F477230
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 296 | 718 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100113208|Ga0075434_1001132083 |
| Length | 373 |
| Sequence | MGVKDERKPGRAPAQGPRLVRKSDYSDPAPLPEDLQEETRLRPLALDDFIGQSAVKEQLRISLEAARRRGEAMDHILFHGPPGLGKTTLASIVAHELGVEISRSSGPVIEKPYDLAGLLTNLEPRGVLFLDEIHRLSPVVEEYLYPALEDFAVDILIDRGPGARSVKLNLEPFTLVGATTRSGLLSAPLRSRFGVTLRLDYYGAEDLAQIVRRSAGILAVDVEEAAAVVIARRARGTPRIANRLLRRVRDFALIKSDGRVTRDVTTEALRLLAVDERGLDDMDRRLLDALITKYGGGPVGLNTLAVVVGEEAGTLEDVYEPFLVQEGFIKRTPRGREATPLAYTHLGLQPPPGSGAGTVADKRAPQQPELPLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 179 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 183 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 184 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 211 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 212 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 213 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 214 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 215 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 216 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 217 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 218 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 219 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.28 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0 |
| Rhizoplane | 2.64 |
| Rhizosphere | 91.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10208653 | 3300005293 | Bacteria | 1325 |
| 2 | Ga0070676_10000920 | 3300005328 | Bacteria | 14563 |
| 3 | Ga0070676_10047022 | 3300005328 | Bacteria | 2518 |
| 4 | Ga0070683_100056652 | 3300005329 | Bacteria | 3640 |
| 5 | Ga0070690_100029402 | 3300005330 | Bacteria | 3408 |
| 6 | Ga0068869_100001130 | 3300005334 | Bacteria | 15569 |
| 7 | Ga0068869_100006522 | 3300005334 | Bacteria | 7407 |
| 8 | Ga0068869_100012050 | 3300005334 | Bacteria | 5697 |
| 9 | Ga0068869_100062433 | 3300005334 | Bacteria | 2735 |
| 10 | Ga0070666_10009938 | 3300005335 | Bacteria | 5939 |
| 11 | Ga0070680_100004576 | 3300005336 | Bacteria | 10399 |
| 12 | Ga0070682_100005442 | 3300005337 | Bacteria | 7097 |
| 13 | Ga0068868_100089220 | 3300005338 | Bacteria | 2482 |
| 14 | Ga0070660_100000332 | 3300005339 | Bacteria | 31219 |
| 15 | Ga0070689_100058703 | 3300005340 | Bacteria | 2988 |
| 16 | Ga0070691_10017004 | 3300005341 | Bacteria | 3346 |
| 17 | Ga0070691_10024098 | 3300005341 | Bacteria | 2828 |
| 18 | Ga0070687_100003822 | 3300005343 | Bacteria | 5914 |
| 19 | Ga0070687_100010610 | 3300005343 | Bacteria | 3994 |
| 20 | Ga0070687_100116018 | 3300005343 | Bacteria | 1524 |
| 21 | Ga0070661_100009598 | 3300005344 | Bacteria | 6703 |
| 22 | Ga0070661_100085079 | 3300005344 | Bacteria | 2336 |
| 23 | Ga0070692_10002146 | 3300005345 | Bacteria | 7559 |
| 24 | Ga0070692_10023997 | 3300005345 | Bacteria | 2993 |
| 25 | Ga0070668_100034892 | 3300005347 | Bacteria | 3834 |
| 26 | Ga0070669_100002755 | 3300005353 | Bacteria | 12681 |
| 27 | Ga0070669_100032732 | 3300005353 | Bacteria | 3756 |
| 28 | Ga0070669_100096592 | 3300005353 | Bacteria | 2223 |
| 29 | Ga0070675_100000147 | 3300005354 | Bacteria | 42295 |
| 30 | Ga0070675_100209221 | 3300005354 | Bacteria | 1695 |
| 31 | Ga0070674_100175096 | 3300005356 | Bacteria | 1639 |
| 32 | Ga0070688_100206021 | 3300005365 | Bacteria | 1378 |
| 33 | Ga0070659_100001428 | 3300005366 | Bacteria | 17225 |
| 34 | Ga0070667_100001231 | 3300005367 | Bacteria | 23262 |
| 35 | Ga0070703_10007460 | 3300005406 | Bacteria | 3072 |
| 36 | Ga0070709_10026406 | 3300005434 | Bacteria | 3442 |
| 37 | Ga0070709_10127511 | 3300005434 | Bacteria | 1733 |
| 38 | Ga0070701_10005551 | 3300005438 | Bacteria | 5220 |
| 39 | Ga0070701_10041825 | 3300005438 | Bacteria | 2337 |
| 40 | Ga0070705_100000542 | 3300005440 | Bacteria | 21855 |
| 41 | Ga0070700_100005861 | 3300005441 | Bacteria | 6525 |
| 42 | Ga0070694_100000839 | 3300005444 | Bacteria | 17297 |
| 43 | Ga0070694_100003904 | 3300005444 | Bacteria | 8915 |
| 44 | Ga0070694_100010230 | 3300005444 | Bacteria | 5778 |
| 45 | Ga0070694_100019487 | 3300005444 | Bacteria | 4315 |
| 46 | Ga0070694_100240019 | 3300005444 | Bacteria | 1367 |
| 47 | Ga0070708_100028783 | 3300005445 | Bacteria | 4783 |
| 48 | Ga0070708_100036585 | 3300005445 | Bacteria | 4282 |
| 49 | Ga0070708_100094405 | 3300005445 | Bacteria | 2729 |
| 50 | Ga0070708_100094591 | 3300005445 | Bacteria | 2726 |
| 51 | Ga0070708_100151506 | 3300005445 | Bacteria | 2157 |
| 52 | Ga0070708_100271637 | 3300005445 | Bacteria | 1595 |
| 53 | Ga0070708_100306122 | 3300005445 | Bacteria | 1496 |
| 54 | Ga0070663_100002069 | 3300005455 | Bacteria | 11198 |
| 55 | Ga0070678_100212097 | 3300005456 | Bacteria | 1605 |
| 56 | Ga0070662_100009230 | 3300005457 | Bacteria | 6441 |
| 57 | Ga0070662_100104757 | 3300005457 | Bacteria | 2147 |
| 58 | Ga0070662_100115885 | 3300005457 | Bacteria | 2047 |
| 59 | Ga0070681_10018854 | 3300005458 | Bacteria | 6904 |
| 60 | Ga0068867_100000884 | 3300005459 | Bacteria | 20270 |
| 61 | Ga0068867_100025393 | 3300005459 | Bacteria | 4251 |
| 62 | Ga0070706_100010113 | 3300005467 | Bacteria | 8768 |
| 63 | Ga0070706_100024833 | 3300005467 | Bacteria | 5517 |
| 64 | Ga0070706_100036412 | 3300005467 | Bacteria | 4545 |
| 65 | Ga0070706_100057489 | 3300005467 | Bacteria | 3589 |
| 66 | Ga0070707_100007265 | 3300005468 | Bacteria | 10285 |
| 67 | Ga0070707_100027866 | 3300005468 | Bacteria | 5374 |
| 68 | Ga0070707_100032051 | 3300005468 | Bacteria | 5006 |
| 69 | Ga0070707_100098450 | 3300005468 | Bacteria | 2833 |
| 70 | Ga0070707_100142874 | 3300005468 | Bacteria | 2329 |
| 71 | Ga0070698_100014079 | 3300005471 | Bacteria | 8457 |
| 72 | Ga0070698_100063516 | 3300005471 | Bacteria | 3723 |
| 73 | Ga0070698_100236197 | 3300005471 | Bacteria | 1761 |
| 74 | Ga0070699_100001741 | 3300005518 | Bacteria | 19879 |
| 75 | Ga0070699_100009282 | 3300005518 | Bacteria | 8521 |
| 76 | Ga0070699_100022694 | 3300005518 | Bacteria | 5409 |
| 77 | Ga0070699_100028105 | 3300005518 | Bacteria | 4850 |
| 78 | Ga0070699_100058928 | 3300005518 | Bacteria | 3327 |
| 79 | Ga0070699_100119845 | 3300005518 | Bacteria | 2313 |
| 80 | Ga0070699_100200134 | 3300005518 | Bacteria | 1776 |
| 81 | Ga0070679_100000895 | 3300005530 | Bacteria | 25859 |
| 82 | Ga0070684_100046493 | 3300005535 | Bacteria | 3761 |
| 83 | Ga0070684_100046615 | 3300005535 | Bacteria | 3756 |
| 84 | Ga0070684_100179256 | 3300005535 | Bacteria | 1926 |
| 85 | Ga0070697_100009170 | 3300005536 | Bacteria | 7730 |
| 86 | Ga0070697_100012093 | 3300005536 | Bacteria | 6758 |
| 87 | Ga0070697_100031758 | 3300005536 | Bacteria | 4248 |
| 88 | Ga0070697_100154827 | 3300005536 | Bacteria | 1934 |
| 89 | Ga0070697_100161285 | 3300005536 | Bacteria | 1894 |
| 90 | Ga0068853_100002471 | 3300005539 | Bacteria | 13838 |
| 91 | Ga0070672_100054067 | 3300005543 | Bacteria | 3142 |
| 92 | Ga0070686_100028847 | 3300005544 | Bacteria | 3369 |
| 93 | Ga0070695_100000685 | 3300005545 | Bacteria | 18104 |
| 94 | Ga0070695_100004819 | 3300005545 | Bacteria | 7939 |
| 95 | Ga0070695_100006806 | 3300005545 | Bacteria | 6768 |
| 96 | Ga0070695_100031556 | 3300005545 | Bacteria | 3307 |
| 97 | Ga0070696_100006243 | 3300005546 | Bacteria | 7975 |
| 98 | Ga0070696_100008767 | 3300005546 | Bacteria | 6766 |
| 99 | Ga0070696_100039506 | 3300005546 | Bacteria | 3258 |
| 100 | Ga0070696_100078406 | 3300005546 | Bacteria | 2336 |
| 101 | Ga0070693_100001933 | 3300005547 | Bacteria | 9483 |
| 102 | Ga0070704_100000570 | 3300005549 | Bacteria | 17791 |
| 103 | Ga0070704_100043264 | 3300005549 | Bacteria | 3121 |
| 104 | Ga0070704_100090359 | 3300005549 | Bacteria | 2281 |
| 105 | Ga0070704_100205617 | 3300005549 | Bacteria | 1592 |
| 106 | Ga0068855_100002792 | 3300005563 | Bacteria | 21489 |
| 107 | Ga0070664_100013072 | 3300005564 | Bacteria | 6755 |
| 108 | Ga0070664_100014425 | 3300005564 | Bacteria | 6443 |
| 109 | Ga0070664_100347928 | 3300005564 | Bacteria | 1347 |
| 110 | Ga0068857_100015332 | 3300005577 | Bacteria | 6692 |
| 111 | Ga0068857_100054677 | 3300005577 | Bacteria | 3542 |
| 112 | Ga0068854_100000353 | 3300005578 | Bacteria | 29520 |
| 113 | Ga0068854_100170384 | 3300005578 | Bacteria | 1694 |
| 114 | Ga0068856_100015448 | 3300005614 | Bacteria | 7377 |
| 115 | Ga0070702_100020943 | 3300005615 | Bacteria | 3433 |
| 116 | Ga0070702_100151707 | 3300005615 | Bacteria | 1488 |
| 117 | Ga0068852_100296429 | 3300005616 | Bacteria | 1564 |
| 118 | Ga0068859_100002575 | 3300005617 | Bacteria | 18433 |
| 119 | Ga0068859_100098878 | 3300005617 | Bacteria | 2972 |
| 120 | Ga0068859_100273962 | 3300005617 | Bacteria | 1780 |
| 121 | Ga0068859_100519076 | 3300005617 | Bacteria | 1286 |
| 122 | Ga0068864_100002331 | 3300005618 | Bacteria | 15700 |
| 123 | Ga0068864_100019308 | 3300005618 | Bacteria | 5698 |
| 124 | Ga0068861_100128932 | 3300005719 | Bacteria | 2051 |
| 125 | Ga0068861_100176541 | 3300005719 | Bacteria | 1774 |
| 126 | Ga0068870_10001193 | 3300005840 | Bacteria | 10423 |
| 127 | Ga0068863_100009799 | 3300005841 | Bacteria | 9338 |
| 128 | Ga0068863_100018065 | 3300005841 | Bacteria | 6753 |
| 129 | Ga0068863_100263192 | 3300005841 | Bacteria | 1668 |
| 130 | Ga0068858_100013709 | 3300005842 | Bacteria | 7650 |
| 131 | Ga0068858_100035521 | 3300005842 | Bacteria | 4623 |
| 132 | Ga0068858_100072563 | 3300005842 | Bacteria | 3194 |
| 133 | Ga0068860_100004896 | 3300005843 | Bacteria | 13649 |
| 134 | Ga0068860_100104122 | 3300005843 | Bacteria | 2709 |
| 135 | Ga0068860_100199773 | 3300005843 | Bacteria | 1937 |
| 136 | Ga0068860_100258327 | 3300005843 | Bacteria | 1697 |
| 137 | Ga0068860_100355197 | 3300005843 | Bacteria | 1443 |
| 138 | Ga0068862_100014194 | 3300005844 | Bacteria | 6605 |
| 139 | Ga0068862_100446816 | 3300005844 | Bacteria | 1218 |
| 140 | Ga0081538_10013563 | 3300005981 | Bacteria | 6444 |
| 141 | Ga0081538_10023994 | 3300005981 | Bacteria | 4361 |
| 142 | Ga0081540_1015632 | 3300005983 | Bacteria | 4795 |
| 143 | Ga0070716_100035601 | 3300006173 | Bacteria | 2738 |
| 144 | Ga0070712_100013158 | 3300006175 | Bacteria | 5279 |
| 145 | Ga0075367_10052431 | 3300006178 | Bacteria | 2414 |
| 146 | Ga0075366_10090882 | 3300006195 | Bacteria | 1829 |
| 147 | Ga0097621_100008941 | 3300006237 | Bacteria | 7242 |
| 148 | Ga0068871_100009037 | 3300006358 | Bacteria | 7197 |
| 149 | Ga0068871_100195523 | 3300006358 | Bacteria | 1744 |
| 150 | Ga0075428_100053120 | 3300006844 | Bacteria | 4439 |
| 151 | Ga0075428_100105380 | 3300006844 | Bacteria | 3075 |
| 152 | Ga0075428_100186965 | 3300006844 | Bacteria | 2241 |
| 153 | Ga0075428_100189129 | 3300006844 | Bacteria | 2227 |
| 154 | Ga0075428_100249476 | 3300006844 | Bacteria | 1913 |
| 155 | Ga0075430_100040160 | 3300006846 | Bacteria | 3961 |
| 156 | Ga0075430_100068786 | 3300006846 | Bacteria | 2971 |
| 157 | Ga0075431_100004465 | 3300006847 | Bacteria | 13728 |
| 158 | Ga0075431_100006780 | 3300006847 | Bacteria | 11370 |
| 159 | Ga0075431_100054782 | 3300006847 | Bacteria | 4113 |
| 160 | Ga0075431_100225077 | 3300006847 | Bacteria | 1913 |
| 161 | Ga0075431_100306812 | 3300006847 | Bacteria | 1603 |
| 162 | Ga0075431_100315366 | 3300006847 | Bacteria | 1577 |
| 163 | Ga0075433_10002435 | 3300006852 | Bacteria | 14167 |
| 164 | Ga0075433_10003721 | 3300006852 | Bacteria | 11804 |
| 165 | Ga0075433_10009354 | 3300006852 | Bacteria | 7835 |
| 166 | Ga0075433_10011237 | 3300006852 | Bacteria | 7208 |
| 167 | Ga0075433_10031005 | 3300006852 | Bacteria | 4566 |
| 168 | Ga0075433_10124271 | 3300006852 | Bacteria | 2292 |
| 169 | Ga0075434_100005150 | 3300006871 | Bacteria | 11874 |
| 170 | Ga0075434_100006466 | 3300006871 | Bacteria | 10738 |
| 171 | Ga0075434_100012438 | 3300006871 | Bacteria | 8070 |
| 172 | Ga0075434_100022709 | 3300006871 | Bacteria | 6109 |
| 173 | Ga0075434_100040276 | 3300006871 | Bacteria | 4627 |
| 174 | Ga0075434_100109296 | 3300006871 | Bacteria | 2775 |
| 175 | Ga0075434_100113208 | 3300006871 | Bacteria | 2725 |
| 176 | Ga0075434_100128910 | 3300006871 | Bacteria | 2548 |
| 177 | Ga0075434_100219667 | 3300006871 | Bacteria | 1920 |
| 178 | Ga0075429_100001793 | 3300006880 | Bacteria | 17793 |
| 179 | Ga0075429_100026975 | 3300006880 | Bacteria | 4988 |
| 180 | Ga0075429_100027715 | 3300006880 | Bacteria | 4917 |
| 181 | Ga0075429_100110824 | 3300006880 | Bacteria | 2399 |
| 182 | Ga0075429_100168965 | 3300006880 | Bacteria | 1916 |
