ga0207678_10081725 3300026067 Bacteria 2766
175 Ga0207678_10149752 3300026067 Bacteria 1992
176 Ga0207678_10564727 3300026067 Bacteria 996
177 Ga0207708_10107363 3300026075 Bacteria 2165
178 Ga0207702_10266430 3300026078 Bacteria 1615
179 Ga0207702_10525361 3300026078 Bacteria 1156
180 Ga0207674_10037961 3300026116 Bacteria 5003
181 Ga0207674_10298506 3300026116 Bacteria 1560
182 Ga0207674_10479038 3300026116 Bacteria 1203
183 Ga0207675_100702086 3300026118 Bacteria 1021
184 Ga0207683_10054399 3300026121 Bacteria 3510
185 Ga0207698_10028688 3300026142 Bacteria 3973
186 Ga0207698_10152830 3300026142 Bacteria 2006
187 Ga0207698_10632428 3300026142 Bacteria 1058
188 Ga0209371_1021303 3300027312 Bacteria 1574
189 Ga0209813_10120765 3300027866 Bacteria 912
190 Ga0268266_10090348 3300028379 Bacteria 2684
191 Ga0268266_10094709 3300028379 Bacteria 2622
192 Ga0268266_10532855 3300028379 Bacteria 1124
193 Ga0265337_1000230 3300028556 Bacteria 30116
194 Ga0265326_10001838 3300028558 Bacteria 7291
195 Ga0265319_1001673 3300028563 Bacteria 12805
196 Ga0265334_10000178 3300028573 Bacteria 37532
197 Ga0265334_10041226 3300028573 Bacteria 1805
198 Ga0265322_10014316 3300028654 Bacteria 2292
199 Ga0265336_10003119 3300028666 Bacteria 6590
200 Ga0265336_10003740 3300028666 Bacteria 5890
201 Ga0307517_10018152 3300028786 Bacteria 9117
202 Ga0307515_10010304 3300028794 Bacteria 17938
203 Ga0307515_10074461 3300028794 Bacteria 4542
204 Ga0307515_10250021 3300028794 Bacteria 1527
205 Ga0265338_10000683 3300028800 Bacteria 58337
206 Ga0265338_10054900 3300028800 Bacteria 3548
207 Ga0265324_10006327 3300029957 Bacteria 4962
208 Ga0265324_10009973 3300029957 Bacteria 3688
209 Ga0307511_10000672 3300030521 Bacteria 36429
210 Ga0307512_10000801 3300030522 Bacteria 46484
211 Ga0307512_10022842 3300030522 Bacteria 5605
212 Ga0265332_10020655 3300031238 Bacteria 2907
213 Ga0265332_10050673 3300031238 Bacteria 1784
214 Ga0265320_10007740 3300031240 Bacteria 6640
215 Ga0265325_10034084 3300031241 Bacteria 2712
216 Ga0265340_10001938 3300031247 Bacteria 11824
217 Ga0265340_10002640 3300031247 Bacteria 10187
218 Ga0265339_10005353 3300031249 Bacteria 8546
219 Ga0265339_10196402 3300031249 Bacteria 997
220 Ga0265331_10014814 3300031250 Bacteria 4137
221 Ga0265316_10015012 3300031344 Bacteria 6791
222 Ga0307513_10001986 3300031456 Bacteria 28948
223 Ga0307513_10010977 3300031456 Bacteria 11301
224 Ga0307513_10031680 3300031456 Bacteria 5983
225 Ga0307509_10006518 3300031507 Bacteria 15655
226 Ga0307509_10011002 3300031507 Bacteria 11025
227 Ga0307509_10024641 3300031507 Bacteria 6734
228 Ga0307509_10035479 3300031507 Bacteria 5473
229 Ga0307509_10138169 3300031507 Bacteria 2378
230 Ga0265313_10004009 3300031595 Bacteria 11526
231 Ga0307508_10004718 3300031616 Bacteria 13199
232 Ga0307508_10013835 3300031616 Bacteria 7363
233 Ga0307508_10030536 3300031616 Bacteria 4871
234 Ga0307514_10005174 3300031649 Bacteria 11764
235 Ga0307514_10008786 3300031649 Bacteria 8554
236 Ga0307514_10101916 3300031649 Bacteria 2059
237 Ga0307514_10164558 3300031649 Bacteria 1462
238 Ga0265314_10010641 3300031711 Bacteria 7654
239 Ga0265342_10001496 3300031712 Bacteria 21649
240 Ga0265342_10049373 3300031712 Bacteria 2518
241 Ga0307516_10000841 3300031730 Bacteria 42119
242 Ga0307516_10059569 3300031730 Bacteria 3713
243 Ga0307516_10402392 3300031730 Bacteria 1028
244 Ga0307405_10049965 3300031731 Bacteria 2587
245 Ga0307413_10023094 3300031824 Bacteria 3366
246 Ga0307413_10113689 3300031824 Bacteria 1818
247 Ga0307518_10092157 3300031838 Bacteria 2179
248 Ga0307410_10295621 3300031852 Bacteria 1276
249 Ga0307410_10545948 3300031852 Bacteria 960
250 Ga0307410_10693820 3300031852 Bacteria 857
251 Ga0307409_100237851 3300031995 Bacteria 1656
252 Ga0307409_100247022 3300031995 Bacteria 1629
253 Ga0307409_100302300 3300031995 Bacteria 1489
254 Ga0307409_100532770 3300031995 Bacteria 1150
255 Ga0307409_100770785 3300031995 Bacteria 967
256 Ga0307416_100192175 3300032002 Bacteria 1927
257 Ga0307415_100025726 3300032126 Bacteria 3700
258 Ga0307415_100266671 3300032126 Bacteria 1400
259 Ga0307507_10030151 3300033179 Bacteria 5726
260 Ga0307507_10060126 3300033179 Bacteria 3550
261 Ga0307507_10094661 3300033179 Bacteria 2537
262 Ga0307507_10163834 3300033179 Bacteria 1635
263 Ga0307510_10006065 3300033180 Bacteria 14405
264 Ga0307510_10057502 3300033180 Bacteria 4036
265 Ga0307510_10075977 3300033180 Bacteria 3307
266 Ga0307510_10130210 3300033180 Bacteria 2192
267 Ga0307510_10141332 3300033180 Bacteria 2050
268 Ga0373934_0031420 3300035086 Bacteria 2079
269 Ga0373944_0073491 3300035089 Bacteria 1118
270 Ga0373936_0010500 3300035113 Bacteria 3495
271 Ga0373954_0057351 3300035118 Bacteria 1834
272 Ga0373957_0085254 3300035120 Bacteria 1250
273 Ga0373955_0029602 3300035172 Bacteria 2849
274 Ga0373924_0011618 3300035410 Bacteria 3274
275 Ga0373935_0146614 3300035692 Bacteria 1598
276 Ga0373933_0016144 3300035724 Bacteria 4172
277 Ga0373925_0006443 3300037068 Bacteria 8639
278 Ga0395900_0231452 3300037418 Bacteria 1858
279 Ga0395898_0007719 3300037466 Bacteria 11421
280 Ga0395898_0036977 3300037466 Bacteria 4845
281 Ga0439436_0003837 3300041404 Bacteria 4602
282 Ga0439436_0004109 3300041404 Bacteria 4461
283 Ga0439436_0005195 3300041404 Bacteria 3991
284 Ga0439436_0015754 3300041404 Bacteria 2271
285 Ga0439438_071793 3300041405 Bacteria 856