| 183 | Ga0075429_100189347 | 3300006880 | Bacteria | 1803 |
| 184 | Ga0075429_100295395 | 3300006880 | Bacteria | 1418 |
| 185 | Ga0068865_100074659 | 3300006881 | Bacteria | 2415 |
| 186 | Ga0075436_100018737 | 3300006914 | Bacteria | 4740 |
| 187 | Ga0075436_100021161 | 3300006914 | Bacteria | 4463 |
| 188 | Ga0075436_100065946 | 3300006914 | Bacteria | 2502 |
| 189 | Ga0075436_100099568 | 3300006914 | Bacteria | 2024 |
| 190 | Ga0075436_100144565 | 3300006914 | Bacteria | 1672 |
| 191 | Ga0075436_100195909 | 3300006914 | Bacteria | 1430 |
| 192 | Ga0097620_100002575 | 3300006931 | Bacteria | 18433 |
| 193 | Ga0097620_100098877 | 3300006931 | Bacteria | 2972 |
| 194 | Ga0097620_100273978 | 3300006931 | Bacteria | 1780 |
| 195 | Ga0097620_100519094 | 3300006931 | Bacteria | 1286 |
| 196 | Ga0075435_100000353 | 3300007076 | Bacteria | 28240 |
| 197 | Ga0075435_100002502 | 3300007076 | Bacteria | 12221 |
| 198 | Ga0075435_100003692 | 3300007076 | Bacteria | 10429 |
| 199 | Ga0075435_100005683 | 3300007076 | Bacteria | 8742 |
| 200 | Ga0075435_100006608 | 3300007076 | Bacteria | 8210 |
| 201 | Ga0075435_100039378 | 3300007076 | Bacteria | 3771 |
| 202 | Ga0075435_100041034 | 3300007076 | Bacteria | 3698 |
| 203 | Ga0105240_10033526 | 3300009093 | Bacteria | 6634 |
| 204 | Ga0105240_10037405 | 3300009093 | Bacteria | 6239 |
| 205 | Ga0105240_10414769 | 3300009093 | Bacteria | 1514 |
| 206 | Ga0111539_10000370 | 3300009094 | Bacteria | 55548 |
| 207 | Ga0111539_10007648 | 3300009094 | Bacteria | 13810 |
| 208 | Ga0111539_10008974 | 3300009094 | Bacteria | 12658 |
| 209 | Ga0111539_10064712 | 3300009094 | Bacteria | 4324 |
| 210 | Ga0105245_10192365 | 3300009098 | Bacteria | 1955 |
| 211 | Ga0114129_10000599 | 3300009147 | Bacteria | 44461 |
| 212 | Ga0114129_10001588 | 3300009147 | Bacteria | 30837 |
| 213 | Ga0114129_10008029 | 3300009147 | Bacteria | 15033 |
| 214 | Ga0114129_10013395 | 3300009147 | Bacteria | 11687 |
| 215 | Ga0114129_10049917 | 3300009147 | Bacteria | 5878 |
| 216 | Ga0114129_10082634 | 3300009147 | Bacteria | 4463 |
| 217 | Ga0114129_10091152 | 3300009147 | Bacteria | 4224 |
| 218 | Ga0114129_10096097 | 3300009147 | Bacteria | 4103 |
| 219 | Ga0114129_10100951 | 3300009147 | Bacteria | 3993 |
| 220 | Ga0114129_10140137 | 3300009147 | Bacteria | 3316 |
| 221 | Ga0114129_10177852 | 3300009147 | Bacteria | 2897 |
| 222 | Ga0114129_10317226 | 3300009147 | Bacteria | 2073 |
| 223 | Ga0105243_10016738 | 3300009148 | Bacteria | 5543 |
| 224 | Ga0105243_10186225 | 3300009148 | Bacteria | 1809 |
| 225 | Ga0105241_10000218 | 3300009174 | Bacteria | 43050 |
| 226 | Ga0105241_10067794 | 3300009174 | Bacteria | 2763 |
| 227 | Ga0105241_10107272 | 3300009174 | Bacteria | 2231 |
| 228 | Ga0105241_10353635 | 3300009174 | Bacteria | 1276 |
| 229 | Ga0105242_10006162 | 3300009176 | Bacteria | 9238 |
| 230 | Ga0105242_10013124 | 3300009176 | Bacteria | 6393 |
| 231 | Ga0105242_10054403 | 3300009176 | Bacteria | 3271 |
| 232 | Ga0105242_10143429 | 3300009176 | Bacteria | 2075 |
| 233 | Ga0105248_10009010 | 3300009177 | Bacteria | 10973 |
| 234 | Ga0105248_10056969 | 3300009177 | Bacteria | 4385 |
| 235 | Ga0105248_10109769 | 3300009177 | Bacteria | 3110 |
| 236 | Ga0105248_10670630 | 3300009177 | Bacteria | 1170 |
| 237 | Ga0105237_10250382 | 3300009545 | Bacteria | 1774 |
| 238 | Ga0105249_10261067 | 3300009553 | Bacteria | 1721 |
| 239 | Ga0105246_10235698 | 3300011119 | Bacteria | 1443 |
| 240 | Ga0157373_10000381 | 3300013100 | Bacteria | 35500 |
| 241 | Ga0157371_10057611 | 3300013102 | Bacteria | 2756 |
| 242 | Ga0157369_10021069 | 3300013105 | Bacteria | 7287 |
| 243 | Ga0157374_10096758 | 3300013296 | Bacteria | 2824 |
| 244 | Ga0157374_10168977 | 3300013296 | Bacteria | 2132 |
| 245 | Ga0157378_10061725 | 3300013297 | Bacteria | 3346 |
| 246 | Ga0157378_10081633 | 3300013297 | Bacteria | 2922 |
| 247 | Ga0157378_10234798 | 3300013297 | Bacteria | 1749 |
| 248 | Ga0163162_10024603 | 3300013306 | Bacteria | 5946 |
| 249 | Ga0157372_10001479 | 3300013307 | Bacteria | 25510 |
| 250 | Ga0157375_10470100 | 3300013308 | Bacteria | 1423 |
| 251 | Ga0163163_10039033 | 3300014325 | Bacteria | 4632 |
| 252 | Ga0157380_10293427 | 3300014326 | Bacteria | 1494 |
| 253 | Ga0157377_10009096 | 3300014745 | Bacteria | 4865 |
| 254 | Ga0157377_10071857 | 3300014745 | Bacteria | 2002 |
| 255 | Ga0157379_10076905 | 3300014968 | Bacteria | 2988 |
| 256 | Ga0157376_10153466 | 3300014969 | Bacteria | 2079 |
| 257 | Ga0157376_10225460 | 3300014969 | Bacteria | 1738 |
| 258 | Ga0182007_10044034 | 3300015262 | Bacteria | 1482 |
| 259 | Ga0163161_10245892 | 3300017792 | Bacteria | 1393 |
| 260 | Ga0206353_11022215 | 3300020082 | Bacteria | 3310 |
| 261 | Ga0213875_10000088 | 3300021388 | Bacteria | 106188 |
| 262 | Ga0224712_10034945 | 3300022467 | Bacteria | 1852 |
| 263 | Ga0207653_10002272 | 3300025885 | Bacteria | 6123 |
| 264 | Ga0207653_10003610 | 3300025885 | Bacteria | 4873 |
| 265 | Ga0207642_10036586 | 3300025899 | Bacteria | 2108 |
| 266 | Ga0207710_10004508 | 3300025900 | Bacteria | 6063 |
| 267 | Ga0207680_10003662 | 3300025903 | Bacteria | 7222 |
| 268 | Ga0207699_10075166 | 3300025906 | Bacteria | 2077 |
| 269 | Ga0207699_10150163 | 3300025906 | Bacteria | 1541 |
| 270 | Ga0207645_10002083 | 3300025907 | Bacteria | 16009 |
| 271 | Ga0207645_10078469 | 3300025907 | Bacteria | 2116 |
| 272 | Ga0207643_10000157 | 3300025908 | Bacteria | 46902 |
| 273 | Ga0207684_10010713 | 3300025910 | Bacteria | 8051 |
| 274 | Ga0207684_10034553 | 3300025910 | Bacteria | 4295 |
| 275 | Ga0207684_10049280 | 3300025910 | Bacteria | 3573 |
| 276 | Ga0207684_10051693 | 3300025910 | Bacteria | 3487 |
| 277 | Ga0207654_10039930 | 3300025911 | Bacteria | 2642 |
| 278 | Ga0207654_10045188 | 3300025911 | Bacteria | 2505 |
| 279 | Ga0207707_10000258 | 3300025912 | Bacteria | 57257 |
| 280 | Ga0207695_10025254 | 3300025913 | Bacteria | 6656 |
| 281 | Ga0207693_10001303 | 3300025915 | Bacteria | 22126 |
| 282 | Ga0207660_10001383 | 3300025917 | Bacteria | 16275 |
| 283 | Ga0207662_10019281 | 3300025918 | Bacteria | 3879 |
| 284 | Ga0207662_10090015 | 3300025918 | Bacteria | 1886 |
| 285 | Ga0207657_10000373 | 3300025919 | Bacteria | 47375 |
| 286 | Ga0207657_10155214 | 3300025919 | Bacteria | 1862 |
| 287 | Ga0207649_10002783 | 3300025920 | Bacteria | 9659 |
| 288 | Ga0207649_10060358 | 3300025920 | Bacteria | 2383 |
| 289 | Ga0207652_10092848 | 3300025921 | Bacteria | 2655 |
| 290 | Ga0207646_10019790 | 3300025922 | Bacteria | 6247 |
| 291 | Ga0207646_10026953 | 3300025922 | Bacteria | 5239 |
| 292 | Ga0207646_10027112 | 3300025922 | Bacteria | 5224 |
| 293 | Ga0207646_10046844 | 3300025922 | Bacteria | 3879 |
| 294 | Ga0207646_10050438 | 3300025922 | Bacteria | 3724 |
| 295 | Ga0207646_10093447 | 3300025922 | Bacteria | 2693 |
| 296 | Ga0207646_10100232 | 3300025922 | Bacteria | 2596 |
| 297 | Ga0207681_10014404 | 3300025923 | Bacteria | 4913 |
| 298 | Ga0207681_10149033 | 3300025923 | Bacteria | 1751 |
| 299 | Ga0207681_10152090 | 3300025923 | Bacteria | 1735 |
| 300 | Ga0207650_10011965 | 3300025925 | Bacteria | 5981 |
| 301 | Ga0207650_10013539 | 3300025925 | Bacteria | 5649 |
| 302 | Ga0207659_10000075 | 3300025926 | Bacteria | 63221 |
| 303 | Ga0207687_10111543 | 3300025927 | Bacteria | 2030 |
| 304 | Ga0207706_10001857 | 3300025933 | Bacteria | 20682 |
| 305 | Ga0207706_10049930 | 3300025933 | Bacteria | 3697 |
| 306 | Ga0207706_10187620 | 3300025933 | Bacteria | 1815 |
| 307 | Ga0207686_10009644 | 3300025934 | Bacteria | 5242 |
| 308 | Ga0207686_10062716 | 3300025934 | Bacteria | 2361 |
| 309 | Ga0207686_10093794 | 3300025934 | Bacteria | 1988 |
| 310 | Ga0207709_10086400 | 3300025935 | Bacteria | 2036 |
| 311 | Ga0207670_10010126 | 3300025936 | Bacteria | 5414 |
| 312 | Ga0207670_10052288 | 3300025936 | Bacteria | 2747 |
| 313 | Ga0207704_10038266 | 3300025938 | Bacteria | 2780 |
| 314 | Ga0207665_10003678 | 3300025939 | Bacteria | 10237 |
| 315 | Ga0207691_10066559 | 3300025940 | Bacteria | 3259 |
| 316 | Ga0207711_10041791 | 3300025941 | Bacteria | 3905 |
| 317 | Ga0207711_10048269 | 3300025941 | Bacteria | 3642 |
| 318 | Ga0207711_10254341 | 3300025941 | Bacteria | 1614 |
| 319 | Ga0207689_10001419 | 3300025942 | Bacteria | 22891 |
| 320 | Ga0207689_10006059 | 3300025942 | Bacteria | 10695 |
| 321 | Ga0207689_10009967 | 3300025942 | Bacteria | 8194 |
| 322 | Ga0207689_10061547 | 3300025942 | Bacteria | 3087 |
| 323 | Ga0207679_10000455 | 3300025945 | Bacteria | 28851 |
| 324 | Ga0207679_10360573 | 3300025945 | Bacteria | 1269 |
| 325 | Ga0207667_10000857 | 3300025949 | Bacteria | 39178 |
| 326 | Ga0207651_10264418 | 3300025960 | Bacteria | 1414 |
| 327 | Ga0207712_10100038 | 3300025961 | Bacteria | 2154 |
| 328 | Ga0207668_10014274 | 3300025972 | Bacteria | 4915 |
| 329 | Ga0207668_10093678 | 3300025972 | Bacteria | 2214 |
| 330 | Ga0207640_10003102 | 3300025981 | Bacteria | 8939 |
| 331 | Ga0207640_10206291 | 3300025981 | Bacteria | 1493 |
| 332 | Ga0207658_10001798 | 3300025986 | Bacteria | 16072 |
| 333 | Ga0207677_10039890 | 3300026023 | Bacteria | 3091 |
| 334 | Ga0207677_10054008 | 3300026023 | Bacteria | 2739 |
| 335 | Ga0207703_10022323 | 3300026035 | Bacteria | 4962 |
| 336 | Ga0207639_10012434 | 3300026041 | Bacteria | 5928 |
| 337 | Ga0207678_10002143 | 3300026067 | Bacteria | 17878 |
| 338 | Ga0207708_10061594 | 3300026075 | Bacteria | 2865 |
| 339 | Ga0207708_10064125 | 3300026075 | Bacteria | 2806 |
| 340 | Ga0207702_10001041 | 3300026078 | Bacteria | 28384 |
| 341 | Ga0207641_10033710 | 3300026088 | Bacteria | 4255 |
| 342 | Ga0207641_10207415 | 3300026088 | Bacteria | 1810 |
| 343 | Ga0207648_10001790 | 3300026089 | Bacteria | 23546 |
| 344 | Ga0207648_10202124 | 3300026089 | Bacteria | 1762 |
| 345 | Ga0207676_10035454 | 3300026095 | Bacteria | 3786 |
| 346 | Ga0207676_10056072 | 3300026095 | Bacteria | 3096 |
| 347 | Ga0207674_10011931 | 3300026116 | Bacteria | 9742 |
| 348 | Ga0207674_10028729 | 3300026116 | Bacteria | 5866 |
| 349 | Ga0207674_10095429 | 3300026116 | Bacteria | 2960 |
| 350 | Ga0207674_10142947 | 3300026116 | Bacteria | 2352 |
| 351 | Ga0207675_100025620 | 3300026118 | Bacteria | 5489 |
| 352 | Ga0207675_100027101 | 3300026118 | Bacteria | 5336 |
| 353 | Ga0207675_100174505 | 3300026118 | Bacteria | 2056 |
| 354 | Ga0207683_10292046 | 3300026121 | Bacteria | 1491 |
| 355 | Ga0207698_10112498 | 3300026142 | Bacteria | 2285 |
| 356 | Ga0209982_1003825 | 3300027552 | Bacteria | 2152 |
| 357 | Ga0209983_1005174 | 3300027665 | Bacteria | 2711 |
| 358 | Ga0209588_1009645 | 3300027671 | Bacteria | 2887 |
| 359 | Ga0209971_1000031 | 3300027682 | Bacteria | 50315 |
| 360 | Ga0209966_1000020 | 3300027695 | Bacteria | 68386 |
| 361 | Ga0209998_10000024 | 3300027717 | Bacteria | 64123 |
| 362 | Ga0209974_10005110 | 3300027876 | Bacteria | 4633 |
| 363 | Ga0207428_10000409 | 3300027907 | Bacteria | 53318 |
| 364 | Ga0207428_10012663 | 3300027907 | Bacteria | 7396 |
| 365 | Ga0207428_10148430 | 3300027907 | Bacteria | 1786 |
| 366 | Ga0268266_10006901 | 3300028379 | Bacteria | 10335 |
| 367 | Ga0268265_10020408 | 3300028380 | Bacteria | 4624 |
| 368 | Ga0268264_10026465 | 3300028381 | Bacteria | 4741 |
| 369 | Ga0268264_10068923 | 3300028381 | Bacteria | 2991 |
| 370 | Ga0268264_10100423 | 3300028381 | Bacteria | 2513 |
| 371 | Ga0268264_10160291 | 3300028381 | Bacteria | 2026 |
| 372 | Ga0268264_10176655 | 3300028381 | Bacteria | 1936 |
| 373 | Ga0307408_100024853 | 3300031548 | Bacteria | 4096 |
| 374 | Ga0307408_100122130 | 3300031548 | Bacteria | 2019 |
| 375 | Ga0316575_10002573 | 3300031665 | Bacteria | 6103 |
| 376 | Ga0316575_10048327 | 3300031665 | Bacteria | 1692 |
| 377 | Ga0316579_10020561 | 3300031691 | Bacteria | 2931 |
| 378 | Ga0316579_10030985 | 3300031691 | Bacteria | 2446 |
| 379 | Ga0316579_10049648 | 3300031691 | Bacteria | 1961 |
| 380 | Ga0316576_10000469 | 3300031727 | Bacteria | 18921 |
| 381 | Ga0316576_10002146 | 3300031727 | Bacteria | 11113 |
| 382 | Ga0316576_10049259 | 3300031727 | Bacteria | 3059 |
| 383 | Ga0316576_10308771 | 3300031727 | Bacteria | 1181 |
| 384 | Ga0316576_10355119 | 3300031727 | Bacteria | 1090 |
| 385 | Ga0316578_10026100 | 3300031728 | Bacteria | 3292 |
| 386 | Ga0316578_10146607 | 3300031728 | Bacteria | 1422 |
| 387 | Ga0316577_10005791 | 3300031733 | Bacteria | 6498 |
| 388 | Ga0316577_10018292 | 3300031733 | Bacteria | 3875 |
| 389 | Ga0316577_10058130 | 3300031733 | Bacteria | 2159 |
| 390 | Ga0316577_10102257 | 3300031733 | Bacteria | 1606 |
| 391 | Ga0316577_10107698 | 3300031733 | Bacteria | 1563 |
| 392 | Ga0316577_10199119 | 3300031733 | Bacteria | 1132 |
| 393 | Ga0307406_10116504 | 3300031901 | Bacteria | 1849 |
| 394 | Ga0307406_10148137 | 3300031901 | Bacteria | 1671 |
| 395 | Ga0307416_100042740 | 3300032002 | Bacteria | 3541 |
| 396 | Ga0316583_10002514 | 3300032133 | Bacteria | 6384 |
| 397 | Ga0316583_10072270 | 3300032133 | Bacteria | 1207 |
| 398 | Ga0316585_10004797 | 3300032137 | Bacteria | 3790 |
| 399 | Ga0373958_0002230 | 3300034819 | Bacteria | 2696 |
| 400 | Ga0373959_0002575 | 3300034820 | Bacteria | 2877 |
| 401 | Ga0373938_0000206 | 3300034957 | Bacteria | 8908 |
| 402 | Ga0373928_0000830 | 3300035084 | Bacteria | 6038 |
| 403 | Ga0373928_0003859 | 3300035084 | Bacteria | 2859 |
| 404 | Ga0373940_0004281 | 3300035088 | Bacteria | 3005 |
| 405 | Ga0373940_0006109 | 3300035088 | Bacteria | 2650 |
| 406 | Ga0373951_0000641 | 3300035091 | Bacteria | 9649 |
| 407 | Ga0373952_0001452 | 3300035092 | Bacteria | 4312 |
| 408 | Ga0373952_0016411 | 3300035092 | Bacteria | 1506 |
| 409 | Ga0373932_0000234 | 3300035112 | Bacteria | 16783 |
| 410 | Ga0373932_0001241 | 3300035112 | Bacteria | 7244 |
| 411 | Ga0373939_0005279 | 3300035114 | Bacteria | 3072 |
| 412 | Ga0373941_0062316 | 3300035115 | Bacteria | 1217 |
| 413 | Ga0373953_0013204 | 3300035117 | Bacteria | 2945 |
| 414 | Ga0373960_0002502 | 3300035121 | Bacteria | 4132 |
| 415 | Ga0373955_0012509 | 3300035172 | Bacteria | 4079 |
| 416 | Ga0373942_0001609 | 3300035207 | Bacteria | 5780 |
| 417 | Ga0373961_0002109 | 3300035241 | Bacteria | 5278 |
| 418 | Ga0373961_0013563 | 3300035241 | Bacteria | 2057 |
| 419 | Ga0373962_0001193 | 3300035242 | Bacteria | 6081 |
| 420 | Ga0316574_0000134 | 3300035398 | Bacteria | 23412 |
| 421 | Ga0316574_0015849 | 3300035398 | Bacteria | 4379 |
| 422 | Ga0316574_0048363 | 3300035398 | Unclassified | 2641 |
| 423 | Ga0373931_0073623 | 3300035691 | Bacteria | 1869 |
| 424 | Ga0373937_0053969 | 3300036401 | Bacteria | 3687 |
| 425 | Ga0373937_0214366 | 3300036401 | Bacteria | 1812 |
| 426 | Ga0316582_0001454 | 3300036647 | Bacteria | 10399 |
| 427 | Ga0316582_0008856 | 3300036647 | Bacteria | 5428 |
| 428 | Ga0316582_0022555 | 3300036647 | Bacteria | 3739 |
| 429 | Ga0316582_0158517 | 3300036647 | Bacteria | 1532 |
| 430 | Ga0316582_0275055 | 3300036647 | Bacteria | 1155 |
| 431 | Ga0316584_0012720 | 3300036712 | Bacteria | 5939 |
| 432 | Ga0316584_0014624 | 3300036712 | Bacteria | 5594 |
| 433 | Ga0316584_0025770 | 3300036712 | Unclassified | 4315 |
| 434 | Ga0316584_0079411 | 3300036712 | Bacteria | 2458 |
| 435 | Ga0316584_0160334 | 3300036712 | Bacteria | 1671 |
| 436 | Ga0316584_0248222 | 3300036712 | Bacteria | 1301 |
| 437 | Ga0373925_0023117 | 3300037068 | Bacteria | 4536 |
| 438 | Ga0395900_0413814 | 3300037418 | Bacteria | 1310 |
| 439 | Ga0395905_0063962 | 3300037471 | Bacteria | 3442 |
| 440 | Ga0436364_0278774 | 3300037853 | Bacteria | 400541 |
| 441 | Ga0395901_0153141 | 3300038443 | Bacteria | 2422 |
| 442 | Ga0400484_25964 | 3300038725 | Unclassified | 4267 |
| 443 | Ga0400484_33113 | 3300038725 | Bacteria | 7526 |
| 444 | Ga0400484_36753 | 3300038725 | Bacteria | 10419 |
| 445 | Ga0400490_05495 | 3300038726 | Bacteria | 4928 |
| 446 | Ga0400490_20302 | 3300038726 | Bacteria | 4774 |
| 447 | Ga0400490_57637 | 3300038726 | Bacteria | 50105 |
| 448 | Ga0400491_01284 | 3300038727 | Bacteria | 2247 |
| 449 | Ga0400491_13897 | 3300038727 | Bacteria | 2028 |
| 450 | Ga0400491_27916 | 3300038727 | Bacteria | 3061 |
| 451 | Ga0400485_09295 | 3300038735 | Bacteria | 39082 |
| 452 | Ga0400485_15200 | 3300038735 | Bacteria | 8137 |
| 453 | Ga0400485_16786 | 3300038735 | Bacteria | 10886 |
| 454 | Ga0400485_19110 | 3300038735 | Bacteria | 16368 |
| 455 | Ga0400488_01246 | 3300038741 | Bacteria | 4269 |
| 456 | Ga0400488_40064 | 3300038741 | Bacteria | 1522 |
| 457 | Ga0400488_60249 | 3300038741 | Unclassified | 4641 |
| 458 | Ga0400486_07017 | 3300038742 | Bacteria | 12169 |
| 459 | Ga0400486_08492 | 3300038742 | Bacteria | 14004 |
| 460 | Ga0400486_27991 | 3300038742 | Bacteria | 24917 |
| 461 | Ga0400486_28559 | 3300038742 | Bacteria | 33164 |
| 462 | Ga0400486_31626 | 3300038742 | Bacteria | 26816 |
| 463 | Ga0242420_010870 | 3300038996 | Bacteria | 1519 |
| 464 | Ga0400483_080006 | 3300039062 | Bacteria | 2144 |
| 465 | Ga0400483_090767 | 3300039062 | Bacteria | 68941 |
| 466 | Ga0400483_143902 | 3300039062 | Bacteria | 5225 |
| 467 | Ga0400483_154721 | 3300039062 | Bacteria | 6384 |
| 468 | Ga0400483_159073 | 3300039062 | Bacteria | 18721 |
| 469 | Ga0400483_228745 | 3300039062 | Bacteria | 2011 |
| 470 | Ga0400483_244471 | 3300039062 | Bacteria | 3056 |
| 471 | Ga0400489_03984 | 3300039093 | Bacteria | 30691 |
| 472 | Ga0400489_71101 | 3300039093 | Bacteria | 95670 |
| 473 | Ga0400489_85455 | 3300039093 | Bacteria | 25057 |
| 474 | Ga0400489_88098 | 3300039093 | Bacteria | 22091 |
| 475 | Ga0400489_96239 | 3300039093 | Bacteria | 35043 |
| 476 | Ga0400487_05468 | 3300039110 | Bacteria | 18445 |
| 477 | Ga0439448_0003645 | 3300042005 | Bacteria | 4291 |
| 478 | Ga0439448_0004102 | 3300042005 | Bacteria | 4100 |
| 479 | Ga0439455_0002010 | 3300042012 | Bacteria | 3596 |
| 480 | Ga0451577_0001528 | 3300042876 | Bacteria | 30399 |
| 481 | Ga0451577_0002563 | 3300042876 | Bacteria | 21451 |
| 482 | Ga0451577_0003197 | 3300042876 | Bacteria | 18404 |
| 483 | Ga0451577_0008288 | 3300042876 | Bacteria | 10116 |
| 484 | Ga0451577_0011788 | 3300042876 | Bacteria | 8250 |
| 485 | Ga0451577_0023850 | 3300042876 | Bacteria | 5573 |
| 486 | Ga0451577_0134764 | 3300042876 | Bacteria | 2217 |
| 487 | Ga0451577_0147679 | 3300042876 | Bacteria | 2114 |
| 488 | Ga0451577_0147735 | 3300042876 | Bacteria | 2114 |
| 489 | Ga0451577_0243244 | 3300042876 | Bacteria | 1628 |
| 490 | Ga0453683_0000048 | 3300044673 | Bacteria | 207480 |
| 491 | Ga0453683_0023353 | 3300044673 | Bacteria | 3942 |
| 492 | Ga0453683_0043225 | 3300044673 | Bacteria | 2828 |
| 493 | Ga0453683_0071848 | 3300044673 | Bacteria | 2165 |
| 494 | Ga0453683_0105022 | 3300044673 | Bacteria | 1774 |
| 495 | Ga0466963_0001565 | 3300044694 | Bacteria | 12405 |
| 496 | Ga0453684_0001302 | 3300044712 | Bacteria | 74077 |
| 497 | Ga0453684_0001453 | 3300044712 | Bacteria | 67345 |
| 498 | Ga0453684_0003094 | 3300044712 | Bacteria | 38342 |
| 499 | Ga0453684_0015160 | 3300044712 | Bacteria | 12228 |
| 500 | Ga0453684_0017310 | 3300044712 | Bacteria | 11177 |
| 501 | Ga0453684_0068794 | 3300044712 | Bacteria | 4494 |
| 502 | Ga0453684_0119023 | 3300044712 | Bacteria | 3193 |
| 503 | Ga0453684_0176258 | 3300044712 | Bacteria | 2514 |
| 504 | Ga0453684_0276365 | 3300044712 | Bacteria | 1917 |
| 505 | Ga0451576_0013787 | 3300045051 | Bacteria | 9030 |
| 506 | Ga0451576_0019829 | 3300045051 | Bacteria | 7333 |
| 507 | Ga0451576_0023088 | 3300045051 | Bacteria | 6740 |
| 508 | Ga0451576_0052940 | 3300045051 | Bacteria | 4253 |
| 509 | Ga0451576_0074289 | 3300045051 | Bacteria | 3538 |
| 510 | Ga0451576_0174259 | 3300045051 | Bacteria | 2245 |
| 511 | Ga0451576_0174733 | 3300045051 | Bacteria | 2242 |
| 512 | Ga0451576_0175287 | 3300045051 | Bacteria | 2238 |
| 513 | Ga0451576_0251356 | 3300045051 | Bacteria | 1848 |
| 514 | Ga0451576_0336528 | 3300045051 | Bacteria | 1580 |
| 515 | Ga0451576_0473711 | 3300045051 | Bacteria | 1315 |
| 516 | Ga0466967_0267111 | 3300045976 | Bacteria | 1638 |
| 517 | Ga0495603_0080888 | 3300046455 | Bacteria | 1904 |
| 518 | Ga0495580_0146187 | 3300046472 | Bacteria | 1638 |
| 519 | Ga0495580_0287762 | 3300046472 | Bacteria | 1120 |
| 520 | Ga0495642_0016591 | 3300046528 | Bacteria | 2873 |
| 521 | Ga0495640_0048187 | 3300046533 | Bacteria | 2946 |
| 522 | Ga0495587_0031898 | 3300046536 | Bacteria | 3188 |
| 523 | Ga0495645_0004379 | 3300046543 | Bacteria | 9645 |
| 524 | Ga0495647_0013279 | 3300046681 | Bacteria | 2851 |
| 525 | Ga0495647_0042784 | 3300046681 | Bacteria | 1731 |
| 526 | Ga0495658_0017715 | 3300046683 | Bacteria | 3687 |
| 527 | Ga0495669_0046440 | 3300046684 | Bacteria | 1938 |
| 528 | Ga0495636_0024339 | 3300047318 | Bacteria | 2455 |
| 529 | Ga0495672_0014028 | 3300047320 | Bacteria | 5505 |
| 530 | Ga0495680_0222783 | 3300047322 | Bacteria | 1346 |
| 531 | Ga0495684_0248807 | 3300047471 | Bacteria | 1294 |
| 532 | Ga0496102_0024057 | 3300048905 | Bacteria | 5414 |
| 533 | Ga0496102_0053609 | 3300048905 | Bacteria | 3676 |
| 534 | Ga0496102_0232581 | 3300048905 | Bacteria | 1738 |
| 535 | Ga0496103_0233712 | 3300048906 | Bacteria | 1183 |
| 536 | Ga0496104_0010445 | 3300048907 | Bacteria | 8292 |
| 537 | Ga0496106_0053746 | 3300048909 | Bacteria | 3043 |
| 538 | Ga0496106_0099843 | 3300048909 | Bacteria | 2250 |
| 539 | Ga0496106_0119168 | 3300048909 | Bacteria | 2062 |
| 540 | Ga0496107_0116245 | 3300048910 | Bacteria | 1969 |
| 541 | Ga0496108_0009031 | 3300048911 | Bacteria | 8077 |
| 542 | Ga0496109_0159420 | 3300048912 | Bacteria | 2114 |
| 543 | Ga0496110_0184985 | 3300048913 | Bacteria | 1892 |
| 544 | Ga0496112_0042253 | 3300048915 | Bacteria | 4459 |
| 545 | Ga0496113_0011834 | 3300048916 | Bacteria | 5845 |
| 546 | Ga0496113_0091689 | 3300048916 | Bacteria | 2343 |
| 547 | Ga0496114_0037531 | 3300048917 | Bacteria | 4007 |
| 548 | Ga0496114_0144573 | 3300048917 | Bacteria | 2061 |
| 549 | Ga0496114_0157004 | 3300048917 | Bacteria | 1976 |
| 550 | Ga0496115_0004390 | 3300048918 | Bacteria | 10212 |
| 551 | Ga0501033_0053098 | 3300049570 | Bacteria | 3002 |
| 552 | Ga0501036_0167355 | 3300049572 | Bacteria | 1852 |
| 553 | Ga0501037_0151881 | 3300049573 | Bacteria | 1655 |
| 554 | Ga0501038_0040865 | 3300049574 | Bacteria | 4047 |
| 555 | Ga0501039_0007391 | 3300049575 | Bacteria | 8377 |
| 556 | Ga0501040_0006872 | 3300049576 | Bacteria | 7374 |
| 557 | Ga0501040_0074291 | 3300049576 | Bacteria | 2349 |
| 558 | Ga0501040_0120156 | 3300049576 | Bacteria | 1843 |
| 559 | Ga0501041_0001517 | 3300049577 | Bacteria | 12876 |
| 560 | Ga0501041_0014739 | 3300049577 | Bacteria | 4642 |
| 561 | Ga0501041_0176975 | 3300049577 | Bacteria | 1335 |
| 562 | Ga0501042_0044771 | 3300049578 | Bacteria | 3153 |
| 563 | Ga0501042_0073479 | 3300049578 | Bacteria | 2446 |
| 564 | Ga0501042_0093360 | 3300049578 | Bacteria | 2161 |
| 565 | Ga0501046_0000607 | 3300049580 | Bacteria | 35214 |
| 566 | Ga0501046_0089977 | 3300049580 | Bacteria | 2362 |
| 567 | Ga0501046_0105299 | 3300049580 | Bacteria | 2161 |
| 568 | Ga0501046_0138709 | 3300049580 | Bacteria | 1841 |
| 569 | Ga0501046_0189328 | 3300049580 | Bacteria | 1535 |
| 570 | Ga0501047_0000115 | 3300049581 | Bacteria | 97128 |
| 571 | Ga0501047_0043661 | 3300049581 | Bacteria | 4330 |
| 572 | Ga0501048_0007236 | 3300049582 | Bacteria | 8420 |
| 573 | Ga0501048_0039379 | 3300049582 | Bacteria | 3391 |
| 574 | Ga0501069_0059282 | 3300049585 | Bacteria | 2136 |
| 575 | Ga0501071_0195235 | 3300049587 | Bacteria | 1519 |
| 576 | Ga0501072_0003099 | 3300049588 | Bacteria | 12529 |
| 577 | Ga0501072_0093008 | 3300049588 | Bacteria | 2395 |
| 578 | Ga0501072_0104005 | 3300049588 | Bacteria | 2257 |
| 579 | Ga0501072_0155504 | 3300049588 | Bacteria | 1823 |
| 580 | Ga0501072_0166474 | 3300049588 | Bacteria | 1759 |
| 581 | Ga0501072_0220639 | 3300049588 | Bacteria | 1511 |
| 582 | Ga0501073_0105256 | 3300049589 | Bacteria | 1958 |
| 583 | Ga0501074_0009258 | 3300049590 | Bacteria | 7155 |
| 584 | Ga0501074_0039206 | 3300049590 | Bacteria | 3431 |
| 585 | Ga0501075_0001457 | 3300049591 | Bacteria | 15394 |
| 586 | Ga0501075_0011581 | 3300049591 | Bacteria | 6245 |
| 587 | Ga0501075_0020084 | 3300049591 | Bacteria | 4852 |
| 588 | Ga0501075_0050577 | 3300049591 | Bacteria | 3124 |
| 589 | Ga0501075_0062232 | 3300049591 | Bacteria | 2813 |
| 590 | Ga0501075_0107835 | 3300049591 | Bacteria | 2117 |
| 591 | Ga0501075_0125389 | 3300049591 | Bacteria | 1955 |
| 592 | Ga0501075_0132683 | 3300049591 | Bacteria | 1897 |
| 593 | Ga0501075_0237543 | 3300049591 | Bacteria | 1389 |
| 594 | Ga0501076_0004888 | 3300049592 | Bacteria | 9581 |
| 595 | Ga0501076_0023309 | 3300049592 | Bacteria | 4770 |
| 596 | Ga0501076_0029517 | 3300049592 | Bacteria | 4264 |
| 597 | Ga0501077_0007562 | 3300049593 | Bacteria | 6704 |
| 598 | Ga0501077_0007616 | 3300049593 | Bacteria | 6682 |
| 599 | Ga0501077_0019750 | 3300049593 | Bacteria | 4262 |
| 600 | Ga0501077_0026293 | 3300049593 | Bacteria | 3694 |