286 Ga0439439_0000121 3300041406 Bacteria 10896
287 Ga0439439_0003420 3300041406 Bacteria 3500
288 Ga0439439_0010864 3300041406 Bacteria 2183
289 Ga0439439_0072405 3300041406 Bacteria 924
290 Ga0451797_0640309 3300041453 Bacteria 1371
291 Ga0451795_1034354 3300041456 Bacteria 3727
292 Ga0451800_0421651 3300041459 Bacteria 2013
293 Ga0451802_1768030 3300041460 Bacteria 1004
294 Ga0451853_1223826 3300041512 Bacteria 2013
295 Ga0451853_1833064 3300041512 Bacteria 2049
296 Ga0439433_0003165 3300041999 Bacteria 3525
297 Ga0439433_0007013 3300041999 Bacteria 2432
298 Ga0439448_0011705 3300042005 Bacteria 2616
299 Ga0439448_0017640 3300042005 Bacteria 2181
300 Ga0439448_0090220 3300042005 Bacteria 1035
301 Ga0439449_0007982 3300042007 Bacteria 4021
302 Ga0439449_0012598 3300042007 Bacteria 3181
303 Ga0439449_0015988 3300042007 Bacteria 2820
304 Ga0439450_067692 3300042008 Bacteria 872
305 Ga0439457_000111 3300042014 Bacteria 19558
306 Ga0439457_000307 3300042014 Bacteria 13539
307 Ga0439457_000998 3300042014 Bacteria 8532
308 Ga0439462_0017760 3300042015 Bacteria 1843
309 Ga0450890_006837 3300042127 Bacteria 1455
310 Ga0450894_000148 3300042131 Bacteria 12360
311 Ga0450894_000258 3300042131 Bacteria 9518
312 Ga0450894_000894 3300042131 Bacteria 4749
313 Ga0450895_006859 3300042132 Bacteria 937
314 Ga0450896_000218 3300042133 Bacteria 5111
315 Ga0450898_000150 3300042134 Bacteria 7018
316 Ga0450898_000188 3300042134 Bacteria 6552
317 Ga0450898_002540 3300042134 Bacteria 2555
318 Ga0450899_000083 3300042135 Bacteria 7979
319 Ga0450900_012551 3300042136 Bacteria 1112
320 Ga0450903_000204 3300042138 Bacteria 13059
321 Ga0450903_011561 3300042138 Bacteria 1420
322 Ga0450906_000040 3300042145 Bacteria 21045
323 Ga0450906_000331 3300042145 Bacteria 9635
324 Ga0450906_000521 3300042145 Bacteria 8089
325 Ga0439458_0000476 3300042157 Bacteria 10265
326 Ga0439458_0003238 3300042157 Bacteria 3849
327 Ga0439458_0009838 3300042157 Bacteria 2129
328 Ga0450908_003549 3300042184 Bacteria 3039
329 Ga0450908_010342 3300042184 Bacteria 1722
330 Ga0439440_0016019 3300042993 Bacteria 1635
331 Ga0466969_0002669 3300044656 Bacteria 9533
332 Ga0466972_0000744 3300044658 Bacteria 15520
333 Ga0466972_0036878 3300044658 Bacteria 2390
334 Ga0466965_0001152 3300044683 Bacteria 10396
335 Ga0466966_0006589 3300044684 Bacteria 7690
336 Ga0466966_0011651 3300044684 Bacteria 5828
337 Ga0466961_0001075 3300044693 Bacteria 16849
338 Ga0466961_0009383 3300044693 Bacteria 6234
339 Ga0466961_0527404 3300044693 Bacteria 712
340 Ga0466963_0010946 3300044694 Bacteria 5512
341 Ga0466963_0036954 3300044694 Bacteria 3187
342 Ga0466963_0037174 3300044694 Bacteria 3178
343 Ga0466963_0078485 3300044694 Bacteria 2232
344 Ga0466963_0122264 3300044694 Bacteria 1792
345 Ga0466964_0002075 3300044706 Bacteria 7048
346 Ga0466964_0150537 3300044706 Bacteria 1078
347 Ga0466971_0000151 3300044719 Bacteria 25764
348 Ga0466971_0010618 3300044719 Bacteria 4026
349 Ga0466971_0032982 3300044719 Bacteria 2320
350 Ga0466971_0088403 3300044719 Bacteria 1417
351 Ga0466968_0033531 3300044735 Bacteria 2140
352 Ga0466970_0025639 3300044765 Bacteria 3088
353 Ga0466970_0078037 3300044765 Bacteria 1786
354 Ga0466957_0102866 3300044842 Bacteria 1802
355 Ga0466960_0009435 3300044901 Bacteria 4022
356 Ga0466960_0144681 3300044901 Bacteria 1265
357 Ga0466959_0002709 3300045049 Bacteria 11383
358 Ga0466959_0008239 3300045049 Bacteria 7357
359 Ga0466959_0049610 3300045049 Bacteria 3084
360 Ga0466959_0089831 3300045049 Bacteria 2207
361 Ga0466959_0108116 3300045049 Bacteria 1987
362 Ga0466958_0008107 3300045836 Bacteria 5812
363 Ga0466958_0027439 3300045836 Bacteria 3370
364 Ga0466958_0058276 3300045836 Bacteria 2348
365 Ga0466967_0002421 3300045976 Bacteria 11598
366 Ga0466967_0041393 3300045976 Bacteria 3972
367 Ga0466967_0063721 3300045976 Bacteria 3276
368 Ga0466967_0087334 3300045976 Bacteria 2827
369 Ga0466967_0255378 3300045976 Bacteria 1675
370 Ga0466967_0621733 3300045976 Bacteria 1067
371 Ga0495627_026909 3300046453 Bacteria 1850
372 Ga0495592_0011446 3300046454 Bacteria 6712
373 Ga0495592_0012776 3300046454 Bacteria 6383
374 Ga0495592_0130734 3300046454 Bacteria 1756
375 Ga0495603_0012311 3300046455 Bacteria 5177
376 Ga0495629_0014036 3300046459 Bacteria 5772
377 Ga0495629_0015196 3300046459 Bacteria 5531
378 Ga0495629_0025807 3300046459 Bacteria 4175
379 Ga0495629_0131760 3300046459 Bacteria 1741
380 Ga0495629_0371008 3300046459 Bacteria 975
381 Ga0495638_0075194 3300046460 Bacteria 2059
382 Ga0495651_0001705 3300046462 Bacteria 16969
383 Ga0495651_0002959 3300046462 Bacteria 13126
384 Ga0495651_0004042 3300046462 Bacteria 11214
385 Ga0495653_0021618 3300046463 Bacteria 5211
386 Ga0495650_0028062 3300046471 Bacteria 2591
387 Ga0495650_0028239 3300046471 Bacteria 2580
388 Ga0495650_0107007 3300046471 Bacteria 1043
389 Ga0495580_0046716 3300046472 Bacteria 3071
390 Ga0495580_0182859 3300046472 Bacteria 1447
391 Ga0495582_0057870 3300046473 Bacteria 2137
392 Ga0495605_0120762 3300046474 Bacteria 1188
393 Ga0495639_0126083 3300046475 Bacteria 1224
394 Ga0495639_0136025 3300046475 Bacteria 1179
395 Ga0495662_0000534 3300046476 Bacteria 17425
396 Ga0495662_0011551 3300046476 Bacteria 4316
397 Ga0495662_0090320 3300046476 Bacteria 1493
398 Ga0495662_0092381 3300046476 Bacteria 1476
399 Ga0495664_0000617 3300046477 Bacteria 18040
400 Ga0495664_0003610 3300046477 Bacteria 8435