| 601 | Ga0501079_0004364 | 3300049741 | Bacteria | 10492 |
| 602 | Ga0501079_0005322 | 3300049741 | Bacteria | 9577 |
| 603 | Ga0501079_0005375 | 3300049741 | Bacteria | 9536 |
| 604 | Ga0501079_0008589 | 3300049741 | Bacteria | 7753 |
| 605 | Ga0501079_0012404 | 3300049741 | Bacteria | 6503 |
| 606 | Ga0501079_0057901 | 3300049741 | Bacteria | 2990 |
| 607 | Ga0501079_0127723 | 3300049741 | Bacteria | 1978 |
| 608 | Ga0501079_0290961 | 3300049741 | Bacteria | 1277 |
| 609 | Ga0501080_0076967 | 3300049742 | Bacteria | 3102 |
| 610 | Ga0501080_0187909 | 3300049742 | Bacteria | 1899 |
| 611 | Ga0501080_0251860 | 3300049742 | Bacteria | 1610 |
| 612 | Ga0501081_0006708 | 3300049743 | Bacteria | 7486 |
| 613 | Ga0501081_0008094 | 3300049743 | Bacteria | 6823 |
| 614 | Ga0501081_0066508 | 3300049743 | Bacteria | 2507 |
| 615 | Ga0501081_0088734 | 3300049743 | Bacteria | 2172 |
| 616 | Ga0501081_0126500 | 3300049743 | Bacteria | 1823 |
| 617 | Ga0501081_0155350 | 3300049743 | Bacteria | 1646 |
| 618 | Ga0501083_0124332 | 3300049744 | Bacteria | 1691 |
| 619 | Ga0501044_0144993 | 3300049823 | Bacteria | 2361 |
| 620 | Ga0501045_0001608 | 3300049824 | Bacteria | 15107 |
| 621 | Ga0501045_0019327 | 3300049824 | Bacteria | 4855 |
| 622 | Ga0501045_0041923 | 3300049824 | Bacteria | 3331 |
| 623 | Ga0501045_0046036 | 3300049824 | Bacteria | 3177 |
| 624 | Ga0501045_0088616 | 3300049824 | Bacteria | 2286 |
| 625 | nmdc:mga03n38_64423_c1 | 3300050490 | Bacteria | 1677 |
| 626 | nmdc:mga0k408_78176_c1 | 3300050493 | Bacteria | 1935 |
| 627 | nmdc:mga05p37_107836_c1 | 3300050507 | Bacteria | 3426 |
| 628 | nmdc:mga05p37_123027_c1 | 3300050507 | Bacteria | 3187 |
| 629 | nmdc:mga05p37_148317_c1 | 3300050507 | Bacteria | 2871 |
| 630 | nmdc:mga05p37_17722_c1 | 3300050507 | Bacteria | 8592 |
| 631 | nmdc:mga05p37_205700_c1 | 3300050507 | Bacteria | 2381 |
| 632 | nmdc:mga05p37_22487_c1 | 3300050507 | Bacteria | 7645 |
| 633 | nmdc:mga05p37_2722_c1 | 3300050507 | Bacteria | 20534 |
| 634 | nmdc:mga05p37_344876_c1 | 3300050507 | Bacteria | 1755 |
| 635 | nmdc:mga05p37_585174_c1 | 3300050507 | Bacteria | 1263 |
| 636 | nmdc:mga05p37_666142_c1 | 3300050507 | Bacteria | 1162 |
| 637 | nmdc:mga05p37_862_c1 | 3300050507 | Bacteria | 34113 |
| 638 | nmdc:mga05p37_88173_c1 | 3300050507 | Bacteria | 3825 |
| 639 | nmdc:mga05p37_94383_c1 | 3300050507 | Bacteria | 3686 |
| 640 | nmdc:mga09592_10352_c1 | 3300050508 | Bacteria | 7589 |
| 641 | nmdc:mga09592_144871_c1 | 3300050508 | Bacteria | 2048 |
| 642 | nmdc:mga09592_228159_c1 | 3300050508 | Bacteria | 1613 |
| 643 | nmdc:mga09592_31298_c1 | 3300050508 | Bacteria | 4433 |
| 644 | nmdc:mga09592_33850_c1 | 3300050508 | Bacteria | 4269 |
| 645 | nmdc:mga09592_3602_c1 | 3300050508 | Bacteria | 12502 |
| 646 | nmdc:mga09592_91120_c1 | 3300050508 | Bacteria | 2605 |
| 647 | nmdc:mga0qj67_125057_c1 | 3300050509 | Bacteria | 2081 |
| 648 | nmdc:mga0qj67_20948_c1 | 3300050509 | Bacteria | 5011 |
| 649 | nmdc:mga06r32_141901_c1 | 3300050510 | Bacteria | 2379 |
| 650 | nmdc:mga06r32_16456_c1 | 3300050510 | Bacteria | 6741 |
| 651 | nmdc:mga06r32_2118_c1 | 3300050510 | Bacteria | 17775 |
| 652 | nmdc:mga06r32_67198_c1 | 3300050510 | Bacteria | 3460 |
| 653 | nmdc:mga06r32_76307_c1 | 3300050510 | Bacteria | 3254 |
| 654 | nmdc:mga08y16_11942_c1 | 3300050511 | Bacteria | 9122 |
| 655 | nmdc:mga08y16_121449_c1 | 3300050511 | Bacteria | 2719 |
| 656 | nmdc:mga08y16_1957_c1 | 3300050511 | Bacteria | 20989 |
| 657 | nmdc:mga08y16_29427_c1 | 3300050511 | Bacteria | 5787 |
| 658 | nmdc:mga08y16_563076_c1 | 3300050511 | Bacteria | 1152 |
| 659 | nmdc:mga08y16_96372_c1 | 3300050511 | Bacteria | 3081 |
| 660 | nmdc:mga0n895_12611_c1 | 3300050512 | Bacteria | 7587 |
| 661 | nmdc:mga0n895_13064_c1 | 3300050512 | Bacteria | 7470 |
| 662 | nmdc:mga0n895_146384_c1 | 3300050512 | Bacteria | 2392 |
| 663 | nmdc:mga0n895_205032_c1 | 3300050512 | Bacteria | 2002 |
| 664 | nmdc:mga0n895_230325_c1 | 3300050512 | Bacteria | 1881 |
| 665 | nmdc:mga0n895_44658_c1 | 3300050512 | Bacteria | 4321 |
| 666 | nmdc:mga0n895_5572_c1 | 3300050512 | Bacteria | 10541 |
| 667 | nmdc:mga0n895_587827_c1 | 3300050512 | Bacteria | 1117 |
| 668 | nmdc:mga0n895_78605_c1 | 3300050512 | Bacteria | 3284 |
| 669 | nmdc:mga0n895_8027_c1 | 3300050512 | Bacteria | 9106 |
| 670 | nmdc:mga0rr50_10927_c1 | 3300050513 | Bacteria | 5790 |
| 671 | nmdc:mga0rr50_3069_c1 | 3300050513 | Bacteria | 9562 |
| 672 | nmdc:mga0rr50_3354_c1 | 3300050513 | Bacteria | 9199 |
| 673 | nmdc:mga0rr50_48691_c1 | 3300050513 | Bacteria | 3134 |
| 674 | nmdc:mga0rr50_50816_c1 | 3300050513 | Bacteria | 3073 |
| 675 | nmdc:mga08x19_13456_c1 | 3300050514 | Bacteria | 4948 |
| 676 | nmdc:mga08x19_2391_c1 | 3300050514 | Bacteria | 11377 |
| 677 | nmdc:mga08x19_65084_c1 | 3300050514 | Bacteria | 2367 |
| 678 | nmdc:mga0a205_11305_c1 | 3300050515 | Bacteria | 8219 |
| 679 | nmdc:mga0a205_12408_c1 | 3300050515 | Bacteria | 7881 |
| 680 | nmdc:mga0a205_23731_c1 | 3300050515 | Bacteria | 5819 |
| 681 | nmdc:mga0a205_342204_c1 | 3300050515 | Bacteria | 1364 |
| 682 | nmdc:mga0a205_42525_c1 | 3300050515 | Bacteria | 2854 |
| 683 | nmdc:mga0a205_46561_c1 | 3300050515 | Bacteria | 4183 |
| 684 | nmdc:mga0a205_4763_c1 | 3300050515 | Bacteria | 12191 |
| 685 | nmdc:mga0a205_48996_c1 | 3300050515 | Bacteria | 4077 |
| 686 | nmdc:mga0a205_49897_c1 | 3300050515 | Bacteria | 4041 |
| 687 | nmdc:mga0a205_5150_c1 | 3300050515 | Bacteria | 11758 |
| 688 | nmdc:mga0a205_87770_c1 | 3300050515 | Bacteria | 3005 |
| 689 | nmdc:mga0a205_895_c1 | 3300050515 | Bacteria | 17939 |
| 690 | Ga0495601_0007688 | 3300053077 | Bacteria | 6337 |
| 691 | Ga0495601_0016947 | 3300053077 | Bacteria | 4420 |
| 692 | Ga0495619_0005739 | 3300053085 | Bacteria | 7865 |
| 693 | Ga0495619_0179524 | 3300053085 | Bacteria | 1465 |
| 694 | Ga0500555_000060 | 3300053103 | Bacteria | 55800 |
| 695 | Ga0500616_0000336 | 3300053153 | Bacteria | 67042 |
| 696 | Ga0500645_001532 | 3300053730 | Bacteria | 11553 |
| 697 | Ga0501084_0003947 | 3300054114 | Bacteria | 12085 |
| 698 | Ga0501084_0006427 | 3300054114 | Bacteria | 9660 |
| 699 | Ga0501084_0013112 | 3300054114 | Bacteria | 6860 |
| 700 | Ga0501084_0024768 | 3300054114 | Bacteria | 5008 |
| 701 | Ga0501084_0037939 | 3300054114 | Bacteria | 4027 |
| 702 | Ga0501084_0136774 | 3300054114 | Bacteria | 2063 |
| 703 | Ga0501084_0316864 | 3300054114 | Bacteria | 1317 |
| 704 | Ga0501082_0000058 | 3300060353 | Bacteria | 78173 |
| 705 | Ga0501082_0006322 | 3300060353 | Bacteria | 10275 |
| 706 | Ga0501082_0007387 | 3300060353 | Bacteria | 9483 |
| 707 | Ga0501082_0019798 | 3300060353 | Bacteria | 5803 |
| 708 | Ga0501082_0115469 | 3300060353 | Bacteria | 2325 |
| 709 | Ga0501082_0278082 | 3300060353 | Bacteria | 1457 |
| 710 | Ga0530510_0000450 | 3300061734 | Bacteria | 26655 |
| 711 | Ga0530510_0000460 | 3300061734 | Bacteria | 26308 |
| 712 | Ga0530510_0019190 | 3300061734 | Bacteria | 4850 |
| 713 | Ga0530510_0057884 | 3300061734 | Bacteria | 2802 |
| 714 | Ga0530510_0067246 | 3300061734 | Bacteria | 2600 |
| 715 | Ga0530510_0068811 | 3300061734 | Bacteria | 2568 |
| 716 | Ga0530510_0118286 | 3300061734 | Bacteria | 1944 |
| 717 | Ga0530510_0208465 | 3300061734 | Bacteria | 1452 |
| 718 | Ga0530510_0218125 | 3300061734 | Bacteria | 1418 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_587827_c1 | nmdc:mga0n895_587827_c1_36_896 | 269 |
| 2 | 3300037418 | Ga0395900_0413814 | Ga0395900_0413814_62_970 | 280 |
| 3 | 3300046681 | Ga0495647_0013279 | Ga0495647_0013279_1891_2805 | 288 |
| 4 | 3300020082 | Ga0206353_11022215 | Ga0206353_110222153 | 297 |
| 5 | 3300038725 | Ga0400484_25964 | Ga0400484_25964_3174_4232 | 298 |
| 6 | 3300044694 | Ga0466963_0001565 | Ga0466963_0001565_6879_7901 | 298 |
| 7 | 3300005615 | Ga0070702_100020943 | Ga0070702_1000209431 | 299 |
| 8 | 3300031727 | Ga0316576_10308771 | Ga0316576_103087712 | 300 |
| 9 | 3300031733 | Ga0316577_10018292 | Ga0316577_100182923 | 300 |
| 10 | 3300038727 | Ga0400491_01284 | Ga0400491_01284_342_1400 | 306 |
| 11 | 3300044712 | Ga0453684_0068794 | Ga0453684_0068794_1238_2218 | 306 |
| 12 | 3300048918 | Ga0496115_0004390 | Ga0496115_0004390_6202_7248 | 308 |
| 13 | 3300025907 | Ga0207645_10078469 | Ga0207645_100784691 | 310 |
| 14 | 3300045976 | Ga0466967_0267111 | Ga0466967_0267111_362_1381 | 310 |
| 15 | 3300005981 | Ga0081538_10023994 | Ga0081538_100239945 | 311 |
| 16 | 3300009093 | Ga0105240_10033526 | Ga0105240_100335268 | 311 |
| 17 | 3300025913 | Ga0207695_10025254 | Ga0207695_100252542 | 311 |
| 18 | 3300022467 | Ga0224712_10034945 | Ga0224712_100349452 | 312 |
| 19 | 3300036712 | Ga0316584_0248222 | Ga0316584_0248222_121_1134 | 312 |
| 20 | 3300009147 | Ga0114129_10140137 | Ga0114129_101401371 | 313 |
| 21 | 3300050507 | nmdc:mga05p37_123027_c1 | nmdc:mga05p37_123027_c1_83_1108 | 313 |
| 22 | 3300037853 | Ga0436364_0278774 | Ga0436364_0278774_384209_385213 | 314 |
| 23 | 3300042876 | Ga0451577_0001528 | Ga0451577_0001528_6874_7896 | 314 |
| 24 | 3300005334 | Ga0068869_100001130 | Ga0068869_1000011309 | 315 |
| 25 | 3300025923 | Ga0207681_10149033 | Ga0207681_101490332 | 315 |
| 26 | 3300025942 | Ga0207689_10006059 | Ga0207689_100060592 | 315 |
| 27 | 3300005367 | Ga0070667_100001231 | Ga0070667_10000123113 | 316 |
| 28 | 3300005843 | Ga0068860_100258327 | Ga0068860_1002583272 | 316 |
| 29 | 3300025986 | Ga0207658_10001798 | Ga0207658_100017989 | 316 |
| 30 | 3300028381 | Ga0268264_10160291 | Ga0268264_101602912 | 316 |
| 31 | 3300031691 | Ga0316579_10049648 | Ga0316579_100496482 | 316 |
| 32 | 3300031727 | Ga0316576_10049259 | Ga0316576_100492592 | 316 |
| 33 | 3300005334 | Ga0068869_100062433 | Ga0068869_1000624333 | 317 |
| 34 | 3300009093 | Ga0105240_10037405 | Ga0105240_100374053 | 317 |
| 35 | 3300050512 | nmdc:mga0n895_205032_c1 | nmdc:mga0n895_205032_c1_579_1583 | 317 |
| 36 | 3300021388 | Ga0213875_10000088 | Ga0213875_1000008886 | 318 |
| 37 | 3300038741 | Ga0400488_40064 | Ga0400488_40064_497_1504 | 318 |
| 38 | 3300044712 | Ga0453684_0119023 | Ga0453684_0119023_130_1155 | 318 |
| 39 | 3300049580 | Ga0501046_0138709 | Ga0501046_0138709_748_1791 | 318 |
| 40 | 3300049581 | Ga0501047_0000115 | Ga0501047_0000115_14114_15157 | 318 |
| 41 | 3300005341 | Ga0070691_10017004 | Ga0070691_100170044 | 319 |
| 42 | 3300005345 | Ga0070692_10023997 | Ga0070692_100239973 | 319 |
| 43 | 3300005438 | Ga0070701_10005551 | Ga0070701_100055515 | 319 |
| 44 | 3300005444 | Ga0070694_100010230 | Ga0070694_1000102306 | 319 |
| 45 | 3300005545 | Ga0070695_100006806 | Ga0070695_1000068064 | 319 |
| 46 | 3300005844 | Ga0068862_100446816 | Ga0068862_1004468161 | 319 |
| 47 | 3300006847 | Ga0075431_100004465 | Ga0075431_10000446514 | 319 |
| 48 | 3300025934 | Ga0207686_10009644 | Ga0207686_100096446 | 319 |
| 49 | 3300025938 | Ga0207704_10038266 | Ga0207704_100382664 | 319 |
| 50 | 3300026116 | Ga0207674_10028729 | Ga0207674_100287295 | 319 |
| 51 | 3300039062 | Ga0400483_228745 | Ga0400483_228745_846_1880 | 319 |
| 52 | 3300050510 | nmdc:mga06r32_2118_c1 | nmdc:mga06r32_2118_c1_16631_17644 | 319 |
| 53 | 3300050512 | nmdc:mga0n895_146384_c1 | nmdc:mga0n895_146384_c1_722_1732 | 319 |
| 54 | 3300050513 | nmdc:mga0rr50_48691_c1 | nmdc:mga0rr50_48691_c1_1345_2355 | 319 |
| 55 | 3300005344 | Ga0070661_100085079 | Ga0070661_1000850791 | 320 |
| 56 | 3300005564 | Ga0070664_100013072 | Ga0070664_1000130725 | 320 |
| 57 | 3300005577 | Ga0068857_100054677 | Ga0068857_1000546774 | 320 |
| 58 | 3300009177 | Ga0105248_10670630 | Ga0105248_106706302 | 320 |
| 59 | 3300013308 | Ga0157375_10470100 | Ga0157375_104701002 | 320 |
| 60 | 3300025920 | Ga0207649_10060358 | Ga0207649_100603583 | 320 |
| 61 | 3300025945 | Ga0207679_10000455 | Ga0207679_1000045527 | 320 |
| 62 | 3300026116 | Ga0207674_10095429 | Ga0207674_100954293 | 320 |
| 63 | 3300026142 | Ga0207698_10112498 | Ga0207698_101124981 | 320 |
| 64 | 3300031665 | Ga0316575_10002573 | Ga0316575_100025736 | 320 |
| 65 | 3300031665 | Ga0316575_10048327 | Ga0316575_100483272 | 320 |
| 66 | 3300031691 | Ga0316579_10020561 | Ga0316579_100205611 | 320 |
| 67 | 3300031691 | Ga0316579_10030985 | Ga0316579_100309852 | 320 |
| 68 | 3300031727 | Ga0316576_10002146 | Ga0316576_1000214612 | 320 |
| 69 | 3300031727 | Ga0316576_10355119 | Ga0316576_103551191 | 320 |
| 70 | 3300031728 | Ga0316578_10026100 | Ga0316578_100261003 | 320 |
| 71 | 3300031733 | Ga0316577_10005791 | Ga0316577_100057914 | 320 |
| 72 | 3300031733 | Ga0316577_10058130 | Ga0316577_100581302 | 320 |
| 73 | 3300031733 | Ga0316577_10102257 | Ga0316577_101022572 | 320 |
| 74 | 3300031733 | Ga0316577_10107698 | Ga0316577_101076982 | 320 |
| 75 | 3300031733 | Ga0316577_10199119 | Ga0316577_101991191 | 320 |
| 76 | 3300032133 | Ga0316583_10002514 | Ga0316583_100025147 | 320 |
| 77 | 3300032133 | Ga0316583_10072270 | Ga0316583_100722701 | 320 |
| 78 | 3300032137 | Ga0316585_10004797 | Ga0316585_100047974 | 320 |
| 79 | 3300035398 | Ga0316574_0000134 | Ga0316574_0000134_3059_4102 | 320 |
| 80 | 3300035398 | Ga0316574_0048363 | Ga0316574_0048363_209_1255 | 320 |
| 81 | 3300036647 | Ga0316582_0001454 | Ga0316582_0001454_7111_8154 | 320 |
| 82 | 3300036647 | Ga0316582_0008856 | Ga0316582_0008856_1312_2355 | 320 |
| 83 | 3300036647 | Ga0316582_0022555 | Ga0316582_0022555_1393_2433 | 320 |
| 84 | 3300036647 | Ga0316582_0158517 | Ga0316582_0158517_456_1499 | 320 |
| 85 | 3300036647 | Ga0316582_0275055 | Ga0316582_0275055_55_1095 | 320 |
| 86 | 3300036712 | Ga0316584_0012720 | Ga0316584_0012720_2672_3715 | 320 |
| 87 | 3300036712 | Ga0316584_0014624 | Ga0316584_0014624_2443_3483 | 320 |
| 88 | 3300036712 | Ga0316584_0025770 | Ga0316584_0025770_182_1228 | 320 |
| 89 | 3300036712 | Ga0316584_0079411 | Ga0316584_0079411_1145_2185 | 320 |
| 90 | 3300036712 | Ga0316584_0160334 | Ga0316584_0160334_317_1360 | 320 |
| 91 | 3300038725 | Ga0400484_33113 | Ga0400484_33113_4129_5184 | 320 |
| 92 | 3300038725 | Ga0400484_36753 | Ga0400484_36753_4460_5500 | 320 |
| 93 | 3300038726 | Ga0400490_05495 | Ga0400490_05495_1977_3017 | 320 |
| 94 | 3300038726 | Ga0400490_20302 | Ga0400490_20302_698_1741 | 320 |
| 95 | 3300038726 | Ga0400490_57637 | Ga0400490_57637_16040_17080 | 320 |
| 96 | 3300038727 | Ga0400491_13897 | Ga0400491_13897_410_1450 | 320 |
| 97 | 3300038727 | Ga0400491_27916 | Ga0400491_27916_1900_2940 | 320 |
| 98 | 3300038735 | Ga0400485_09295 | Ga0400485_09295_11398_12438 | 320 |
| 99 | 3300038735 | Ga0400485_15200 | Ga0400485_15200_4390_5430 | 320 |
| 100 | 3300038735 | Ga0400485_16786 | Ga0400485_16786_2345_3391 | 320 |
| 101 | 3300038735 | Ga0400485_19110 | Ga0400485_19110_11275_12315 | 320 |
| 102 | 3300038741 | Ga0400488_01246 | Ga0400488_01246_1027_2067 | 320 |
| 103 | 3300038741 | Ga0400488_60249 | Ga0400488_60249_317_1363 | 320 |
| 104 | 3300038742 | Ga0400486_07017 | Ga0400486_07017_7210_8256 | 320 |
| 105 | 3300038742 | Ga0400486_08492 | Ga0400486_08492_2891_3931 | 320 |
| 106 | 3300038742 | Ga0400486_27991 | Ga0400486_27991_10589_11629 | 320 |
| 107 | 3300038742 | Ga0400486_28559 | Ga0400486_28559_5521_6567 | 320 |
| 108 | 3300038742 | Ga0400486_31626 | Ga0400486_31626_23541_24581 | 320 |
| 109 | 3300039062 | Ga0400483_080006 | Ga0400483_080006_452_1489 | 320 |
| 110 | 3300039062 | Ga0400483_090767 | Ga0400483_090767_38560_39606 | 320 |
| 111 | 3300039062 | Ga0400483_143902 | Ga0400483_143902_3577_4617 | 320 |
| 112 | 3300039062 | Ga0400483_154721 | Ga0400483_154721_5166_6209 | 320 |
| 113 | 3300039062 | Ga0400483_159073 | Ga0400483_159073_12898_13938 | 320 |
| 114 | 3300039062 | Ga0400483_244471 | Ga0400483_244471_569_1609 | 320 |
| 115 | 3300039093 | Ga0400489_71101 | Ga0400489_71101_54677_55717 | 320 |
| 116 | 3300039093 | Ga0400489_85455 | Ga0400489_85455_17595_18641 | 320 |
| 117 | 3300039093 | Ga0400489_88098 | Ga0400489_88098_14862_15902 | 320 |
| 118 | 3300039093 | Ga0400489_96239 | Ga0400489_96239_17035_18093 | 320 |
| 119 | 3300039110 | Ga0400487_05468 | Ga0400487_05468_6881_7921 | 320 |
| 120 | 3300042005 | Ga0439448_0004102 | Ga0439448_0004102_2248_3264 | 320 |
| 121 | 3300042012 | Ga0439455_0002010 | Ga0439455_0002010_1291_2307 | 320 |
| 122 | 3300044673 | Ga0453683_0023353 | Ga0453683_0023353_1895_2908 | 320 |
| 123 | 3300044712 | Ga0453684_0276365 | Ga0453684_0276365_868_1884 | 320 |
| 124 | 3300045051 | Ga0451576_0074289 | Ga0451576_0074289_1802_2818 | 320 |
| 125 | 3300046533 | Ga0495640_0048187 | Ga0495640_0048187_1299_2408 | 320 |
| 126 | 3300049576 | Ga0501040_0120156 | Ga0501040_0120156_243_1268 | 320 |
| 127 | 3300049580 | Ga0501046_0089977 | Ga0501046_0089977_1141_2166 | 320 |
| 128 | 3300049582 | Ga0501048_0039379 | Ga0501048_0039379_1948_2973 | 320 |
| 129 | 3300049588 | Ga0501072_0093008 | Ga0501072_0093008_1264_2289 | 320 |
| 130 | 3300049589 | Ga0501073_0105256 | Ga0501073_0105256_415_1440 | 320 |
| 131 | 3300049590 | Ga0501074_0039206 | Ga0501074_0039206_1462_2487 | 320 |
| 132 | 3300049591 | Ga0501075_0001457 | Ga0501075_0001457_3697_4722 | 320 |
| 133 | 3300049592 | Ga0501076_0029517 | Ga0501076_0029517_1134_2159 | 320 |
| 134 | 3300049741 | Ga0501079_0012404 | Ga0501079_0012404_2981_4006 | 320 |
| 135 | 3300049743 | Ga0501081_0006708 | Ga0501081_0006708_351_1376 | 320 |
| 136 | 3300049743 | Ga0501081_0066508 | Ga0501081_0066508_522_1544 | 320 |
| 137 | 3300049744 | Ga0501083_0124332 | Ga0501083_0124332_383_1408 | 320 |
| 138 | 3300049824 | Ga0501045_0019327 | Ga0501045_0019327_1836_2861 | 320 |
| 139 | 3300053077 | Ga0495601_0007688 | Ga0495601_0007688_292_1401 | 320 |
| 140 | 3300053085 | Ga0495619_0005739 | Ga0495619_0005739_5636_6745 | 320 |
| 141 | 3300054114 | Ga0501084_0024768 | Ga0501084_0024768_2502_3527 | 320 |
| 142 | 3300060353 | Ga0501082_0019798 | Ga0501082_0019798_1767_2792 | 320 |
| 143 | iso_pu_bacteria | 2740891818 | 2740990985 | 320 |
| 144 | 3300005328 | Ga0070676_10047022 | Ga0070676_100470222 | 321 |
| 145 | 3300005334 | Ga0068869_100012050 | Ga0068869_1000120504 | 321 |
| 146 | 3300005341 | Ga0070691_10024098 | Ga0070691_100240983 | 321 |
| 147 | 3300005353 | Ga0070669_100096592 | Ga0070669_1000965923 | 321 |
| 148 | 3300005444 | Ga0070694_100019487 | Ga0070694_1000194874 | 321 |
| 149 | 3300005518 | Ga0070699_100058928 | Ga0070699_1000589283 | 321 |
| 150 | 3300005545 | Ga0070695_100000685 | Ga0070695_10000068519 | 321 |
| 151 | 3300005545 | Ga0070695_100031556 | Ga0070695_1000315563 | 321 |
| 152 | 3300005549 | Ga0070704_100090359 | Ga0070704_1000903593 | 321 |
| 153 | 3300005563 | Ga0068855_100002792 | Ga0068855_10000279210 | 321 |
| 154 | 3300005564 | Ga0070664_100014425 | Ga0070664_1000144256 | 321 |
| 155 | 3300005577 | Ga0068857_100015332 | Ga0068857_1000153325 | 321 |
| 156 | 3300005578 | Ga0068854_100000353 | Ga0068854_1000003534 | 321 |
| 157 | 3300005614 | Ga0068856_100015448 | Ga0068856_1000154484 | 321 |
| 158 | 3300005617 | Ga0068859_100002575 | Ga0068859_1000025756 | 321 |
| 159 | 3300005618 | Ga0068864_100019308 | Ga0068864_1000193084 | 321 |
| 160 | 3300005840 | Ga0068870_10001193 | Ga0068870_100011936 | 321 |
| 161 | 3300005841 | Ga0068863_100009799 | Ga0068863_1000097998 | 321 |
| 162 | 3300005843 | Ga0068860_100004896 | Ga0068860_10000489614 | 321 |
| 163 | 3300005843 | Ga0068860_100355197 | Ga0068860_1003551972 | 321 |
| 164 | 3300005844 | Ga0068862_100014194 | Ga0068862_1000141945 | 321 |
| 165 | 3300006846 | Ga0075430_100040160 | Ga0075430_1000401603 | 321 |
| 166 | 3300006847 | Ga0075431_100006780 | Ga0075431_1000067803 | 321 |
| 167 | 3300006852 | Ga0075433_10003721 | Ga0075433_100037212 | 321 |
| 168 | 3300006871 | Ga0075434_100012438 | Ga0075434_1000124388 | 321 |
| 169 | 3300006871 | Ga0075434_100022709 | Ga0075434_1000227094 | 321 |
| 170 | 3300006880 | Ga0075429_100168965 | Ga0075429_1001689652 | 321 |
| 171 | 3300006914 | Ga0075436_100099568 | Ga0075436_1000995683 | 321 |
| 172 | 3300006914 | Ga0075436_100144565 | Ga0075436_1001445652 | 321 |
| 173 | 3300006931 | Ga0097620_100002575 | Ga0097620_1000025756 | 321 |
| 174 | 3300007076 | Ga0075435_100002502 | Ga0075435_10000250210 | 321 |
| 175 | 3300009147 | Ga0114129_10082634 | Ga0114129_100826345 | 321 |
| 176 | 3300009147 | Ga0114129_10091152 | Ga0114129_100911522 | 321 |
| 177 | 3300017792 | Ga0163161_10245892 | Ga0163161_102458922 | 321 |
| 178 | 3300025885 | Ga0207653_10002272 | Ga0207653_100022722 | 321 |
| 179 | 3300025907 | Ga0207645_10002083 | Ga0207645_100020836 | 321 |
| 180 | 3300025908 | Ga0207643_10000157 | Ga0207643_1000015735 | 321 |
| 181 | 3300025910 | Ga0207684_10034553 | Ga0207684_100345535 | 321 |
| 182 | 3300025912 | Ga0207707_10000258 | Ga0207707_1000025820 | 321 |
| 183 | 3300025917 | Ga0207660_10001383 | Ga0207660_1000138312 | 321 |
| 184 | 3300025918 | Ga0207662_10019281 | Ga0207662_100192812 | 321 |
| 185 | 3300025919 | Ga0207657_10000373 | Ga0207657_100003736 | 321 |
| 186 | 3300025920 | Ga0207649_10002783 | Ga0207649_100027835 | 321 |
| 187 | 3300025921 | Ga0207652_10092848 | Ga0207652_100928482 | 321 |
| 188 | 3300025925 | Ga0207650_10013539 | Ga0207650_100135396 | 321 |
| 189 | 3300025933 | Ga0207706_10001857 | Ga0207706_1000185714 | 321 |
| 190 | 3300025936 | Ga0207670_10010126 | Ga0207670_100101265 | 321 |
| 191 | 3300025936 | Ga0207670_10052288 | Ga0207670_100522882 | 321 |
| 192 | 3300025942 | Ga0207689_10001419 | Ga0207689_1000141911 | 321 |
| 193 | 3300025942 | Ga0207689_10009967 | Ga0207689_100099678 | 321 |
| 194 | 3300025949 | Ga0207667_10000857 | Ga0207667_1000085716 | 321 |
| 195 | 3300025981 | Ga0207640_10003102 | Ga0207640_100031024 | 321 |
| 196 | 3300026023 | Ga0207677_10054008 | Ga0207677_100540083 | 321 |
| 197 | 3300026041 | Ga0207639_10012434 | Ga0207639_100124346 | 321 |
| 198 | 3300026067 | Ga0207678_10002143 | Ga0207678_1000214316 | 321 |
| 199 | 3300026078 | Ga0207702_10001041 | Ga0207702_1000104123 | 321 |
| 200 | 3300026089 | Ga0207648_10001790 | Ga0207648_1000179011 | 321 |
| 201 | 3300026116 | Ga0207674_10011931 | Ga0207674_100119318 | 321 |
| 202 | 3300026118 | Ga0207675_100025620 | Ga0207675_1000256207 | 321 |
| 203 | 3300026118 | Ga0207675_100174505 | Ga0207675_1001745052 | 321 |
| 204 | 3300027552 | Ga0209982_1003825 | Ga0209982_10038253 | 321 |
| 205 | 3300027665 | Ga0209983_1005174 | Ga0209983_10051743 | 321 |
| 206 | 3300027682 | Ga0209971_1000031 | Ga0209971_100003110 | 321 |
| 207 | 3300027695 | Ga0209966_1000020 | Ga0209966_100002035 | 321 |
| 208 | 3300027717 | Ga0209998_10000024 | Ga0209998_1000002439 | 321 |
| 209 | 3300027876 | Ga0209974_10005110 | Ga0209974_100051103 | 321 |
| 210 | 3300028380 | Ga0268265_10020408 | Ga0268265_100204084 | 321 |
| 211 | 3300028381 | Ga0268264_10026465 | Ga0268264_100264652 | 321 |
| 212 | 3300031727 | Ga0316576_10000469 | Ga0316576_1000046916 | 321 |
| 213 | 3300031728 | Ga0316578_10146607 | Ga0316578_101466072 | 321 |
| 214 | 3300035084 | Ga0373928_0000830 | Ga0373928_0000830_2672_3688 | 321 |
| 215 | 3300035112 | Ga0373932_0001241 | Ga0373932_0001241_1314_2330 | 321 |
| 216 | 3300036401 | Ga0373937_0214366 | Ga0373937_0214366_603_1625 | 321 |
| 217 | 3300042876 | Ga0451577_0002563 | Ga0451577_0002563_6373_7389 | 321 |
| 218 | 3300042876 | Ga0451577_0008288 | Ga0451577_0008288_8052_9068 | 321 |
| 219 | 3300042876 | Ga0451577_0147679 | Ga0451577_0147679_764_1780 | 321 |
| 220 | 3300042876 | Ga0451577_0147735 | Ga0451577_0147735_161_1183 | 321 |
| 221 | 3300042876 | Ga0451577_0243244 | Ga0451577_0243244_17_1030 | 321 |
| 222 | 3300044673 | Ga0453683_0000048 | Ga0453683_0000048_114477_115493 | 321 |
| 223 | 3300044673 | Ga0453683_0043225 | Ga0453683_0043225_15_1031 | 321 |
| 224 | 3300044712 | Ga0453684_0001302 | Ga0453684_0001302_37624_38640 | 321 |
| 225 | 3300044712 | Ga0453684_0001453 | Ga0453684_0001453_4188_5204 | 321 |
| 226 | 3300044712 | Ga0453684_0003094 | Ga0453684_0003094_29825_30841 | 321 |
| 227 | 3300044712 | Ga0453684_0017310 | Ga0453684_0017310_2912_3928 | 321 |
| 228 | 3300045051 | Ga0451576_0174259 | Ga0451576_0174259_911_1927 | 321 |
| 229 | 3300045051 | Ga0451576_0174733 | Ga0451576_0174733_319_1332 | 321 |
| 230 | 3300046681 | Ga0495647_0042784 | Ga0495647_0042784_373_1389 | 321 |
| 231 | 3300048909 | Ga0496106_0099843 | Ga0496106_0099843_1089_2105 | 321 |
| 232 | 3300048910 | Ga0496107_0116245 | Ga0496107_0116245_91_1107 | 321 |
| 233 | 3300049570 | Ga0501033_0053098 | Ga0501033_0053098_1772_2788 | 321 |
| 234 | 3300049572 | Ga0501036_0167355 | Ga0501036_0167355_418_1431 | 321 |
| 235 | 3300049574 | Ga0501038_0040865 | Ga0501038_0040865_1845_2858 | 321 |
| 236 | 3300049575 | Ga0501039_0007391 | Ga0501039_0007391_6362_7375 | 321 |
| 237 | 3300049576 | Ga0501040_0006872 | Ga0501040_0006872_4530_5543 | 321 |
| 238 | 3300049576 | Ga0501040_0074291 | Ga0501040_0074291_996_2051 | 321 |
| 239 | 3300049577 | Ga0501041_0001517 | Ga0501041_0001517_2720_3736 | 321 |
| 240 | 3300049577 | Ga0501041_0014739 | Ga0501041_0014739_1778_2791 | 321 |
| 241 | 3300049578 | Ga0501042_0044771 | Ga0501042_0044771_1728_2741 | 321 |