401 Ga0495664_0159761 3300046477 Bacteria 1367
402 Ga0495585_0022960 3300046492 Bacteria 3580
403 Ga0495585_0153112 3300046492 Bacteria 1201
404 Ga0495594_0008240 3300046499 Bacteria 5363
405 Ga0495594_0034337 3300046499 Bacteria 2759
406 Ga0495594_0062842 3300046499 Bacteria 2056
407 Ga0495596_0014822 3300046500 Bacteria 3279
408 Ga0495596_0035274 3300046500 Bacteria 1984
409 Ga0495583_0006789 3300046506 Bacteria 7397
410 Ga0495583_0064824 3300046506 Bacteria 1619
411 Ga0495583_0072513 3300046506 Bacteria 1511
412 Ga0495606_0007389 3300046507 Bacteria 9853
413 Ga0495608_0036891 3300046511 Bacteria 3288
414 Ga0495608_0211865 3300046511 Bacteria 1218
415 Ga0495610_0059901 3300046512 Bacteria 1815
416 Ga0495616_0018556 3300046513 Bacteria 3816
417 Ga0495618_0218426 3300046514 Bacteria 1203
418 Ga0495620_0010158 3300046515 Bacteria 4973
419 Ga0495628_0004349 3300046516 Bacteria 12569
420 Ga0495628_0036786 3300046516 Bacteria 3926
421 Ga0495628_0071763 3300046516 Bacteria 2698
422 Ga0495628_0100719 3300046516 Bacteria 2230
423 Ga0495628_0220511 3300046516 Bacteria 1424
424 Ga0495630_0169651 3300046517 Bacteria 1662
425 Ga0495630_0400598 3300046517 Bacteria 1051
426 Ga0495630_0413688 3300046517 Bacteria 1033
427 Ga0495631_0003534 3300046518 Bacteria 8542
428 Ga0495637_0019780 3300046520 Bacteria 3108
429 Ga0495643_0005450 3300046522 Bacteria 8605
430 Ga0495643_0010819 3300046522 Bacteria 5593
431 Ga0495648_0037742 3300046524 Bacteria 3100
432 Ga0495648_0070367 3300046524 Bacteria 2033
433 Ga0495652_0001214 3300046529 Bacteria 28869
434 Ga0495652_0004196 3300046529 Bacteria 13871
435 Ga0495652_0031801 3300046529 Bacteria 4619
436 Ga0495654_0162063 3300046530 Bacteria 981
437 Ga0495665_0199212 3300046531 Bacteria 1038
438 Ga0495640_0014013 3300046533 Bacteria 6084
439 Ga0495640_0040118 3300046533 Bacteria 3279
440 Ga0495586_0020844 3300046535 Bacteria 3492
441 Ga0495586_0039468 3300046535 Bacteria 2538
442 Ga0495586_0067886 3300046535 Bacteria 1945
443 Ga0495587_0003123 3300046536 Bacteria 11081
444 Ga0495587_0037947 3300046536 Bacteria 2891
445 Ga0495587_0067962 3300046536 Bacteria 2076
446 Ga0495609_0006276 3300046538 Bacteria 6090
447 Ga0495597_0114070 3300046542 Bacteria 1131
448 Ga0495645_0005263 3300046543 Bacteria 8862
449 Ga0495645_0027092 3300046543 Bacteria 4162
450 Ga0495645_0035747 3300046543 Bacteria 3621
451 Ga0495633_0019430 3300046558 Bacteria 3436
452 Ga0495656_0042467 3300046615 Bacteria 1904
453 Ga0495668_0047568 3300046616 Bacteria 2381
454 Ga0495668_0064320 3300046616 Bacteria 2019
455 Ga0495634_0005064 3300046642 Bacteria 10178
456 Ga0495634_0015110 3300046642 Bacteria 5548
457 Ga0495634_0095421 3300046642 Bacteria 1926
458 Ga0495611_0040066 3300046648 Bacteria 2087
459 Ga0495611_0108677 3300046648 Bacteria 1290
460 Ga0495625_0022762 3300046660 Bacteria 4796
461 Ga0495625_0050603 3300046660 Bacteria 2981
462 Ga0495625_0221413 3300046660 Bacteria 1240
463 Ga0495635_0001004 3300046663 Bacteria 18654
464 Ga0495635_0006399 3300046663 Bacteria 8207
465 Ga0495635_0008784 3300046663 Bacteria 7054
466 Ga0495635_0122104 3300046663 Bacteria 1776
467 Ga0495661_0015013 3300046665 Bacteria 5176
468 Ga0495588_0005143 3300046674 Bacteria 5811
469 Ga0495588_0007950 3300046674 Bacteria 4848
470 Ga0495657_0007012 3300046675 Bacteria 8742
471 Ga0495657_0007655 3300046675 Bacteria 8315
472 Ga0495657_0046225 3300046675 Bacteria 2949
473 Ga0495657_0056586 3300046675 Bacteria 2610
474 Ga0495599_0263107 3300046678 Bacteria 1047
475 Ga0495623_0038419 3300046679 Unclassified 3061
476 Ga0495623_0140009 3300046679 Bacteria 1440
477 Ga0495646_0027436 3300046680 Bacteria 3573
478 Ga0495646_0057201 3300046680 Bacteria 2335
479 Ga0495646_0126822 3300046680 Bacteria 1439
480 Ga0495647_0034238 3300046681 Bacteria 1902
481 Ga0495658_0008782 3300046683 Bacteria 5021
482 Ga0495658_0009802 3300046683 Bacteria 4776
483 Ga0495658_0025901 3300046683 Bacteria 3139
484 Ga0495613_0017227 3300046689 Bacteria 5382
485 Ga0495613_0017594 3300046689 Bacteria 5322
486 Ga0495613_0039155 3300046689 Bacteria 3514
487 Ga0495613_0097823 3300046689 Bacteria 2120
488 Ga0495671_0027920 3300046692 Bacteria 2910
489 Ga0495589_0017853 3300046794 Bacteria 3639
490 Ga0495589_0056999 3300046794 Bacteria 1922
491 Ga0495589_0174134 3300046794 Bacteria 1022
492 Ga0495600_0017891 3300046809 Bacteria 4510
493 Ga0495660_0102664 3300046810 Bacteria 1469
494 Ga0495581_0021486 3300047315 Bacteria 3740
495 Ga0495581_0038159 3300047315 Bacteria 2780
496 Ga0495581_0063538 3300047315 Bacteria 2133
497 Ga0495581_0075144 3300047315 Bacteria 1955
498 Ga0495604_0003200 3300047317 Bacteria 13084
499 Ga0495604_0004760 3300047317 Bacteria 10752
500 Ga0495604_0045322 3300047317 Bacteria 3432
501 Ga0495604_0066312 3300047317 Bacteria 2746
502 Ga0495604_0239144 3300047317 Bacteria 1242
503 Ga0495636_0018692 3300047318 Bacteria 2781
504 Ga0495636_0024149 3300047318 Bacteria 2463
505 Ga0495636_0072794 3300047318 Bacteria 1469
506 Ga0495674_0069192 3300047319 Bacteria 3053
507 Ga0495674_0334491 3300047319 Bacteria 1231
508 Ga0495674_0518661 3300047319 Bacteria 952
509 Ga0495676_0012001 3300047321 Bacteria 7815
510 Ga0495676_0017146 3300047321 Bacteria 6408
511 Ga0495676_0021121 3300047321 Bacteria 5697
512 Ga0495676_0072134 3300047321 Bacteria 2652
513 Ga0495676_0084970 3300047321 Bacteria 2385
514 Ga0495680_0010905 3300047322 Bacteria 8076