| 242 | 3300049578 | Ga0501042_0073479 | Ga0501042_0073479_16_1029 | 321 |
| 243 | 3300049580 | Ga0501046_0000607 | Ga0501046_0000607_29674_30687 | 321 |
| 244 | 3300049580 | Ga0501046_0189328 | Ga0501046_0189328_320_1336 | 321 |
| 245 | 3300049581 | Ga0501047_0043661 | Ga0501047_0043661_1706_2719 | 321 |
| 246 | 3300049582 | Ga0501048_0007236 | Ga0501048_0007236_2881_3894 | 321 |
| 247 | 3300049585 | Ga0501069_0059282 | Ga0501069_0059282_949_1974 | 321 |
| 248 | 3300049587 | Ga0501071_0195235 | Ga0501071_0195235_317_1333 | 321 |
| 249 | 3300049588 | Ga0501072_0155504 | Ga0501072_0155504_126_1142 | 321 |
| 250 | 3300049590 | Ga0501074_0009258 | Ga0501074_0009258_1001_2014 | 321 |
| 251 | 3300049591 | Ga0501075_0020084 | Ga0501075_0020084_3120_4136 | 321 |
| 252 | 3300049591 | Ga0501075_0062232 | Ga0501075_0062232_101_1156 | 321 |
| 253 | 3300049592 | Ga0501076_0004888 | Ga0501076_0004888_2352_3368 | 321 |
| 254 | 3300049592 | Ga0501076_0023309 | Ga0501076_0023309_1909_2922 | 321 |
| 255 | 3300049593 | Ga0501077_0007616 | Ga0501077_0007616_2991_4007 | 321 |
| 256 | 3300049593 | Ga0501077_0026293 | Ga0501077_0026293_1825_2838 | 321 |
| 257 | 3300049741 | Ga0501079_0004364 | Ga0501079_0004364_3698_4714 | 321 |
| 258 | 3300049741 | Ga0501079_0005375 | Ga0501079_0005375_971_1984 | 321 |
| 259 | 3300049742 | Ga0501080_0076967 | Ga0501080_0076967_888_1901 | 321 |
| 260 | 3300049742 | Ga0501080_0251860 | Ga0501080_0251860_154_1170 | 321 |
| 261 | 3300049743 | Ga0501081_0008094 | Ga0501081_0008094_3200_4216 | 321 |
| 262 | 3300049824 | Ga0501045_0001608 | Ga0501045_0001608_2566_3579 | 321 |
| 263 | 3300049824 | Ga0501045_0041923 | Ga0501045_0041923_1143_2159 | 321 |
| 264 | 3300050507 | nmdc:mga05p37_344876_c1 | nmdc:mga05p37_344876_c1_115_1131 | 321 |
| 265 | 3300050507 | nmdc:mga05p37_94383_c1 | nmdc:mga05p37_94383_c1_749_1774 | 321 |
| 266 | 3300050510 | nmdc:mga06r32_67198_c1 | nmdc:mga06r32_67198_c1_790_1809 | 321 |
| 267 | 3300050514 | nmdc:mga08x19_65084_c1 | nmdc:mga08x19_65084_c1_399_1418 | 321 |
| 268 | 3300050515 | nmdc:mga0a205_87770_c1 | nmdc:mga0a205_87770_c1_1489_2505 | 321 |
| 269 | 3300054114 | Ga0501084_0003947 | Ga0501084_0003947_1896_2912 | 321 |
| 270 | 3300060353 | Ga0501082_0000058 | Ga0501082_0000058_75339_76352 | 321 |
| 271 | 3300060353 | Ga0501082_0006322 | Ga0501082_0006322_5558_6574 | 321 |
| 272 | 3300060353 | Ga0501082_0115469 | Ga0501082_0115469_595_1650 | 321 |
| 273 | 3300061734 | Ga0530510_0000450 | Ga0530510_0000450_3146_4162 | 321 |
| 274 | 3300061734 | Ga0530510_0019190 | Ga0530510_0019190_871_1887 | 321 |
| 275 | 3300061734 | Ga0530510_0067246 | Ga0530510_0067246_1091_2104 | 321 |
| 276 | 3300005719 | Ga0068861_100128932 | Ga0068861_1001289321 | 322 |
| 277 | 3300005841 | Ga0068863_100263192 | Ga0068863_1002631922 | 322 |
| 278 | 3300005842 | Ga0068858_100072563 | Ga0068858_1000725633 | 322 |
| 279 | 3300006178 | Ga0075367_10052431 | Ga0075367_100524312 | 322 |
| 280 | 3300006195 | Ga0075366_10090882 | Ga0075366_100908822 | 322 |
| 281 | 3300025942 | Ga0207689_10061547 | Ga0207689_100615474 | 322 |
| 282 | 3300026035 | Ga0207703_10022323 | Ga0207703_100223235 | 322 |
| 283 | 3300026089 | Ga0207648_10202124 | Ga0207648_102021242 | 322 |
| 284 | 3300026121 | Ga0207683_10292046 | Ga0207683_102920462 | 322 |
| 285 | 3300031901 | Ga0307406_10148137 | Ga0307406_101481371 | 322 |
| 286 | 3300039093 | Ga0400489_03984 | Ga0400489_03984_9317_10369 | 322 |
| 287 | 3300042876 | Ga0451577_0011788 | Ga0451577_0011788_2060_3082 | 322 |
| 288 | 3300047320 | Ga0495672_0014028 | Ga0495672_0014028_2373_3395 | 322 |
| 289 | 3300048913 | Ga0496110_0184985 | Ga0496110_0184985_530_1615 | 322 |
| 290 | 3300049580 | Ga0501046_0105299 | Ga0501046_0105299_922_1959 | 322 |
| 291 | 3300049741 | Ga0501079_0057901 | Ga0501079_0057901_1450_2487 | 322 |
| 292 | 3300050490 | nmdc:mga03n38_64423_c1 | nmdc:mga03n38_64423_c1_325_1347 | 322 |
| 293 | 3300050493 | nmdc:mga0k408_78176_c1 | nmdc:mga0k408_78176_c1_582_1604 | 322 |
| 294 | 3300050511 | nmdc:mga08y16_96372_c1 | nmdc:mga08y16_96372_c1_1714_2730 | 322 |
| 295 | 3300050512 | nmdc:mga0n895_230325_c1 | nmdc:mga0n895_230325_c1_384_1400 | 322 |
| 296 | 3300050515 | nmdc:mga0a205_11305_c1 | nmdc:mga0a205_11305_c1_5132_6148 | 322 |
| 297 | 3300053103 | Ga0500555_000060 | Ga0500555_000060_28038_29060 | 322 |
| 298 | 3300053153 | Ga0500616_0000336 | Ga0500616_0000336_50932_51954 | 322 |
| 299 | 3300053730 | Ga0500645_001532 | Ga0500645_001532_8704_9726 | 322 |
| 300 | 3300054114 | Ga0501084_0037939 | Ga0501084_0037939_499_1536 | 322 |
| 301 | 3300060353 | Ga0501082_0278082 | Ga0501082_0278082_241_1278 | 322 |
| 302 | 3300061734 | Ga0530510_0000460 | Ga0530510_0000460_23529_24566 | 322 |
| 303 | 3300005365 | Ga0070688_100206021 | Ga0070688_1002060211 | 323 |
| 304 | 3300005445 | Ga0070708_100151506 | Ga0070708_1001515062 | 323 |
| 305 | 3300006844 | Ga0075428_100186965 | Ga0075428_1001869653 | 323 |
| 306 | 3300006880 | Ga0075429_100295395 | Ga0075429_1002953952 | 323 |
| 307 | 3300035084 | Ga0373928_0003859 | Ga0373928_0003859_824_1846 | 323 |
| 308 | 3300049573 | Ga0501037_0151881 | Ga0501037_0151881_569_1606 | 323 |
| 309 | 3300049591 | Ga0501075_0237543 | Ga0501075_0237543_212_1261 | 323 |
| 310 | 3300049743 | Ga0501081_0088734 | Ga0501081_0088734_841_1890 | 323 |
| 311 | 3300049823 | Ga0501044_0144993 | Ga0501044_0144993_188_1270 | 323 |
| 312 | 3300050508 | nmdc:mga09592_31298_c1 | nmdc:mga09592_31298_c1_1812_2864 | 323 |
| 313 | 3300050510 | nmdc:mga06r32_16456_c1 | nmdc:mga06r32_16456_c1_624_1676 | 323 |
| 314 | 3300050511 | nmdc:mga08y16_121449_c1 | nmdc:mga08y16_121449_c1_1022_2047 | 323 |
| 315 | 3300054114 | Ga0501084_0136774 | Ga0501084_0136774_887_1936 | 323 |
| 316 | 3300005330 | Ga0070690_100029402 | Ga0070690_1000294022 | 324 |
| 317 | 3300005335 | Ga0070666_10009938 | Ga0070666_100099385 | 324 |
| 318 | 3300005343 | Ga0070687_100003822 | Ga0070687_1000038227 | 324 |
| 319 | 3300005343 | Ga0070687_100116018 | Ga0070687_1001160182 | 324 |
| 320 | 3300005354 | Ga0070675_100000147 | Ga0070675_10000014744 | 324 |
| 321 | 3300005356 | Ga0070674_100175096 | Ga0070674_1001750962 | 324 |
| 322 | 3300005434 | Ga0070709_10127511 | Ga0070709_101275112 | 324 |
| 323 | 3300005456 | Ga0070678_100212097 | Ga0070678_1002120972 | 324 |
| 324 | 3300005459 | Ga0068867_100025393 | Ga0068867_1000253935 | 324 |
| 325 | 3300005535 | Ga0070684_100179256 | Ga0070684_1001792562 | 324 |
| 326 | 3300005536 | Ga0070697_100009170 | Ga0070697_1000091705 | 324 |
| 327 | 3300005544 | Ga0070686_100028847 | Ga0070686_1000288472 | 324 |
| 328 | 3300005546 | Ga0070696_100006243 | Ga0070696_1000062436 | 324 |
| 329 | 3300005564 | Ga0070664_100347928 | Ga0070664_1003479282 | 324 |
| 330 | 3300005578 | Ga0068854_100170384 | Ga0068854_1001703842 | 324 |
| 331 | 3300005616 | Ga0068852_100296429 | Ga0068852_1002964292 | 324 |
| 332 | 3300005617 | Ga0068859_100098878 | Ga0068859_1000988782 | 324 |
| 333 | 3300005617 | Ga0068859_100273962 | Ga0068859_1002739622 | 324 |
| 334 | 3300005618 | Ga0068864_100002331 | Ga0068864_1000023316 | 324 |
| 335 | 3300005842 | Ga0068858_100013709 | Ga0068858_1000137094 | 324 |
| 336 | 3300005842 | Ga0068858_100035521 | Ga0068858_1000355214 | 324 |
| 337 | 3300006237 | Ga0097621_100008941 | Ga0097621_1000089412 | 324 |
| 338 | 3300006358 | Ga0068871_100009037 | Ga0068871_1000090376 | 324 |
| 339 | 3300006871 | Ga0075434_100006466 | Ga0075434_1000064667 | 324 |
| 340 | 3300006871 | Ga0075434_100040276 | Ga0075434_1000402765 | 324 |
| 341 | 3300006871 | Ga0075434_100128910 | Ga0075434_1001289102 | 324 |
| 342 | 3300006881 | Ga0068865_100074659 | Ga0068865_1000746592 | 324 |
| 343 | 3300006914 | Ga0075436_100018737 | Ga0075436_1000187375 | 324 |
| 344 | 3300006914 | Ga0075436_100021161 | Ga0075436_1000211613 | 324 |
| 345 | 3300006914 | Ga0075436_100195909 | Ga0075436_1001959092 | 324 |
| 346 | 3300006931 | Ga0097620_100098877 | Ga0097620_1000988772 | 324 |
| 347 | 3300006931 | Ga0097620_100273978 | Ga0097620_1002739782 | 324 |
| 348 | 3300007076 | Ga0075435_100000353 | Ga0075435_1000003537 | 324 |
| 349 | 3300007076 | Ga0075435_100003692 | Ga0075435_1000036922 | 324 |
| 350 | 3300007076 | Ga0075435_100006608 | Ga0075435_1000066085 | 324 |
| 351 | 3300007076 | Ga0075435_100041034 | Ga0075435_1000410343 | 324 |
| 352 | 3300009093 | Ga0105240_10414769 | Ga0105240_104147692 | 324 |
| 353 | 3300009098 | Ga0105245_10192365 | Ga0105245_101923652 | 324 |
| 354 | 3300009147 | Ga0114129_10000599 | Ga0114129_1000059937 | 324 |
| 355 | 3300009147 | Ga0114129_10001588 | Ga0114129_1000158816 | 324 |
| 356 | 3300009147 | Ga0114129_10049917 | Ga0114129_100499176 | 324 |
| 357 | 3300009147 | Ga0114129_10096097 | Ga0114129_100960974 | 324 |
| 358 | 3300009147 | Ga0114129_10177852 | Ga0114129_101778524 | 324 |
| 359 | 3300009148 | Ga0105243_10186225 | Ga0105243_101862252 | 324 |
| 360 | 3300009174 | Ga0105241_10107272 | Ga0105241_101072722 | 324 |
| 361 | 3300009174 | Ga0105241_10353635 | Ga0105241_103536352 | 324 |
| 362 | 3300009176 | Ga0105242_10013124 | Ga0105242_100131244 | 324 |
| 363 | 3300009176 | Ga0105242_10054403 | Ga0105242_100544034 | 324 |
| 364 | 3300009177 | Ga0105248_10009010 | Ga0105248_100090102 | 324 |
| 365 | 3300009177 | Ga0105248_10109769 | Ga0105248_101097692 | 324 |
| 366 | 3300013296 | Ga0157374_10096758 | Ga0157374_100967584 | 324 |
| 367 | 3300013296 | Ga0157374_10168977 | Ga0157374_101689772 | 324 |
| 368 | 3300013297 | Ga0157378_10234798 | Ga0157378_102347982 | 324 |
| 369 | 3300014325 | Ga0163163_10039033 | Ga0163163_100390334 | 324 |
| 370 | 3300014745 | Ga0157377_10009096 | Ga0157377_100090964 | 324 |
| 371 | 3300014745 | Ga0157377_10071857 | Ga0157377_100718572 | 324 |
| 372 | 3300014968 | Ga0157379_10076905 | Ga0157379_100769054 | 324 |
| 373 | 3300014969 | Ga0157376_10153466 | Ga0157376_101534663 | 324 |
| 374 | 3300014969 | Ga0157376_10225460 | Ga0157376_102254602 | 324 |
| 375 | 3300025899 | Ga0207642_10036586 | Ga0207642_100365862 | 324 |
| 376 | 3300025900 | Ga0207710_10004508 | Ga0207710_100045086 | 324 |
| 377 | 3300025903 | Ga0207680_10003662 | Ga0207680_100036624 | 324 |
| 378 | 3300025906 | Ga0207699_10150163 | Ga0207699_101501632 | 324 |
| 379 | 3300025911 | Ga0207654_10045188 | Ga0207654_100451882 | 324 |
| 380 | 3300025925 | Ga0207650_10011965 | Ga0207650_100119653 | 324 |
| 381 | 3300025926 | Ga0207659_10000075 | Ga0207659_1000007525 | 324 |
| 382 | 3300025927 | Ga0207687_10111543 | Ga0207687_101115432 | 324 |
| 383 | 3300025934 | Ga0207686_10062716 | Ga0207686_100627163 | 324 |
| 384 | 3300025934 | Ga0207686_10093794 | Ga0207686_100937942 | 324 |
| 385 | 3300025941 | Ga0207711_10041791 | Ga0207711_100417914 | 324 |
| 386 | 3300025941 | Ga0207711_10048269 | Ga0207711_100482693 | 324 |
| 387 | 3300025945 | Ga0207679_10360573 | Ga0207679_103605732 | 324 |
| 388 | 3300025960 | Ga0207651_10264418 | Ga0207651_102644182 | 324 |
| 389 | 3300025981 | Ga0207640_10206291 | Ga0207640_102062912 | 324 |
| 390 | 3300026023 | Ga0207677_10039890 | Ga0207677_100398903 | 324 |
| 391 | 3300026095 | Ga0207676_10035454 | Ga0207676_100354544 | 324 |
| 392 | 3300026095 | Ga0207676_10056072 | Ga0207676_100560723 | 324 |
| 393 | 3300028379 | Ga0268266_10006901 | Ga0268266_100069015 | 324 |
| 394 | 3300028381 | Ga0268264_10100423 | Ga0268264_101004231 | 324 |
| 395 | 3300031548 | Ga0307408_100122130 | Ga0307408_1001221302 | 324 |
| 396 | 3300034819 | Ga0373958_0002230 | Ga0373958_0002230_539_1564 | 324 |
| 397 | 3300034820 | Ga0373959_0002575 | Ga0373959_0002575_64_1089 | 324 |
| 398 | 3300034957 | Ga0373938_0000206 | Ga0373938_0000206_1504_2529 | 324 |
| 399 | 3300035088 | Ga0373940_0004281 | Ga0373940_0004281_1411_2436 | 324 |
| 400 | 3300035091 | Ga0373951_0000641 | Ga0373951_0000641_7355_8380 | 324 |
| 401 | 3300035092 | Ga0373952_0001452 | Ga0373952_0001452_2720_3745 | 324 |
| 402 | 3300035112 | Ga0373932_0000234 | Ga0373932_0000234_9384_10409 | 324 |
| 403 | 3300035114 | Ga0373939_0005279 | Ga0373939_0005279_1056_2081 | 324 |
| 404 | 3300035115 | Ga0373941_0062316 | Ga0373941_0062316_52_1083 | 324 |
| 405 | 3300035117 | Ga0373953_0013204 | Ga0373953_0013204_1341_2369 | 324 |
| 406 | 3300035121 | Ga0373960_0002502 | Ga0373960_0002502_2091_3116 | 324 |
| 407 | 3300035172 | Ga0373955_0012509 | Ga0373955_0012509_2111_3139 | 324 |
| 408 | 3300035207 | Ga0373942_0001609 | Ga0373942_0001609_1530_2555 | 324 |
| 409 | 3300035241 | Ga0373961_0002109 | Ga0373961_0002109_1637_2662 | 324 |
| 410 | 3300035242 | Ga0373962_0001193 | Ga0373962_0001193_3940_4965 | 324 |
| 411 | 3300035398 | Ga0316574_0015849 | Ga0316574_0015849_2013_3110 | 324 |
| 412 | 3300035691 | Ga0373931_0073623 | Ga0373931_0073623_173_1198 | 324 |
| 413 | 3300036401 | Ga0373937_0053969 | Ga0373937_0053969_654_1682 | 324 |
| 414 | 3300037068 | Ga0373925_0023117 | Ga0373925_0023117_777_1865 | 324 |
| 415 | 3300037471 | Ga0395905_0063962 | Ga0395905_0063962_2295_3344 | 324 |
| 416 | 3300038443 | Ga0395901_0153141 | Ga0395901_0153141_975_2024 | 324 |
| 417 | 3300044712 | Ga0453684_0176258 | Ga0453684_0176258_1439_2464 | 324 |
| 418 | 3300045051 | Ga0451576_0023088 | Ga0451576_0023088_4971_5996 | 324 |
| 419 | 3300046455 | Ga0495603_0080888 | Ga0495603_0080888_619_1647 | 324 |
| 420 | 3300046536 | Ga0495587_0031898 | Ga0495587_0031898_1149_2177 | 324 |
| 421 | 3300046543 | Ga0495645_0004379 | Ga0495645_0004379_7903_8931 | 324 |
| 422 | 3300046683 | Ga0495658_0017715 | Ga0495658_0017715_1603_2631 | 324 |
| 423 | 3300047322 | Ga0495680_0222783 | Ga0495680_0222783_87_1115 | 324 |
| 424 | 3300047471 | Ga0495684_0248807 | Ga0495684_0248807_165_1193 | 324 |
| 425 | 3300048905 | Ga0496102_0024057 | Ga0496102_0024057_3322_4347 | 324 |
| 426 | 3300048906 | Ga0496103_0233712 | Ga0496103_0233712_101_1129 | 324 |
| 427 | 3300048907 | Ga0496104_0010445 | Ga0496104_0010445_5139_6167 | 324 |
| 428 | 3300048909 | Ga0496106_0053746 | Ga0496106_0053746_1687_2715 | 324 |
| 429 | 3300048909 | Ga0496106_0119168 | Ga0496106_0119168_73_1098 | 324 |
| 430 | 3300048911 | Ga0496108_0009031 | Ga0496108_0009031_1166_2194 | 324 |
| 431 | 3300048915 | Ga0496112_0042253 | Ga0496112_0042253_3167_4195 | 324 |
| 432 | 3300048916 | Ga0496113_0011834 | Ga0496113_0011834_2966_3994 | 324 |
| 433 | 3300048916 | Ga0496113_0091689 | Ga0496113_0091689_1127_2155 | 324 |
| 434 | 3300048917 | Ga0496114_0037531 | Ga0496114_0037531_1124_2152 | 324 |
| 435 | 3300048917 | Ga0496114_0144573 | Ga0496114_0144573_587_1615 | 324 |
| 436 | 3300048917 | Ga0496114_0157004 | Ga0496114_0157004_88_1116 | 324 |
| 437 | 3300050507 | nmdc:mga05p37_107836_c1 | nmdc:mga05p37_107836_c1_1608_2633 | 324 |
| 438 | 3300050507 | nmdc:mga05p37_17722_c1 | nmdc:mga05p37_17722_c1_104_1132 | 324 |
| 439 | 3300050507 | nmdc:mga05p37_666142_c1 | nmdc:mga05p37_666142_c1_119_1150 | 324 |
| 440 | 3300050507 | nmdc:mga05p37_862_c1 | nmdc:mga05p37_862_c1_9622_10650 | 324 |
| 441 | 3300050512 | nmdc:mga0n895_8027_c1 | nmdc:mga0n895_8027_c1_190_1215 | 324 |
| 442 | 3300050513 | nmdc:mga0rr50_10927_c1 | nmdc:mga0rr50_10927_c1_3164_4192 | 324 |
| 443 | 3300050513 | nmdc:mga0rr50_3354_c1 | nmdc:mga0rr50_3354_c1_2619_3644 | 324 |
| 444 | 3300050513 | nmdc:mga0rr50_50816_c1 | nmdc:mga0rr50_50816_c1_313_1338 | 324 |
| 445 | 3300050514 | nmdc:mga08x19_13456_c1 | nmdc:mga08x19_13456_c1_1427_2452 | 324 |
| 446 | 3300050515 | nmdc:mga0a205_23731_c1 | nmdc:mga0a205_23731_c1_655_1683 | 324 |
| 447 | 3300050515 | nmdc:mga0a205_42525_c1 | nmdc:mga0a205_42525_c1_1755_2780 | 324 |
| 448 | 3300053077 | Ga0495601_0016947 | Ga0495601_0016947_1639_2667 | 324 |
| 449 | 3300053085 | Ga0495619_0179524 | Ga0495619_0179524_402_1430 | 324 |
| 450 | 3300061734 | Ga0530510_0218125 | Ga0530510_0218125_323_1354 | 324 |
| 451 | 3300005444 | Ga0070694_100240019 | Ga0070694_1002400192 | 325 |
| 452 | 3300005445 | Ga0070708_100094405 | Ga0070708_1000944054 | 325 |
| 453 | 3300005518 | Ga0070699_100001741 | Ga0070699_1000017416 | 325 |
| 454 | 3300005536 | Ga0070697_100012093 | Ga0070697_1000120934 | 325 |
| 455 | 3300005546 | Ga0070696_100078406 | Ga0070696_1000784063 | 325 |
| 456 | 3300005617 | Ga0068859_100519076 | Ga0068859_1005190762 | 325 |
| 457 | 3300006844 | Ga0075428_100053120 | Ga0075428_1000531204 | 325 |
| 458 | 3300006846 | Ga0075430_100068786 | Ga0075430_1000687863 | 325 |
| 459 | 3300006847 | Ga0075431_100054782 | Ga0075431_1000547823 | 325 |
| 460 | 3300006852 | Ga0075433_10009354 | Ga0075433_100093548 | 325 |
| 461 | 3300006852 | Ga0075433_10031005 | Ga0075433_100310055 | 325 |
| 462 | 3300006871 | Ga0075434_100219667 | Ga0075434_1002196672 | 325 |
| 463 | 3300006880 | Ga0075429_100026975 | Ga0075429_1000269753 | 325 |
| 464 | 3300006880 | Ga0075429_100110824 | Ga0075429_1001108243 | 325 |
| 465 | 3300006931 | Ga0097620_100519094 | Ga0097620_1005190942 | 325 |
| 466 | 3300009147 | Ga0114129_10100951 | Ga0114129_101009513 | 325 |
| 467 | 3300009147 | Ga0114129_10317226 | Ga0114129_103172263 | 325 |
| 468 | 3300025919 | Ga0207657_10155214 | Ga0207657_101552142 | 325 |
| 469 | 3300031548 | Ga0307408_100024853 | Ga0307408_1000248535 | 325 |
| 470 | 3300032002 | Ga0307416_100042740 | Ga0307416_1000427403 | 325 |
| 471 | 3300050507 | nmdc:mga05p37_205700_c1 | nmdc:mga05p37_205700_c1_771_1811 | 325 |
| 472 | 3300050508 | nmdc:mga09592_228159_c1 | nmdc:mga09592_228159_c1_258_1301 | 325 |
| 473 | 3300050512 | nmdc:mga0n895_78605_c1 | nmdc:mga0n895_78605_c1_1188_2228 | 325 |
| 474 | 3300050515 | nmdc:mga0a205_12408_c1 | nmdc:mga0a205_12408_c1_3614_4654 | 325 |
| 475 | 3300050515 | nmdc:mga0a205_895_c1 | nmdc:mga0a205_895_c1_15198_16232 | 325 |
| 476 | 3300061734 | Ga0530510_0208465 | Ga0530510_0208465_379_1425 | 325 |
| 477 | 3300005441 | Ga0070700_100005861 | Ga0070700_1000058613 | 326 |
| 478 | 3300005445 | Ga0070708_100094591 | Ga0070708_1000945911 | 326 |
| 479 | 3300005471 | Ga0070698_100236197 | Ga0070698_1002361972 | 326 |
| 480 | 3300005535 | Ga0070684_100046615 | Ga0070684_1000466152 | 326 |
| 481 | 3300005546 | Ga0070696_100039506 | Ga0070696_1000395064 | 326 |
| 482 | 3300005549 | Ga0070704_100043264 | Ga0070704_1000432643 | 326 |
| 483 | 3300006844 | Ga0075428_100249476 | Ga0075428_1002494762 | 326 |
| 484 | 3300006880 | Ga0075429_100001793 | Ga0075429_1000017937 | 326 |
| 485 | 3300006914 | Ga0075436_100065946 | Ga0075436_1000659462 | 326 |
| 486 | 3300009094 | Ga0111539_10008974 | Ga0111539_100089749 | 326 |
| 487 | 3300009147 | Ga0114129_10008029 | Ga0114129_1000802911 | 326 |
| 488 | 3300009148 | Ga0105243_10016738 | Ga0105243_100167386 | 326 |
| 489 | 3300009176 | Ga0105242_10006162 | Ga0105242_100061626 | 326 |
| 490 | 3300013297 | Ga0157378_10061725 | Ga0157378_100617252 | 326 |
| 491 | 3300025972 | Ga0207668_10093678 | Ga0207668_100936782 | 326 |
| 492 | 3300026075 | Ga0207708_10061594 | Ga0207708_100615943 | 326 |
| 493 | 3300026088 | Ga0207641_10033710 | Ga0207641_100337104 | 326 |
| 494 | 3300027671 | Ga0209588_1009645 | Ga0209588_10096453 | 326 |
| 495 | 3300027907 | Ga0207428_10148430 | Ga0207428_101484302 | 326 |
| 496 | 3300031901 | Ga0307406_10116504 | Ga0307406_101165042 | 326 |
| 497 | 3300048905 | Ga0496102_0232581 | Ga0496102_0232581_427_1506 | 326 |
| 498 | 3300049588 | Ga0501072_0220639 | Ga0501072_0220639_155_1195 | 326 |
| 499 | 3300050507 | nmdc:mga05p37_88173_c1 | nmdc:mga05p37_88173_c1_173_1216 | 326 |
| 500 | 3300050508 | nmdc:mga09592_33850_c1 | nmdc:mga09592_33850_c1_1915_2958 | 326 |
| 501 | 3300050511 | nmdc:mga08y16_29427_c1 | nmdc:mga08y16_29427_c1_2610_3653 | 326 |
| 502 | 3300050512 | nmdc:mga0n895_5572_c1 | nmdc:mga0n895_5572_c1_6358_7404 | 326 |
| 503 | 3300005347 | Ga0070668_100034892 | Ga0070668_1000348924 | 327 |
| 504 | 3300005353 | Ga0070669_100002755 | Ga0070669_10000275510 | 327 |
| 505 | 3300005457 | Ga0070662_100104757 | Ga0070662_1001047572 | 327 |
| 506 | 3300005467 | Ga0070706_100057489 | Ga0070706_1000574894 | 327 |
| 507 | 3300005468 | Ga0070707_100027866 | Ga0070707_1000278664 | 327 |
| 508 | 3300005518 | Ga0070699_100200134 | Ga0070699_1002001341 | 327 |
| 509 | 3300005543 | Ga0070672_100054067 | Ga0070672_1000540673 | 327 |
| 510 | 3300005549 | Ga0070704_100205617 | Ga0070704_1002056172 | 327 |
| 511 | 3300005719 | Ga0068861_100176541 | Ga0068861_1001765413 | 327 |
| 512 | 3300005843 | Ga0068860_100104122 | Ga0068860_1001041223 | 327 |
| 513 | 3300006871 | Ga0075434_100113208 | Ga0075434_1001132083 | 327 |
| 514 | 3300006880 | Ga0075429_100189347 | Ga0075429_1001893472 | 327 |
| 515 | 3300007076 | Ga0075435_100005683 | Ga0075435_1000056833 | 327 |
| 516 | 3300009094 | Ga0111539_10007648 | Ga0111539_100076488 | 327 |
| 517 | 3300009147 | Ga0114129_10013395 | Ga0114129_100133952 | 327 |
| 518 | 3300009174 | Ga0105241_10067794 | Ga0105241_100677943 | 327 |
| 519 | 3300013297 | Ga0157378_10081633 | Ga0157378_100816332 | 327 |
| 520 | 3300013306 | Ga0163162_10024603 | Ga0163162_100246035 | 327 |
| 521 | 3300025910 | Ga0207684_10049280 | Ga0207684_100492803 | 327 |
| 522 | 3300025911 | Ga0207654_10039930 | Ga0207654_100399302 | 327 |
| 523 | 3300025922 | Ga0207646_10027112 | Ga0207646_100271125 | 327 |
| 524 | 3300025923 | Ga0207681_10014404 | Ga0207681_100144047 | 327 |
| 525 | 3300025933 | Ga0207706_10049930 | Ga0207706_100499303 | 327 |
| 526 | 3300025935 | Ga0207709_10086400 | Ga0207709_100864002 | 327 |
| 527 | 3300025940 | Ga0207691_10066559 | Ga0207691_100665593 | 327 |
| 528 | 3300025972 | Ga0207668_10014274 | Ga0207668_100142744 | 327 |
| 529 | 3300026118 | Ga0207675_100027101 | Ga0207675_1000271013 | 327 |
| 530 | 3300027907 | Ga0207428_10012663 | Ga0207428_100126633 | 327 |
| 531 | 3300028381 | Ga0268264_10068923 | Ga0268264_100689232 | 327 |
| 532 | 3300046528 | Ga0495642_0016591 | Ga0495642_0016591_1495_2547 | 327 |
| 533 | 3300046684 | Ga0495669_0046440 | Ga0495669_0046440_172_1224 | 327 |
| 534 | 3300047318 | Ga0495636_0024339 | Ga0495636_0024339_679_1725 | 327 |
| 535 | 3300049578 | Ga0501042_0093360 | Ga0501042_0093360_957_2003 | 327 |
| 536 | 3300049588 | Ga0501072_0003099 | Ga0501072_0003099_10775_11830 | 327 |
| 537 | 3300049591 | Ga0501075_0011581 | Ga0501075_0011581_1358_2413 | 327 |
| 538 | 3300049591 | Ga0501075_0125389 | Ga0501075_0125389_619_1662 | 327 |
| 539 | 3300049593 | Ga0501077_0007562 | Ga0501077_0007562_3696_4751 | 327 |
| 540 | 3300049593 | Ga0501077_0019750 | Ga0501077_0019750_836_1882 | 327 |
| 541 | 3300049741 | Ga0501079_0005322 | Ga0501079_0005322_2741_3796 | 327 |
| 542 | 3300049741 | Ga0501079_0127723 | Ga0501079_0127723_35_1081 | 327 |
| 543 | 3300049824 | Ga0501045_0046036 | Ga0501045_0046036_1481_2536 | 327 |
| 544 | 3300050507 | nmdc:mga05p37_22487_c1 | nmdc:mga05p37_22487_c1_893_1948 | 327 |
| 545 | 3300050507 | nmdc:mga05p37_2722_c1 | nmdc:mga05p37_2722_c1_16112_17200 | 327 |
| 546 | 3300050507 | nmdc:mga05p37_585174_c1 | nmdc:mga05p37_585174_c1_111_1166 | 327 |
| 547 | 3300050508 | nmdc:mga09592_10352_c1 | nmdc:mga09592_10352_c1_2977_4032 | 327 |
| 548 | 3300050508 | nmdc:mga09592_144871_c1 | nmdc:mga09592_144871_c1_348_1415 | 327 |
| 549 | 3300050508 | nmdc:mga09592_3602_c1 | nmdc:mga09592_3602_c1_1021_2109 | 327 |
| 550 | 3300050509 | nmdc:mga0qj67_125057_c1 | nmdc:mga0qj67_125057_c1_826_1881 | 327 |
| 551 | 3300050509 | nmdc:mga0qj67_20948_c1 | nmdc:mga0qj67_20948_c1_206_1294 | 327 |
| 552 | 3300050510 | nmdc:mga06r32_141901_c1 | nmdc:mga06r32_141901_c1_68_1123 | 327 |
| 553 | 3300050511 | nmdc:mga08y16_1957_c1 | nmdc:mga08y16_1957_c1_16863_17918 | 327 |
| 554 | 3300050512 | nmdc:mga0n895_13064_c1 | nmdc:mga0n895_13064_c1_1653_2774 | 327 |
| 555 | 3300050513 | nmdc:mga0rr50_3069_c1 | nmdc:mga0rr50_3069_c1_6950_7993 | 327 |
| 556 | 3300050515 | nmdc:mga0a205_4763_c1 | nmdc:mga0a205_4763_c1_1118_2239 | 327 |
| 557 | 3300050515 | nmdc:mga0a205_48996_c1 | nmdc:mga0a205_48996_c1_157_1209 | 327 |
| 558 | 3300054114 | Ga0501084_0006427 | Ga0501084_0006427_4869_5924 | 327 |
| 559 | 3300060353 | Ga0501082_0007387 | Ga0501082_0007387_7229_8284 | 327 |
| 560 | 3300061734 | Ga0530510_0057884 | Ga0530510_0057884_656_1702 | 327 |
| 561 | 3300061734 | Ga0530510_0118286 | Ga0530510_0118286_325_1371 | 327 |
| 562 | 3300005293 | Ga0065715_10208653 | Ga0065715_102086532 | 328 |
| 563 | 3300005328 | Ga0070676_10000920 | Ga0070676_1000092010 | 328 |
| 564 | 3300005329 | Ga0070683_100056652 | Ga0070683_1000566525 | 328 |
| 565 | 3300005334 | Ga0068869_100006522 | Ga0068869_1000065224 | 328 |
| 566 | 3300005336 | Ga0070680_100004576 | Ga0070680_1000045768 | 328 |
| 567 | 3300005337 | Ga0070682_100005442 | Ga0070682_1000054425 | 328 |
| 568 | 3300005338 | Ga0068868_100089220 | Ga0068868_1000892203 | 328 |
| 569 | 3300005339 | Ga0070660_100000332 | Ga0070660_10000033230 | 328 |
| 570 | 3300005340 | Ga0070689_100058703 | Ga0070689_1000587034 | 328 |
| 571 | 3300005343 | Ga0070687_100010610 | Ga0070687_1000106104 | 328 |
| 572 | 3300005344 | Ga0070661_100009598 | Ga0070661_1000095982 | 328 |
| 573 | 3300005345 | Ga0070692_10002146 | Ga0070692_100021463 | 328 |