515 Ga0495680_0158276 3300047322 Bacteria 1646
516 Ga0495683_0042719 3300047323 Bacteria 2285
517 Ga0495687_001648 3300047443 Bacteria 20081
518 Ga0495687_005720 3300047443 Bacteria 7830
519 Ga0495687_012644 3300047443 Bacteria 4449
520 Ga0495687_061924 3300047443 Bacteria 1537
521 Ga0495687_068479 3300047443 Bacteria 1433
522 Ga0495687_082509 3300047443 Bacteria 1254
523 Ga0495687_127269 3300047443 Bacteria 908
524 Ga0495685_004021 3300047447 Bacteria 4728
525 Ga0495685_042950 3300047447 Bacteria 1542
526 Ga0495681_0001693 3300047470 Bacteria 16334
527 Ga0495681_0003555 3300047470 Bacteria 10848
528 Ga0495681_0018274 3300047470 Bacteria 3866
529 Ga0495684_0172801 3300047471 Bacteria 1606
530 Ga0495686_0126084 3300047472 Bacteria 1522
531 Ga0495593_0003639 3300047673 Bacteria 9204
532 Ga0495593_0005185 3300047673 Bacteria 7702
533 Ga0495602_0044426 3300048088 Bacteria 4030
534 Ga0495602_0048087 3300048088 Bacteria 3838
535 Ga0495602_0112008 3300048088 Bacteria 2215
536 Ga0495614_0000841 3300048089 Bacteria 12989
537 Ga0495614_0124692 3300048089 Bacteria 1137
538 Ga0495626_0031029 3300048091 Bacteria 2575
539 Ga0496100_0320045 3300048903 Bacteria 1165
540 Ga0496101_0203665 3300048904 Bacteria 1530
541 Ga0496103_0048374 3300048906 Bacteria 2628
542 Ga0496104_0001344 3300048907 Bacteria 21277
543 Ga0496105_0015905 3300048908 Bacteria 6001
544 Ga0496105_0104975 3300048908 Bacteria 2332
545 Ga0496108_0003880 3300048911 Bacteria 12006
546 Ga0496108_0276214 3300048911 Bacteria 1463
547 Ga0496109_0009141 3300048912 Bacteria 8437
548 Ga0496110_0077753 3300048913 Bacteria 2952
549 Ga0496111_0000184 3300048914 Bacteria 28609
550 Ga0496111_0646386 3300048914 Bacteria 772
551 Ga0496112_0789927 3300048915 Bacteria 874
552 Ga0496113_0383910 3300048916 Bacteria 1127
553 Ga0496114_0045997 3300048917 Bacteria 3626
554 Ga0496114_0087355 3300048917 Bacteria 2644
555 Ga0496114_0204771 3300048917 Bacteria 1729
556 Ga0496114_0240856 3300048917 Bacteria 1591
557 Ga0496114_0468784 3300048917 Bacteria 1114
558 Ga0496115_0058151 3300048918 Bacteria 3111
559 Ga0496115_0106671 3300048918 Bacteria 2300
560 Ga0496126_0040528 3300048929 Bacteria 4317
561 Ga0496126_0052562 3300048929 Bacteria 3701
562 Ga0496126_0189384 3300048929 Bacteria 1743
563 Ga0495678_040733 3300049459 Bacteria 1864
564 Ga0501031_0026720 3300049568 Bacteria 3763
565 Ga0501032_0159857 3300049569 Bacteria 1479
566 Ga0501033_0016410 3300049570 Bacteria 5609
567 Ga0501033_0124749 3300049570 Bacteria 1867
568 Ga0501038_0004886 3300049574 Bacteria 12455
569 Ga0501038_0056791 3300049574 Bacteria 3362
570 Ga0501039_0012962 3300049575 Bacteria 6374
571 Ga0501039_0038797 3300049575 Bacteria 3678
572 Ga0501040_0022715 3300049576 Bacteria 4202
573 Ga0501040_0129682 3300049576 Bacteria 1772
574 Ga0501041_0027512 3300049577 Bacteria 3427
575 Ga0501042_0025091 3300049578 Bacteria 4185
576 Ga0501043_0234243 3300049579 Bacteria 1417
577 Ga0501046_0115301 3300049580 Bacteria 2049
578 Ga0501048_0027173 3300049582 Bacteria 4161
579 Ga0501048_0203577 3300049582 Bacteria 1403
580 Ga0501069_0234904 3300049585 Bacteria 1068
581 Ga0501070_0334905 3300049586 Bacteria 1230
582 Ga0501070_0642175 3300049586 Bacteria 843
583 Ga0501071_0106982 3300049587 Bacteria 2065
584 Ga0501071_0107270 3300049587 Bacteria 2062
585 Ga0501071_0528061 3300049587 Bacteria 906
586 Ga0501072_0016239 3300049588 Bacteria 5711
587 Ga0501076_0052533 3300049592 Bacteria 3228
588 Ga0501079_0153950 3300049741 Bacteria 1792
589 Ga0501079_0273516 3300049741 Bacteria 1320
590 Ga0501081_0105440 3300049743 Bacteria 1997
591 Ga0501035_0789158 3300049822 Bacteria 759
592 Ga0501044_0129950 3300049823 Bacteria 2513
593 Ga0501045_0150440 3300049824 Bacteria 1732
594 nmdc:mga03n38_113996_c1 3300050490 Bacteria 1320
595 nmdc:mga03n38_59632_c1 3300050490 Bacteria 1732
596 nmdc:mga0yw44_9998_c1 3300050492 Bacteria 4826
597 nmdc:mga06z11_3522_c1 3300050494 Bacteria 6065
598 nmdc:mga06z11_79061_c1 3300050494 Bacteria 1760
599 nmdc:mga04h51_141831_c1 3300050495 Bacteria 912
600 nmdc:mga05p37_190442_c1 3300050507 Bacteria 2491
601 nmdc:mga0qj67_177337_c1 3300050509 Bacteria 1731
602 nmdc:mga06r32_517459_c1 3300050510 Bacteria 1169
603 nmdc:mga08y16_481470_c1 3300050511 Bacteria 1263
604 Ga0495601_0046889 3300053077 Bacteria 2720
605 Ga0495601_0080219 3300053077 Bacteria 2093
606 Ga0495601_0257853 3300053077 Bacteria 1138
607 Ga0495612_0030361 3300053078 Bacteria 2176
608 Ga0495612_0052942 3300053078 Bacteria 1671
609 Ga0500635_0000006 3300053080 Bacteria 187108
610 Ga0495655_0009402 3300053083 Bacteria 1894
611 Ga0495655_0043695 3300053083 Bacteria 1156
612 Ga0495619_0236981 3300053085 Bacteria 1264
613 Ga0495619_0254160 3300053085 Bacteria 1218
614 Ga0495619_0347717 3300053085 Bacteria 1026
615 Ga0500578_0028597 3300053086 Bacteria 3580
616 Ga0500578_0095711 3300053086 Bacteria 1883
617 Ga0500583_0077922 3300053092 Bacteria 1597
618 Ga0500640_001432 3300053095 Bacteria 7238
619 Ga0500640_090474 3300053095 Bacteria 1282
620 Ga0500654_093215 3300053099 Bacteria 1328
621 Ga0500660_090749 3300053100 Bacteria 1366
622 Ga0500553_082981 3300053101 Bacteria 1435
623 Ga0500553_099182 3300053101 Bacteria 1258
624 Ga0500553_101657 3300053101 Bacteria 1235
625 Ga0500560_005769 3300053107 Bacteria 2771
626 Ga0500560_108310 3300053107 Bacteria 931
627 Ga0500569_001328 3300053109 Bacteria 4631
628 Ga0500580_047549 3300053113 Bacteria 1810
629 Ga0500621_091258 3300053126 Bacteria 1211
630 Ga0500628_000785 3300053129 Bacteria 5659
631 Ga0500652_012391 3300053131 Bacteria 2989
632 Ga0500658_0011811 3300053134 Bacteria 3219
633 Ga0500561_0009872 3300053137 Bacteria 1952
634 Ga0500573_0017609 3300053140 Bacteria 4069
635 Ga0500573_0069670 3300053140 Bacteria 2007
636 Ga0500579_029352 3300053143 Bacteria 3536
637 Ga0500600_0027671 3300053149 Bacteria 3358
638 Ga0500616_0004587 3300053153 Bacteria 9771
639 Ga0500616_0011605 3300053153 Bacteria 5192
640 Ga0500633_0026027 3300053160 Bacteria 1836
641 Ga0500634_0041823 3300053161 Bacteria 2487
642 Ga0500587_001195 3300053739 Bacteria 3598
643 Ga0466962_0000203 3300061719 Bacteria 24833
644 Ga0466962_0009988 3300061719 Bacteria 4554
645 Ga0466962_0013923 3300061719 Bacteria 3873
646 Ga0530510_0049948 3300061734 Bacteria 3021
647 Ga0530510_0145979 3300061734 Bacteria 1745
648 2966604224 2966598605 Bacteria 7676064
649 2585304325 2582581313 Bacteria 10042643
650 2585314956 2582581314 Bacteria 11452267
651 2587864724 2585428094 Bacteria 3604039
652 2616698793 2616644814 Bacteria 11555299
653 2643760014 2643221548 Bacteria 8053412
654 2643904984 2643221578 Bacteria 9213798
655 2644403043 2643221673 Bacteria 9196637
656 2644440778 2643221678 Bacteria 9540101
657 2644460290 2643221682 Bacteria 6743283
658 2644631094 2643221714 Bacteria 9015452
659 2676489056 2675903060 Bacteria 10051191
660 2731909369 2731639228 Bacteria 4187555
661 2785346268 2784746763 Bacteria 9783172
662 2785346317 2784746763 Bacteria 9783172
663 2785346826 2784746763 Bacteria 9783172
664 2785373391 2784746768 Bacteria 10036182
665 2785373451 2784746768 Bacteria 10036182
666 2786674605 2786546132 Bacteria 10419719
667 2808845504 2808606359 Bacteria 9866990
668 2808915210 2808606375 Bacteria 9466072
669 2812354187 2811994879 Bacteria 9313447
670 2812482928 2811994917 Bacteria 7761064
671 2816427009 2816332119 Bacteria 8120218
672 2844850581 2844849076 Bacteria 4091819
673 2852635863 2852635781 Bacteria 8251373
674 2852642595 2852635781 Bacteria 8251373
675 2857744859 2857740372 Bacteria 4782044
676 2862282898 2862281513 Bacteria 9621493
677 2862386815 2862382967 Bacteria 10317375
678 2863407847 2863404153 Bacteria 9672205
679 2867431623 2867428634 Bacteria 9590268
680 2877677032 2877676314 Bacteria 9512378
681 2877677527 2877676314 Bacteria 9512378
682 2884702668 2884693830 Bacteria 11273186
683 2887446781 2887443736 Bacteria 4426037
684 2895429477 2895427314 Bacteria 13147766
685 2895452168 2895442618 Bacteria 11027144
686 2899371203 2899370129 Bacteria 6781179
687 2904499108 2904497146 Bacteria 4731781
688 2910811428 2910809715 Bacteria 4982797
689 2912715776 2912715099 Bacteria 9460473
690 2919060911 2919059106 Bacteria 4991624
691 2919472853 2919468124 Bacteria 9133025
692 2932430161 2932426870 Bacteria 4547726
693 2933422151 2933418574 Bacteria 4476724
694 2939651234 2939647034 Bacteria 4681660
695 2939678959 2939674588 Bacteria 4844420
696 2946052410 2946045630 Bacteria 8527308
697 2946071511 2946064051 Bacteria 8957905
698 2946079871 2946072368 Bacteria 8999607
699 2947225267 2947224130 Bacteria 9938529
700 2954009434 2954002825 Bacteria 9173742
701 2954382258 2954380949 Bacteria 10050426
702 2954390056 2954380949 Bacteria 10050426
703 2954680798 2954673503 Bacteria 9685905
704 2954683357 2954682443 Bacteria 9862841
705 2954693085 2954691527 Bacteria 10720516
706 2954708159 2954701450 Bacteria 10834262
707 2954712758 2954711539 Bacteria 10867210
708 2954722717 2954721474 Bacteria 10456478
709 2954739143 2954731030 Bacteria 10243860
710 2954741597 2954740390 Bacteria 10229294
711 2954757972 2954749733 Bacteria 10366972
712 2954760608 2954759201 Bacteria 9358192
713 2990066967 2990059506 Bacteria 9321252
714 2997608423 2997600082 Bacteria 9896405
715 8003322633 8003314358 Bacteria 10575343
716 8008560421 8008558824 Bacteria 10610750
717 8048410554 8048406513 Bacteria 8936924
718 8056836320 8056829672 Bacteria 9045328
719 JGI24739J22299_10017128
720 JGI24739J22299_10042956
721 JGI24739J22299_10049648
722 JGI24738J21930_10009736
723 JGI25152J39213_1000109
724 JGI25406J46586_10041231
725 JGI25406J46586_10059721
726 rootH1_10005650
727 rootH1_10026697
728 rootH1_10055768
729 rootL2_10001330
730 rootH1_10015077
731 rootH1_10015078
732 Ga0070683_100115720
733 Ga0070683_100370914
734 Ga0070683_100846362
735 Ga0068869_100123209
736 Ga0070680_100018278
737 Ga0070680_100065815
738 Ga0070682_100051982
739 Ga0070682_100268051
740 Ga0070660_100044202
741 Ga0070675_100392966
742 Ga0070709_10012890
743 Ga0070709_10052893
744 Ga0070709_10167460
745 Ga0070714_100051600
746 Ga0070714_100090715
747 Ga0070714_100226882
748 Ga0070713_100014860
749 Ga0070713_100103696
750 Ga0070713_100157475
751 Ga0070713_100236426
752 Ga0070713_100504083
753 Ga0070710_10004386
754 Ga0070710_10032628
755 Ga0070710_10064158
756 Ga0070711_100016186
757 Ga0070678_100075137
758 Ga0070681_10073741
759 Ga0070706_100262720
760 Ga0070707_100066294
761 Ga0070698_100009228
762 Ga0070699_100076467
763 Ga0070684_100065285
764 Ga0070684_100321456
765 Ga0068853_100095691
766 Ga0068853_100170450
767 Ga0068853_100302113
768 Ga0070672_100122245
769 Ga0070665_100111970
770 Ga0070665_100217797
771 Ga0068855_100009579
772 Ga0068855_100439186
773 Ga0068857_100627876
774 Ga0068857_100687266
775 Ga0068854_100000781
776 Ga0068854_100054481
777 Ga0068856_100213535
778 Ga0068856_100502046
779 Ga0068856_100505448
780 Ga0068852_100113891
781 Ga0068852_100150038
782 Ga0068852_100197985
783 Ga0068851_10297548
784 Ga0081455_10001079
785 Ga0081540_1002232
786 Ga0081539_10001103
787 Ga0081539_10003736
788 Ga0081539_10022636
789 Ga0081539_10038322
790 Ga0081539_10064219
791 Ga0070717_10241001
792 Ga0070717_10288394
793 Ga0075365_10101617
794 Ga0075368_10005280
795 Ga0075363_100123438
796 Ga0075363_100141625
797 Ga0075364_10130113
798 Ga0070716_100034547
799 Ga0070712_100005494
800 Ga0075367_10005258
801 Ga0075367_10078717
802 Ga0075430_100035704
803 Ga0075431_100005354
804 Ga0075431_100258992
805 Ga0075431_100485878
806 Ga0075429_100035883
807 Ga0099826_10049670
808 Ga0105244_10006177
809 Ga0105244_10054056
810 Ga0105240_10011484
811 Ga0114129_10000681
812 Ga0105243_10009399
813 Ga0105241_10003035
814 Ga0105249_10264363
815 Ga0105239_10014794
816 Ga0105239_10131203
817 Ga0105246_10043073
818 Ga0105246_10531960
819 Ga0105246_10602434
820 Ga0157370_10057608
821 Ga0157369_10114233
822 Ga0157369_10129576
823 Ga0157369_10457542
824 Ga0157374_10122188
825 Ga0157372_10137066
826 Ga0157372_10360691
827 Ga0182008_10000552
828 Ga0182008_10000777
829 Ga0182007_10000554
830 Ga0182007_10000661
831 Ga0183367_1011
832 Ga0183367_1016
833 Ga0206356_10357540
834 Ga0224712_10091684
835 Ga0209129_1000180
836 Ga0209025_1001362
837 Ga0209051_1004857
838 Ga0207697_10004439
839 Ga0207692_10005516
840 Ga0207692_10121735
841 Ga0207647_10005581
842 Ga0207647_10005686
843 Ga0207647_10010531
844 Ga0207647_10013528
845 Ga0207647_10032455
846 Ga0207647_10090575
847 Ga0207647_10096689
848 Ga0207699_10003554
849 Ga0207699_10281098
850 Ga0207705_10313041
851 Ga0207654_10003921
852 Ga0207707_10050349
853 Ga0207695_10003004
854 Ga0207671_10000488
855 Ga0207693_10012884
856 Ga0207693_10022336
857 Ga0207693_10051422
858 Ga0207663_10060410
859 Ga0207663_10214767
860 Ga0207660_10064154
861 Ga0207657_10025688
862 Ga0207657_10112922
863 Ga0207646_10106023
864 Ga0207694_10001572
865 Ga0207700_10007329
866 Ga0207700_10046153
867 Ga0207700_10078808
868 Ga0207700_10086278
869 Ga0207700_10138432
870 Ga0207664_10012624
871 Ga0207664_10125027
872 Ga0207664_10342427
873 Ga0207664_10731517
874 Ga0207690_10098864
875 Ga0207706_10051112
876 Ga0207665_10045607
877 Ga0207665_10135810
878 Ga0207689_10180457
879 Ga0207689_10621902
880 Ga0207661_10027634
881 Ga0207661_10188297
882 Ga0207661_10250823
883 Ga0207667_10293489
884 Ga0207640_10010341
885 Ga0207640_10121888
886 Ga0207640_10145475
887 Ga0207677_10217350
888 Ga0207639_10136666
889 Ga0207639_10146051
890 Ga0207639_10177159
891 Ga0207678_10007418
892 Ga0207678_10081725
893 Ga0207678_10149752
894 Ga0207678_10564727
895 Ga0207708_10107363
896 Ga0207702_10266430
897 Ga0207702_10525361
898 Ga0207674_10037961
899 Ga0207674_10298506
900 Ga0207674_10479038
901 Ga0207675_100702086
902 Ga0207683_10054399
903 Ga0207698_10028688
904 Ga0207698_10152830
905 Ga0207698_10632428
906 Ga0209371_1021303
907 Ga0209813_10120765
908 Ga0268266_10090348
909 Ga0268266_10094709
910 Ga0268266_10532855
911 Ga0265337_1000230
912 Ga0265326_10001838
913 Ga0265319_1001673
914 Ga0265334_10000178
915 Ga0265334_10041226
916 Ga0265322_10014316
917 Ga0265336_10003119
918 Ga0265336_10003740
919 Ga0307517_10018152
920 Ga0307515_10010304
921 Ga0307515_10074461
922 Ga0307515_10250021
923 Ga0265338_10000683
924 Ga0265338_10054900
925 Ga0265324_10006327
926 Ga0265324_10009973
927 Ga0307511_10000672
928 Ga0307512_10000801
929 Ga0307512_10022842
930 Ga0265332_10020655
931 Ga0265332_10050673
932 Ga0265320_10007740
933 Ga0265325_10034084
934 Ga0265340_10001938
935 Ga0265340_10002640
936 Ga0265339_10005353
937 Ga0265339_10196402
938 Ga0265331_10014814
939 Ga0265316_10015012
940 Ga0307513_10001986
941 Ga0307513_10010977
942 Ga0307513_10031680
943 Ga0307509_10006518
944 Ga0307509_10011002
945 Ga0307509_10024641
946 Ga0307509_10035479
947 Ga0307509_10138169
948 Ga0265313_10004009
949 Ga0307508_10004718
950 Ga0307508_10013835
951 Ga0307508_10030536
952 Ga0307514_10005174
953 Ga0307514_10008786
954 Ga0307514_10101916
955 Ga0307514_10164558
956 Ga0265314_10010641
957 Ga0265342_10001496
958 Ga0265342_10049373
959 Ga0307516_10000841
960 Ga0307516_10059569
961 Ga0307516_10402392
962 Ga0307405_10049965
963 Ga0307413_10023094
964 Ga0307413_10113689
965 Ga0307518_10092157
966 Ga0307410_10295621
967 Ga0307410_10545948
968 Ga0307410_10693820
969 Ga0307409_100237851
970 Ga0307409_100247022
971 Ga0307409_100302300
972 Ga0307409_100532770
973 Ga0307409_100770785
974 Ga0307416_100192175
975 Ga0307415_100025726
976 Ga0307415_100266671
977 Ga0307507_10030151
978 Ga0307507_10060126
979 Ga0307507_10094661
980 Ga0307507_10163834
981 Ga0307510_10006065
982 Ga0307510_10057502
983 Ga0307510_10075977
984 Ga0307510_10130210
985 Ga0307510_10141332
986 Ga0373934_0031420
987 Ga0373944_0073491
988 Ga0373936_0010500
989 Ga0373954_0057351
990 Ga0373957_0085254
991 Ga0373955_0029602
992 Ga0373924_0011618
993 Ga0373935_0146614
994 Ga0373933_0016144
995 Ga0373925_0006443
996 Ga0395900_0231452
997 Ga0395898_0007719
998 Ga0395898_0036977
999 Ga0439436_0003837
1000 Ga0439436_0004109
1001 Ga0439436_0005195
1002 Ga0439436_0015754
1003 Ga0439438_071793
1004 Ga0439439_0000121
1005 Ga0439439_0003420
1006 Ga0439439_0010864
1007 Ga0439439_0072405
1008 Ga0451797_0640309
1009 Ga0451795_1034354
1010 Ga0451800_0421651
1011 Ga0451802_1768030
1012 Ga0451853_1223826
1013 Ga0451853_1833064
1014 Ga0439433_0003165
1015 Ga0439433_0007013
1016 Ga0439448_0011705
1017 Ga0439448_0017640
1018 Ga0439448_0090220
1019 Ga0439449_0007982
1020 Ga0439449_0012598
1021 Ga0439449_0015988
1022 Ga0439450_067692
1023 Ga0439457_000111
1024 Ga0439457_000307
1025 Ga0439457_000998
1026 Ga0439462_0017760
1027 Ga0450890_006837
1028 Ga0450894_000148
1029 Ga0450894_000258
1030 Ga0450894_000894
1031 Ga0450895_006859
1032 Ga0450896_000218
1033 Ga0450898_000150
1034 Ga0450898_000188
1035 Ga0450898_002540
1036 Ga0450899_000083
1037 Ga0450900_012551
1038 Ga0450903_000204
1039 Ga0450903_011561
1040 Ga0450906_000040
1041 Ga0450906_000331
1042 Ga0450906_000521
1043 Ga0439458_0000476
1044 Ga0439458_0003238
1045 Ga0439458_0009838
1046 Ga0450908_003549
1047 Ga0450908_010342
1048 Ga0439440_0016019
1049 Ga0466969_0002669
1050 Ga0466972_0000744
1051 Ga0466972_0036878
1052 Ga0466965_0001152
1053 Ga0466966_0006589
1054 Ga0466966_0011651
1055 Ga0466961_0001075
1056 Ga0466961_0009383
1057 Ga0466961_0527404
1058 Ga0466963_0010946
1059 Ga0466963_0036954
1060 Ga0466963_0037174
1061 Ga0466963_0078485
1062 Ga0466963_0122264
1063 Ga0466964_0002075
1064 Ga0466964_0150537
1065 Ga0466971_0000151
1066 Ga0466971_0010618
1067 Ga0466971_0032982
1068 Ga0466971_0088403
1069 Ga0466968_0033531
1070 Ga0466970_0025639
1071 Ga0466970_0078037
1072 Ga0466957_0102866
1073 Ga0466960_0009435
1074 Ga0466960_0144681
1075 Ga0466959_0002709
1076 Ga0466959_0008239
1077 Ga0466959_0049610
1078 Ga0466959_0089831
1079 Ga0466959_0108116
1080 Ga0466958_0008107
1081 Ga0466958_0027439
1082 Ga0466958_0058276
1083 Ga0466967_0002421
1084 Ga0466967_0041393
1085 Ga0466967_0063721
1086 Ga0466967_0087334
1087 Ga0466967_0255378
1088 Ga0466967_0621733
1089 Ga0495627_026909
1090 Ga0495592_0011446
1091 Ga0495592_0012776
1092 Ga0495592_0130734
1093 Ga0495603_0012311
1094 Ga0495629_0014036
1095 Ga0495629_0015196
1096 Ga0495629_0025807
1097 Ga0495629_0131760
1098 Ga0495629_0371008
1099 Ga0495638_0075194
1100 Ga0495651_0001705
1101 Ga0495651_0002959
1102 Ga0495651_0004042
1103 Ga0495653_0021618
1104 Ga0495650_0028062
1105 Ga0495650_0028239
1106 Ga0495650_0107007
1107 Ga0495580_0046716
1108 Ga0495580_0182859
1109 Ga0495582_0057870
1110 Ga0495605_0120762
1111 Ga0495639_0126083
1112 Ga0495639_0136025
1113 Ga0495662_0000534
1114 Ga0495662_0011551
1115 Ga0495662_0090320
1116 Ga0495662_0092381
1117 Ga0495664_0000617
1118 Ga0495664_0003610
1119 Ga0495664_0159761
1120 Ga0495585_0022960
1121 Ga0495585_0153112
1122 Ga0495594_0008240
1123 Ga0495594_0034337
1124 Ga0495594_0062842
1125 Ga0495596_0014822
1126 Ga0495596_0035274
1127 Ga0495583_0006789
1128 Ga0495583_0064824
1129 Ga0495583_0072513
1130 Ga0495606_0007389
1131 Ga0495608_0036891
1132 Ga0495608_0211865
1133 Ga0495610_0059901
1134 Ga0495616_0018556
1135 Ga0495618_0218426
1136 Ga0495620_0010158
1137 Ga0495628_0004349
1138 Ga0495628_0036786
1139 Ga0495628_0071763
1140 Ga0495628_0100719
1141 Ga0495628_0220511
1142 Ga0495630_0169651
1143 Ga0495630_0400598
1144 Ga0495630_0413688
1145 Ga0495631_0003534
1146 Ga0495637_0019780
1147 Ga0495643_0005450
1148 Ga0495643_0010819
1149 Ga0495648_0037742
1150 Ga0495648_0070367
1151 Ga0495652_0001214
1152 Ga0495652_0004196
1153 Ga0495652_0031801
1154 Ga0495654_0162063
1155 Ga0495665_0199212
1156 Ga0495640_0014013
1157 Ga0495640_0040118
1158 Ga0495586_0020844
1159 Ga0495586_0039468
1160 Ga0495586_0067886
1161 Ga0495587_0003123
1162 Ga0495587_0037947
1163 Ga0495587_0067962
1164 Ga0495609_0006276
1165 Ga0495597_0114070
1166 Ga0495645_0005263
1167 Ga0495645_0027092
1168 Ga0495645_0035747
1169 Ga0495633_0019430
1170 Ga0495656_0042467
1171 Ga0495668_0047568
1172 Ga0495668_0064320
1173 Ga0495634_0005064
1174 Ga0495634_0015110
1175 Ga0495634_0095421
1176 Ga0495611_0040066
1177 Ga0495611_0108677
1178 Ga0495625_0022762
1179 Ga0495625_0050603
1180 Ga0495625_0221413
1181 Ga0495635_0001004
1182 Ga0495635_0006399
1183 Ga0495635_0008784
1184 Ga0495635_0122104
1185 Ga0495661_0015013
1186 Ga0495588_0005143
1187 Ga0495588_0007950
1188 Ga0495657_0007012
1189 Ga0495657_0007655
1190 Ga0495657_0046225
1191 Ga0495657_0056586
1192 Ga0495599_0263107
1193 Ga0495623_0038419
1194 Ga0495623_0140009
1195 Ga0495646_0027436
1196 Ga0495646_0057201
1197 Ga0495646_0126822
1198 Ga0495647_0034238
1199 Ga0495658_0008782
1200 Ga0495658_0009802
1201 Ga0495658_0025901
1202 Ga0495613_0017227
1203 Ga0495613_0017594
1204 Ga0495613_0039155
1205 Ga0495613_0097823
1206 Ga0495671_0027920
1207 Ga0495589_0017853
1208 Ga0495589_0056999
1209 Ga0495589_0174134
1210 Ga0495600_0017891
1211 Ga0495660_0102664
1212 Ga0495581_0021486
1213 Ga0495581_0038159
1214 Ga0495581_0063538
1215 Ga0495581_0075144
1216 Ga0495604_0003200
1217 Ga0495604_0004760
1218 Ga0495604_0045322
1219 Ga0495604_0066312
1220 Ga0495604_0239144
1221 Ga0495636_0018692
1222 Ga0495636_0024149
1223 Ga0495636_0072794
1224 Ga0495674_0069192
1225 Ga0495674_0334491
1226 Ga0495674_0518661
1227 Ga0495676_0012001
1228 Ga0495676_0017146
1229 Ga0495676_0021121
1230 Ga0495676_0072134
1231 Ga0495676_0084970
1232 Ga0495680_0010905
1233 Ga0495680_0158276
1234 Ga0495683_0042719
1235 Ga0495687_001648
1236 Ga0495687_005720
1237 Ga0495687_012644
1238 Ga0495687_061924
1239 Ga0495687_068479
1240 Ga0495687_082509
1241 Ga0495687_127269
1242 Ga0495685_004021
1243 Ga0495685_042950
1244 Ga0495681_0001693
1245 Ga0495681_0003555
1246 Ga0495681_0018274
1247 Ga0495684_0172801
1248 Ga0495686_0126084
1249 Ga0495593_0003639
1250 Ga0495593_0005185
1251 Ga0495602_0044426
1252 Ga0495602_0048087
1253 Ga0495602_0112008
1254 Ga0495614_0000841
1255 Ga0495614_0124692
1256 Ga0495626_0031029
1257 Ga0496100_0320045
1258 Ga0496101_0203665
1259 Ga0496103_0048374
1260 Ga0496104_0001344
1261 Ga0496105_0015905
1262 Ga0496105_0104975
1263 Ga0496108_0003880
1264 Ga0496108_0276214
1265 Ga0496109_0009141
1266 Ga0496110_0077753
1267 Ga0496111_0000184
1268 Ga0496111_0646386
1269 Ga0496112_0789927
1270 Ga0496113_0383910
1271 Ga0496114_0045997
1272 Ga0496114_0087355
1273 Ga0496114_0204771
1274 Ga0496114_0240856
1275 Ga0496114_0468784
1276 Ga0496115_0058151
1277 Ga0496115_0106671
1278 Ga0496126_0040528
1279 Ga0496126_0052562
1280 Ga0496126_0189384
1281 Ga0495678_040733
1282 Ga0501031_0026720
1283 Ga0501032_0159857
1284 Ga0501033_0016410
1285 Ga0501033_0124749
1286 Ga0501038_0004886
1287 Ga0501038_0056791
1288 Ga0501039_0012962
1289 Ga0501039_0038797
1290 Ga0501040_0022715
1291 Ga0501040_0129682
1292 Ga0501041_0027512
1293 Ga0501042_0025091
1294 Ga0501043_0234243
1295 Ga0501046_0115301
1296 Ga0501048_0027173
1297 Ga0501048_0203577
1298 Ga0501069_0234904
1299 Ga0501070_0334905
1300 Ga0501070_0642175
1301 Ga0501071_0106982
1302 Ga0501071_0107270
1303 Ga0501071_0528061
1304 Ga0501072_0016239
1305 Ga0501076_0052533
1306 Ga0501079_0153950
1307 Ga0501079_0273516
1308 Ga0501081_0105440
1309 Ga0501035_0789158
1310 Ga0501044_0129950
1311 Ga0501045_0150440
1312 nmdc:mga03n38_113996_c1
1313 nmdc:mga03n38_59632_c1
1314 nmdc:mga0yw44_9998_c1
1315 nmdc:mga06z11_3522_c1
1316 nmdc:mga06z11_79061_c1
1317 nmdc:mga04h51_141831_c1
1318 nmdc:mga05p37_190442_c1
1319 nmdc:mga0qj67_177337_c1
1320 nmdc:mga06r32_517459_c1
1321 nmdc:mga08y16_481470_c1
1322 Ga0495601_0046889
1323 Ga0495601_0080219
1324 Ga0495601_0257853
1325 Ga0495612_0030361
1326 Ga0495612_0052942
1327 Ga0500635_0000006
1328 Ga0495655_0009402
1329 Ga0495655_0043695
1330 Ga0495619_0236981
1331 Ga0495619_0254160
1332 Ga0495619_0347717
1333 Ga0500578_0028597
1334 Ga0500578_0095711
1335 Ga0500583_0077922
1336 Ga0500640_001432
1337 Ga0500640_090474
1338 Ga0500654_093215
1339 Ga0500660_090749
1340 Ga0500553_082981
1341 Ga0500553_099182
1342 Ga0500553_101657
1343 Ga0500560_005769
1344 Ga0500560_108310
1345 Ga0500569_001328
1346 Ga0500580_047549
1347 Ga0500621_091258
1348 Ga0500628_000785
1349 Ga0500652_012391
1350 Ga0500658_0011811
1351 Ga0500561_0009872
1352 Ga0500573_0017609
1353 Ga0500573_0069670
1354 Ga0500579_029352
1355 Ga0500600_0027671
1356 Ga0500616_0004587
1357 Ga0500616_0011605
1358 Ga0500633_0026027
1359 Ga0500634_0041823
1360 Ga0500587_001195
1361 Ga0466962_0000203
1362 Ga0466962_0009988
1363 Ga0466962_0013923
1364 Ga0530510_0049948
1365 Ga0530510_0145979
1366 2966604224
1367 2585304325
1368 2585314956
1369 2587864724
1370 2616698793
1371 2643760014
1372 2643904984
1373 2644403043
1374 2644440778
1375 2644460290
1376 2644631094
1377 2676489056
1378 2731909369
1379 2785346268
1380 2785346317
1381 2785346826
1382 2785373391
1383 2785373451
1384 2786674605
1385 2808845504
1386 2808915210
1387 2812354187
1388 2812482928
1389 2816427009
1390 2844850581
1391 2852635863
1392 2852642595
1393 2857744859
1394 2862282898
1395 2862386815
1396 2863407847
1397 2867431623
1398 2877677032
1399 2877677527
1400 2884702668
1401 2887446781
1402 2895429477
1403 2895452168
1404 2899371203
1405 2904499108
1406 2910811428
1407 2912715776
1408 2919060911
1409 2919472853
1410 2932430161
1411 2933422151
1412 2939651234
1413 2939678959
1414 2946052410
1415 2946071511
1416 2946079871
1417 2947225267
1418 2954009434
1419 2954382258
1420 2954390056
1421 2954680798
1422 2954683357
1423 2954693085
1424 2954708159
1425 2954712758
1426 2954722717
1427 2954739143
1428 2954741597
1429 2954757972
1430 2954760608
1431 2990066967
1432 2997608423
1433 8003322633
1434 8008560421
1435 8048410554
1436 8056836320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

193

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

246

0.91

PF08659

KR

KR domain

7

183

0.75

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

241

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dqx-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9649 1 242
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.959 3 241
3sju-assembly1.cif.gz_A hedamycin polyketide ketoreductase bound to nadph 0.9572 8 244
6ffb-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant s205 - mutant q148a - in complex with a nonsteroidal inhibitor 0.9541 1 245
4yqz-assembly1.cif.gz_B crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9539 1 242
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 4 174 3.40.50.720
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 3 241 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9577 50 169 3.40.50.720
4yqzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9523 4 241 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9518 4 186 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1X4HYD4-F1-model_v4 Short-chain dehydrogenase 0.9987 1 222 GO:0016491
AF-A0A6I3FNJ5-F1-model_v4 SDR family oxidoreductase 0.997 74 248 GO:0016491
AF-A0A345XXH1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9969 2 252 GO:0016491
AF-A0A2N0EMC4-F1-model_v4 deleted 0.9967 1 249
AF-A0A367EHH1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9954 3 251 GO:0016491

Map