| 574 | 3300005353 | Ga0070669_100032732 | Ga0070669_1000327324 | 328 |
| 575 | 3300005354 | Ga0070675_100209221 | Ga0070675_1002092211 | 328 |
| 576 | 3300005366 | Ga0070659_100001428 | Ga0070659_10000142810 | 328 |
| 577 | 3300005406 | Ga0070703_10007460 | Ga0070703_100074602 | 328 |
| 578 | 3300005434 | Ga0070709_10026406 | Ga0070709_100264064 | 328 |
| 579 | 3300005438 | Ga0070701_10041825 | Ga0070701_100418253 | 328 |
| 580 | 3300005440 | Ga0070705_100000542 | Ga0070705_10000054210 | 328 |
| 581 | 3300005444 | Ga0070694_100000839 | Ga0070694_10000083910 | 328 |
| 582 | 3300005444 | Ga0070694_100003904 | Ga0070694_1000039048 | 328 |
| 583 | 3300005445 | Ga0070708_100028783 | Ga0070708_1000287836 | 328 |
| 584 | 3300005445 | Ga0070708_100036585 | Ga0070708_1000365852 | 328 |
| 585 | 3300005445 | Ga0070708_100271637 | Ga0070708_1002716371 | 328 |
| 586 | 3300005445 | Ga0070708_100306122 | Ga0070708_1003061222 | 328 |
| 587 | 3300005455 | Ga0070663_100002069 | Ga0070663_1000020692 | 328 |
| 588 | 3300005457 | Ga0070662_100009230 | Ga0070662_1000092305 | 328 |
| 589 | 3300005457 | Ga0070662_100115885 | Ga0070662_1001158852 | 328 |
| 590 | 3300005458 | Ga0070681_10018854 | Ga0070681_100188545 | 328 |
| 591 | 3300005459 | Ga0068867_100000884 | Ga0068867_10000088412 | 328 |
| 592 | 3300005467 | Ga0070706_100010113 | Ga0070706_10001011310 | 328 |
| 593 | 3300005467 | Ga0070706_100024833 | Ga0070706_1000248335 | 328 |
| 594 | 3300005467 | Ga0070706_100036412 | Ga0070706_1000364125 | 328 |
| 595 | 3300005468 | Ga0070707_100007265 | Ga0070707_1000072656 | 328 |
| 596 | 3300005468 | Ga0070707_100032051 | Ga0070707_1000320512 | 328 |
| 597 | 3300005468 | Ga0070707_100098450 | Ga0070707_1000984503 | 328 |
| 598 | 3300005468 | Ga0070707_100142874 | Ga0070707_1001428741 | 328 |
| 599 | 3300005471 | Ga0070698_100014079 | Ga0070698_1000140795 | 328 |
| 600 | 3300005471 | Ga0070698_100063516 | Ga0070698_1000635164 | 328 |
| 601 | 3300005518 | Ga0070699_100009282 | Ga0070699_1000092827 | 328 |
| 602 | 3300005518 | Ga0070699_100022694 | Ga0070699_1000226943 | 328 |
| 603 | 3300005518 | Ga0070699_100028105 | Ga0070699_1000281055 | 328 |
| 604 | 3300005518 | Ga0070699_100119845 | Ga0070699_1001198452 | 328 |
| 605 | 3300005530 | Ga0070679_100000895 | Ga0070679_10000089514 | 328 |
| 606 | 3300005535 | Ga0070684_100046493 | Ga0070684_1000464932 | 328 |
| 607 | 3300005536 | Ga0070697_100031758 | Ga0070697_1000317583 | 328 |
| 608 | 3300005536 | Ga0070697_100154827 | Ga0070697_1001548272 | 328 |
| 609 | 3300005536 | Ga0070697_100161285 | Ga0070697_1001612853 | 328 |
| 610 | 3300005539 | Ga0068853_100002471 | Ga0068853_1000024716 | 328 |
| 611 | 3300005545 | Ga0070695_100004819 | Ga0070695_1000048198 | 328 |
| 612 | 3300005546 | Ga0070696_100008767 | Ga0070696_1000087675 | 328 |
| 613 | 3300005547 | Ga0070693_100001933 | Ga0070693_1000019335 | 328 |
| 614 | 3300005549 | Ga0070704_100000570 | Ga0070704_1000005708 | 328 |
| 615 | 3300005615 | Ga0070702_100151707 | Ga0070702_1001517071 | 328 |
| 616 | 3300005841 | Ga0068863_100018065 | Ga0068863_1000180655 | 328 |
| 617 | 3300005843 | Ga0068860_100199773 | Ga0068860_1001997732 | 328 |
| 618 | 3300005981 | Ga0081538_10013563 | Ga0081538_100135635 | 328 |
| 619 | 3300005983 | Ga0081540_1015632 | Ga0081540_10156325 | 328 |
| 620 | 3300006173 | Ga0070716_100035601 | Ga0070716_1000356014 | 328 |
| 621 | 3300006175 | Ga0070712_100013158 | Ga0070712_1000131585 | 328 |
| 622 | 3300006358 | Ga0068871_100195523 | Ga0068871_1001955232 | 328 |
| 623 | 3300006844 | Ga0075428_100105380 | Ga0075428_1001053802 | 328 |
| 624 | 3300006844 | Ga0075428_100189129 | Ga0075428_1001891292 | 328 |
| 625 | 3300006847 | Ga0075431_100225077 | Ga0075431_1002250773 | 328 |
| 626 | 3300006847 | Ga0075431_100306812 | Ga0075431_1003068122 | 328 |
| 627 | 3300006847 | Ga0075431_100315366 | Ga0075431_1003153662 | 328 |
| 628 | 3300006852 | Ga0075433_10002435 | Ga0075433_100024354 | 328 |
| 629 | 3300006852 | Ga0075433_10011237 | Ga0075433_100112376 | 328 |
| 630 | 3300006852 | Ga0075433_10124271 | Ga0075433_101242712 | 328 |
| 631 | 3300006871 | Ga0075434_100005150 | Ga0075434_1000051506 | 328 |
| 632 | 3300006871 | Ga0075434_100109296 | Ga0075434_1001092962 | 328 |
| 633 | 3300006880 | Ga0075429_100027715 | Ga0075429_1000277154 | 328 |
| 634 | 3300007076 | Ga0075435_100039378 | Ga0075435_1000393783 | 328 |
| 635 | 3300009094 | Ga0111539_10000370 | Ga0111539_100003704 | 328 |
| 636 | 3300009094 | Ga0111539_10064712 | Ga0111539_100647126 | 328 |
| 637 | 3300009174 | Ga0105241_10000218 | Ga0105241_100002185 | 328 |
| 638 | 3300009176 | Ga0105242_10143429 | Ga0105242_101434292 | 328 |
| 639 | 3300009177 | Ga0105248_10056969 | Ga0105248_100569695 | 328 |
| 640 | 3300009545 | Ga0105237_10250382 | Ga0105237_102503822 | 328 |
| 641 | 3300009553 | Ga0105249_10261067 | Ga0105249_102610673 | 328 |
| 642 | 3300011119 | Ga0105246_10235698 | Ga0105246_102356982 | 328 |
| 643 | 3300013100 | Ga0157373_10000381 | Ga0157373_1000038111 | 328 |
| 644 | 3300013102 | Ga0157371_10057611 | Ga0157371_100576113 | 328 |
| 645 | 3300013105 | Ga0157369_10021069 | Ga0157369_100210696 | 328 |
| 646 | 3300013307 | Ga0157372_10001479 | Ga0157372_1000147912 | 328 |
| 647 | 3300014326 | Ga0157380_10293427 | Ga0157380_102934272 | 328 |
| 648 | 3300015262 | Ga0182007_10044034 | Ga0182007_100440343 | 328 |
| 649 | 3300025885 | Ga0207653_10003610 | Ga0207653_100036104 | 328 |
| 650 | 3300025906 | Ga0207699_10075166 | Ga0207699_100751663 | 328 |
| 651 | 3300025910 | Ga0207684_10010713 | Ga0207684_100107137 | 328 |
| 652 | 3300025910 | Ga0207684_10051693 | Ga0207684_100516934 | 328 |
| 653 | 3300025915 | Ga0207693_10001303 | Ga0207693_100013037 | 328 |
| 654 | 3300025918 | Ga0207662_10090015 | Ga0207662_100900152 | 328 |
| 655 | 3300025922 | Ga0207646_10019790 | Ga0207646_100197907 | 328 |
| 656 | 3300025922 | Ga0207646_10026953 | Ga0207646_100269535 | 328 |
| 657 | 3300025922 | Ga0207646_10046844 | Ga0207646_100468443 | 328 |
| 658 | 3300025922 | Ga0207646_10050438 | Ga0207646_100504382 | 328 |
| 659 | 3300025922 | Ga0207646_10093447 | Ga0207646_100934473 | 328 |
| 660 | 3300025922 | Ga0207646_10100232 | Ga0207646_101002322 | 328 |
| 661 | 3300025923 | Ga0207681_10152090 | Ga0207681_101520902 | 328 |
| 662 | 3300025933 | Ga0207706_10187620 | Ga0207706_101876203 | 328 |
| 663 | 3300025939 | Ga0207665_10003678 | Ga0207665_100036786 | 328 |
| 664 | 3300025941 | Ga0207711_10254341 | Ga0207711_102543412 | 328 |
| 665 | 3300025961 | Ga0207712_10100038 | Ga0207712_101000382 | 328 |
| 666 | 3300026075 | Ga0207708_10064125 | Ga0207708_100641253 | 328 |
| 667 | 3300026088 | Ga0207641_10207415 | Ga0207641_102074153 | 328 |
| 668 | 3300026116 | Ga0207674_10142947 | Ga0207674_101429474 | 328 |
| 669 | 3300027907 | Ga0207428_10000409 | Ga0207428_1000040945 | 328 |
| 670 | 3300028381 | Ga0268264_10176655 | Ga0268264_101766552 | 328 |
| 671 | 3300035088 | Ga0373940_0006109 | Ga0373940_0006109_723_1757 | 328 |
| 672 | 3300035092 | Ga0373952_0016411 | Ga0373952_0016411_426_1460 | 328 |
| 673 | 3300035241 | Ga0373961_0013563 | Ga0373961_0013563_730_1764 | 328 |
| 674 | 3300038996 | Ga0242420_010870 | Ga0242420_010870_321_1355 | 328 |
| 675 | 3300042005 | Ga0439448_0003645 | Ga0439448_0003645_1467_2501 | 328 |
| 676 | 3300042876 | Ga0451577_0003197 | Ga0451577_0003197_12721_13755 | 328 |
| 677 | 3300042876 | Ga0451577_0023850 | Ga0451577_0023850_1837_2871 | 328 |
| 678 | 3300042876 | Ga0451577_0134764 | Ga0451577_0134764_1046_2080 | 328 |
| 679 | 3300044673 | Ga0453683_0071848 | Ga0453683_0071848_441_1475 | 328 |
| 680 | 3300044673 | Ga0453683_0105022 | Ga0453683_0105022_20_1054 | 328 |
| 681 | 3300044712 | Ga0453684_0015160 | Ga0453684_0015160_3916_4950 | 328 |
| 682 | 3300045051 | Ga0451576_0013787 | Ga0451576_0013787_6622_7656 | 328 |
| 683 | 3300045051 | Ga0451576_0019829 | Ga0451576_0019829_4505_5539 | 328 |
| 684 | 3300045051 | Ga0451576_0052940 | Ga0451576_0052940_1460_2494 | 328 |
| 685 | 3300045051 | Ga0451576_0175287 | Ga0451576_0175287_377_1411 | 328 |
| 686 | 3300045051 | Ga0451576_0251356 | Ga0451576_0251356_41_1075 | 328 |
| 687 | 3300045051 | Ga0451576_0336528 | Ga0451576_0336528_258_1292 | 328 |
| 688 | 3300045051 | Ga0451576_0473711 | Ga0451576_0473711_160_1194 | 328 |
| 689 | 3300046472 | Ga0495580_0146187 | Ga0495580_0146187_417_1451 | 328 |
| 690 | 3300046472 | Ga0495580_0287762 | Ga0495580_0287762_56_1090 | 328 |
| 691 | 3300048905 | Ga0496102_0053609 | Ga0496102_0053609_799_1833 | 328 |
| 692 | 3300048912 | Ga0496109_0159420 | Ga0496109_0159420_484_1518 | 328 |
| 693 | 3300049577 | Ga0501041_0176975 | Ga0501041_0176975_140_1177 | 328 |
| 694 | 3300049588 | Ga0501072_0104005 | Ga0501072_0104005_186_1220 | 328 |
| 695 | 3300049588 | Ga0501072_0166474 | Ga0501072_0166474_441_1475 | 328 |
| 696 | 3300049591 | Ga0501075_0050577 | Ga0501075_0050577_1020_2054 | 328 |
| 697 | 3300049591 | Ga0501075_0107835 | Ga0501075_0107835_276_1310 | 328 |
| 698 | 3300049591 | Ga0501075_0132683 | Ga0501075_0132683_678_1712 | 328 |
| 699 | 3300049741 | Ga0501079_0008589 | Ga0501079_0008589_4631_5668 | 328 |
| 700 | 3300049741 | Ga0501079_0290961 | Ga0501079_0290961_207_1241 | 328 |
| 701 | 3300049742 | Ga0501080_0187909 | Ga0501080_0187909_575_1609 | 328 |
| 702 | 3300049743 | Ga0501081_0126500 | Ga0501081_0126500_226_1263 | 328 |
| 703 | 3300049743 | Ga0501081_0155350 | Ga0501081_0155350_293_1327 | 328 |
| 704 | 3300049824 | Ga0501045_0088616 | Ga0501045_0088616_552_1589 | 328 |
| 705 | 3300050507 | nmdc:mga05p37_148317_c1 | nmdc:mga05p37_148317_c1_1381_2415 | 328 |
| 706 | 3300050508 | nmdc:mga09592_91120_c1 | nmdc:mga09592_91120_c1_333_1367 | 328 |
| 707 | 3300050510 | nmdc:mga06r32_76307_c1 | nmdc:mga06r32_76307_c1_506_1543 | 328 |
| 708 | 3300050511 | nmdc:mga08y16_11942_c1 | nmdc:mga08y16_11942_c1_5557_6591 | 328 |
| 709 | 3300050511 | nmdc:mga08y16_563076_c1 | nmdc:mga08y16_563076_c1_11_1045 | 328 |
| 710 | 3300050512 | nmdc:mga0n895_12611_c1 | nmdc:mga0n895_12611_c1_4466_5500 | 328 |
| 711 | 3300050512 | nmdc:mga0n895_44658_c1 | nmdc:mga0n895_44658_c1_589_1623 | 328 |
| 712 | 3300050514 | nmdc:mga08x19_2391_c1 | nmdc:mga08x19_2391_c1_8969_10003 | 328 |
| 713 | 3300050515 | nmdc:mga0a205_342204_c1 | nmdc:mga0a205_342204_c1_112_1146 | 328 |
| 714 | 3300050515 | nmdc:mga0a205_46561_c1 | nmdc:mga0a205_46561_c1_1052_2086 | 328 |
| 715 | 3300050515 | nmdc:mga0a205_49897_c1 | nmdc:mga0a205_49897_c1_1976_3010 | 328 |
| 716 | 3300050515 | nmdc:mga0a205_5150_c1 | nmdc:mga0a205_5150_c1_576_1610 | 328 |
| 717 | 3300054114 | Ga0501084_0013112 | Ga0501084_0013112_4826_5863 | 328 |
| 718 | 3300054114 | Ga0501084_0316864 | Ga0501084_0316864_49_1083 | 328 |
| 719 | 3300061734 | Ga0530510_0068811 | Ga0530510_0068811_562_1596 | 328 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o5v-assembly1.cif.gz_A | crystal structure of t. acidophilum ider | 0.8425 | 249 | 312 |
| 1g3s-assembly1.cif.gz_A | cys102ser dtxr | 0.8286 | 247 | 310 |
| 2dtr-assembly1.cif.gz_A-2 | structure of diphtheria toxin repressor | 0.8285 | 249 | 312 |
| 3glx-assembly1.cif.gz_A-2 | crystal structure analysis of the dtxr(e175k) complexed with ni(ii) | 0.8278 | 249 | 312 |
| 2qqa-assembly1.cif.gz_A-2 | crystal structure of dtxr(e9a c102d) complexed with nickel(ii) | 0.8204 | 249 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6blbA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9835 | 184 | 246 | 1.10.8.60 |
| 1in5A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9738 | 247 | 316 | 1.10.10.10 |
| 6blbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9735 | 24 | 183 | 3.40.50.300 |
| 3pfiB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9615 | 27 | 184 | 3.40.50.300 |
| 1hqcB03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9582 | 249 | 317 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0WPH5-F1-model_v4 | RuvB C-terminal winged helix domain-containing protein | 0.9932 | 248 | 318 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A7Y2ISW1-F1-model_v4 | AAA family ATPase | 0.9928 | 29 | 138 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A6G2DWS7-F1-model_v4 | AAA family ATPase | 0.9905 | 31 | 137 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A661LGM7-F1-model_v4 | Holliday junction branch migration DNA helicase RuvB | 0.9902 | 249 | 317 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-X1G2L0-F1-model_v4 | AAA+ ATPase domain-containing protein | 0.9894 | 42 | 203 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar