F477230

General Info

Members Datasets Scaffolds Average Seq Length
719 296 718 339

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100113208|Ga0075434_1001132083
Length 373
Sequence MGVKDERKPGRAPAQGPRLVRKSDYSDPAPLPEDLQEETRLRPLALDDFIGQSAVKEQLRISLEAARRRGEAMDHILFHGPPGLGKTTLASIVAHELGVEISRSSGPVIEKPYDLAGLLTNLEPRGVLFLDEIHRLSPVVEEYLYPALEDFAVDILIDRGPGARSVKLNLEPFTLVGATTRSGLLSAPLRSRFGVTLRLDYYGAEDLAQIVRRSAGILAVDVEEAAAVVIARRARGTPRIANRLLRRVRDFALIKSDGRVTRDVTTEALRLLAVDERGLDDMDRRLLDALITKYGGGPVGLNTLAVVVGEEAGTLEDVYEPFLVQEGFIKRTPRGREATPLAYTHLGLQPPPGSGAGTVADKRAPQQPELPLT

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
183 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
211 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
212 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
213 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
214 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
215 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
216 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
217 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
218 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
219 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.28
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 2.64
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10208653 3300005293 Bacteria 1325
2 Ga0070676_10000920 3300005328 Bacteria 14563
3 Ga0070676_10047022 3300005328 Bacteria 2518
4 Ga0070683_100056652 3300005329 Bacteria 3640
5 Ga0070690_100029402 3300005330 Bacteria 3408
6 Ga0068869_100001130 3300005334 Bacteria 15569
7 Ga0068869_100006522 3300005334 Bacteria 7407
8 Ga0068869_100012050 3300005334 Bacteria 5697
9 Ga0068869_100062433 3300005334 Bacteria 2735
10 Ga0070666_10009938 3300005335 Bacteria 5939
11 Ga0070680_100004576 3300005336 Bacteria 10399
12 Ga0070682_100005442 3300005337 Bacteria 7097
13 Ga0068868_100089220 3300005338 Bacteria 2482
14 Ga0070660_100000332 3300005339 Bacteria 31219
15 Ga0070689_100058703 3300005340 Bacteria 2988
16 Ga0070691_10017004 3300005341 Bacteria 3346
17 Ga0070691_10024098 3300005341 Bacteria 2828
18 Ga0070687_100003822 3300005343 Bacteria 5914
19 Ga0070687_100010610 3300005343 Bacteria 3994
20 Ga0070687_100116018 3300005343 Bacteria 1524
21 Ga0070661_100009598 3300005344 Bacteria 6703
22 Ga0070661_100085079 3300005344 Bacteria 2336
23 Ga0070692_10002146 3300005345 Bacteria 7559
24 Ga0070692_10023997 3300005345 Bacteria 2993
25 Ga0070668_100034892 3300005347 Bacteria 3834
26 Ga0070669_100002755 3300005353 Bacteria 12681
27 Ga0070669_100032732 3300005353 Bacteria 3756
28 Ga0070669_100096592 3300005353 Bacteria 2223
29 Ga0070675_100000147 3300005354 Bacteria 42295
30 Ga0070675_100209221 3300005354 Bacteria 1695
31 Ga0070674_100175096 3300005356 Bacteria 1639
32 Ga0070688_100206021 3300005365 Bacteria 1378
33 Ga0070659_100001428 3300005366 Bacteria 17225
34 Ga0070667_100001231 3300005367 Bacteria 23262
35 Ga0070703_10007460 3300005406 Bacteria 3072
36 Ga0070709_10026406 3300005434 Bacteria 3442
37 Ga0070709_10127511 3300005434 Bacteria 1733
38 Ga0070701_10005551 3300005438 Bacteria 5220
39 Ga0070701_10041825 3300005438 Bacteria 2337
40 Ga0070705_100000542 3300005440 Bacteria 21855
41 Ga0070700_100005861 3300005441 Bacteria 6525
42 Ga0070694_100000839 3300005444 Bacteria 17297
43 Ga0070694_100003904 3300005444 Bacteria 8915
44 Ga0070694_100010230 3300005444 Bacteria 5778
45 Ga0070694_100019487 3300005444 Bacteria 4315
46 Ga0070694_100240019 3300005444 Bacteria 1367
47 Ga0070708_100028783 3300005445 Bacteria 4783
48 Ga0070708_100036585 3300005445 Bacteria 4282
49 Ga0070708_100094405 3300005445 Bacteria 2729
50 Ga0070708_100094591 3300005445 Bacteria 2726
51 Ga0070708_100151506 3300005445 Bacteria 2157
52 Ga0070708_100271637 3300005445 Bacteria 1595
53 Ga0070708_100306122 3300005445 Bacteria 1496
54 Ga0070663_100002069 3300005455 Bacteria 11198
55 Ga0070678_100212097 3300005456 Bacteria 1605
56 Ga0070662_100009230 3300005457 Bacteria 6441
57 Ga0070662_100104757 3300005457 Bacteria 2147
58 Ga0070662_100115885 3300005457 Bacteria 2047
59 Ga0070681_10018854 3300005458 Bacteria 6904
60 Ga0068867_100000884 3300005459 Bacteria 20270
61 Ga0068867_100025393 3300005459 Bacteria 4251
62 Ga0070706_100010113 3300005467 Bacteria 8768
63 Ga0070706_100024833 3300005467 Bacteria 5517
64 Ga0070706_100036412 3300005467 Bacteria 4545
65 Ga0070706_100057489 3300005467 Bacteria 3589
66 Ga0070707_100007265 3300005468 Bacteria 10285
67 Ga0070707_100027866 3300005468 Bacteria 5374
68 Ga0070707_100032051 3300005468 Bacteria 5006
69 Ga0070707_100098450 3300005468 Bacteria 2833
70 Ga0070707_100142874 3300005468 Bacteria 2329
71 Ga0070698_100014079 3300005471 Bacteria 8457
72 Ga0070698_100063516 3300005471 Bacteria 3723
73 Ga0070698_100236197 3300005471 Bacteria 1761
74 Ga0070699_100001741 3300005518 Bacteria 19879
75 Ga0070699_100009282 3300005518 Bacteria 8521
76 Ga0070699_100022694 3300005518 Bacteria 5409
77 Ga0070699_100028105 3300005518 Bacteria 4850
78 Ga0070699_100058928 3300005518 Bacteria 3327
79 Ga0070699_100119845 3300005518 Bacteria 2313
80 Ga0070699_100200134 3300005518 Bacteria 1776
81 Ga0070679_100000895 3300005530 Bacteria 25859
82 Ga0070684_100046493 3300005535 Bacteria 3761
83 Ga0070684_100046615 3300005535 Bacteria 3756
84 Ga0070684_100179256 3300005535 Bacteria 1926
85 Ga0070697_100009170 3300005536 Bacteria 7730
86 Ga0070697_100012093 3300005536 Bacteria 6758
87 Ga0070697_100031758 3300005536 Bacteria 4248
88 Ga0070697_100154827 3300005536 Bacteria 1934
89 Ga0070697_100161285 3300005536 Bacteria 1894
90 Ga0068853_100002471 3300005539 Bacteria 13838
91 Ga0070672_100054067 3300005543 Bacteria 3142
92 Ga0070686_100028847 3300005544 Bacteria 3369
93 Ga0070695_100000685 3300005545 Bacteria 18104
94 Ga0070695_100004819 3300005545 Bacteria 7939
95 Ga0070695_100006806 3300005545 Bacteria 6768
96 Ga0070695_100031556 3300005545 Bacteria 3307
97 Ga0070696_100006243 3300005546 Bacteria 7975
98 Ga0070696_100008767 3300005546 Bacteria 6766
99 Ga0070696_100039506 3300005546 Bacteria 3258
100 Ga0070696_100078406 3300005546 Bacteria 2336
101 Ga0070693_100001933 3300005547 Bacteria 9483
102 Ga0070704_100000570 3300005549 Bacteria 17791
103 Ga0070704_100043264 3300005549 Bacteria 3121
104 Ga0070704_100090359 3300005549 Bacteria 2281
105 Ga0070704_100205617 3300005549 Bacteria 1592
106 Ga0068855_100002792 3300005563 Bacteria 21489
107 Ga0070664_100013072 3300005564 Bacteria 6755
108 Ga0070664_100014425 3300005564 Bacteria 6443
109 Ga0070664_100347928 3300005564 Bacteria 1347
110 Ga0068857_100015332 3300005577 Bacteria 6692
111 Ga0068857_100054677 3300005577 Bacteria 3542
112 Ga0068854_100000353 3300005578 Bacteria 29520
113 Ga0068854_100170384 3300005578 Bacteria 1694
114 Ga0068856_100015448 3300005614 Bacteria 7377
115 Ga0070702_100020943 3300005615 Bacteria 3433
116 Ga0070702_100151707 3300005615 Bacteria 1488
117 Ga0068852_100296429 3300005616 Bacteria 1564
118 Ga0068859_100002575 3300005617 Bacteria 18433
119 Ga0068859_100098878 3300005617 Bacteria 2972
120 Ga0068859_100273962 3300005617 Bacteria 1780
121 Ga0068859_100519076 3300005617 Bacteria 1286
122 Ga0068864_100002331 3300005618 Bacteria 15700
123 Ga0068864_100019308 3300005618 Bacteria 5698
124 Ga0068861_100128932 3300005719 Bacteria 2051
125 Ga0068861_100176541 3300005719 Bacteria 1774
126 Ga0068870_10001193 3300005840 Bacteria 10423
127 Ga0068863_100009799 3300005841 Bacteria 9338
128 Ga0068863_100018065 3300005841 Bacteria 6753
129 Ga0068863_100263192 3300005841 Bacteria 1668
130 Ga0068858_100013709 3300005842 Bacteria 7650
131 Ga0068858_100035521 3300005842 Bacteria 4623
132 Ga0068858_100072563 3300005842 Bacteria 3194
133 Ga0068860_100004896 3300005843 Bacteria 13649
134 Ga0068860_100104122 3300005843 Bacteria 2709
135 Ga0068860_100199773 3300005843 Bacteria 1937
136 Ga0068860_100258327 3300005843 Bacteria 1697
137 Ga0068860_100355197 3300005843 Bacteria 1443
138 Ga0068862_100014194 3300005844 Bacteria 6605
139 Ga0068862_100446816 3300005844 Bacteria 1218
140 Ga0081538_10013563 3300005981 Bacteria 6444
141 Ga0081538_10023994 3300005981 Bacteria 4361
142 Ga0081540_1015632 3300005983 Bacteria 4795
143 Ga0070716_100035601 3300006173 Bacteria 2738
144 Ga0070712_100013158 3300006175 Bacteria 5279
145 Ga0075367_10052431 3300006178 Bacteria 2414
146 Ga0075366_10090882 3300006195 Bacteria 1829
147 Ga0097621_100008941 3300006237 Bacteria 7242
148 Ga0068871_100009037 3300006358 Bacteria 7197
149 Ga0068871_100195523 3300006358 Bacteria 1744
150 Ga0075428_100053120 3300006844 Bacteria 4439
151 Ga0075428_100105380 3300006844 Bacteria 3075
152 Ga0075428_100186965 3300006844 Bacteria 2241
153 Ga0075428_100189129 3300006844 Bacteria 2227
154 Ga0075428_100249476 3300006844 Bacteria 1913
155 Ga0075430_100040160 3300006846 Bacteria 3961
156 Ga0075430_100068786 3300006846 Bacteria 2971
157 Ga0075431_100004465 3300006847 Bacteria 13728
158 Ga0075431_100006780 3300006847 Bacteria 11370
159 Ga0075431_100054782 3300006847 Bacteria 4113
160 Ga0075431_100225077 3300006847 Bacteria 1913
161 Ga0075431_100306812 3300006847 Bacteria 1603
162 Ga0075431_100315366 3300006847 Bacteria 1577
163 Ga0075433_10002435 3300006852 Bacteria 14167
164 Ga0075433_10003721 3300006852 Bacteria 11804
165 Ga0075433_10009354 3300006852 Bacteria 7835
166 Ga0075433_10011237 3300006852 Bacteria 7208
167 Ga0075433_10031005 3300006852 Bacteria 4566
168 Ga0075433_10124271 3300006852 Bacteria 2292
169 Ga0075434_100005150 3300006871 Bacteria 11874
170 Ga0075434_100006466 3300006871 Bacteria 10738
171 Ga0075434_100012438 3300006871 Bacteria 8070
172 Ga0075434_100022709 3300006871 Bacteria 6109
173 Ga0075434_100040276 3300006871 Bacteria 4627
174 Ga0075434_100109296 3300006871 Bacteria 2775
175 Ga0075434_100113208 3300006871 Bacteria 2725
176 Ga0075434_100128910 3300006871 Bacteria 2548
177 Ga0075434_100219667 3300006871 Bacteria 1920
178 Ga0075429_100001793 3300006880 Bacteria 17793
179 Ga0075429_100026975 3300006880 Bacteria 4988
180 Ga0075429_100027715 3300006880 Bacteria 4917
181 Ga0075429_100110824 3300006880 Bacteria 2399
182 Ga0075429_100168965 3300006880 Bacteria 1916
183 Ga0075429_100189347 3300006880 Bacteria 1803
184 Ga0075429_100295395 3300006880 Bacteria 1418
185 Ga0068865_100074659 3300006881 Bacteria 2415
186 Ga0075436_100018737 3300006914 Bacteria 4740
187 Ga0075436_100021161 3300006914 Bacteria 4463
188 Ga0075436_100065946 3300006914 Bacteria 2502
189 Ga0075436_100099568 3300006914 Bacteria 2024
190 Ga0075436_100144565 3300006914 Bacteria 1672
191 Ga0075436_100195909 3300006914 Bacteria 1430
192 Ga0097620_100002575 3300006931 Bacteria 18433
193 Ga0097620_100098877 3300006931 Bacteria 2972
194 Ga0097620_100273978 3300006931 Bacteria 1780
195 Ga0097620_100519094 3300006931 Bacteria 1286
196 Ga0075435_100000353 3300007076 Bacteria 28240
197 Ga0075435_100002502 3300007076 Bacteria 12221
198 Ga0075435_100003692 3300007076 Bacteria 10429
199 Ga0075435_100005683 3300007076 Bacteria 8742
200 Ga0075435_100006608 3300007076 Bacteria 8210
201 Ga0075435_100039378 3300007076 Bacteria 3771
202 Ga0075435_100041034 3300007076 Bacteria 3698
203 Ga0105240_10033526 3300009093 Bacteria 6634
204 Ga0105240_10037405 3300009093 Bacteria 6239
205 Ga0105240_10414769 3300009093 Bacteria 1514
206 Ga0111539_10000370 3300009094 Bacteria 55548
207 Ga0111539_10007648 3300009094 Bacteria 13810
208 Ga0111539_10008974 3300009094 Bacteria 12658
209 Ga0111539_10064712 3300009094 Bacteria 4324
210 Ga0105245_10192365 3300009098 Bacteria 1955
211 Ga0114129_10000599 3300009147 Bacteria 44461
212 Ga0114129_10001588 3300009147 Bacteria 30837
213 Ga0114129_10008029 3300009147 Bacteria 15033
214 Ga0114129_10013395 3300009147 Bacteria 11687
215 Ga0114129_10049917 3300009147 Bacteria 5878
216 Ga0114129_10082634 3300009147 Bacteria 4463
217 Ga0114129_10091152 3300009147 Bacteria 4224
218 Ga0114129_10096097 3300009147 Bacteria 4103
219 Ga0114129_10100951 3300009147 Bacteria 3993
220 Ga0114129_10140137 3300009147 Bacteria 3316
221 Ga0114129_10177852 3300009147 Bacteria 2897
222 Ga0114129_10317226 3300009147 Bacteria 2073
223 Ga0105243_10016738 3300009148 Bacteria 5543
224 Ga0105243_10186225 3300009148 Bacteria 1809
225 Ga0105241_10000218 3300009174 Bacteria 43050
226 Ga0105241_10067794 3300009174 Bacteria 2763
227 Ga0105241_10107272 3300009174 Bacteria 2231
228 Ga0105241_10353635 3300009174 Bacteria 1276
229 Ga0105242_10006162 3300009176 Bacteria 9238
230 Ga0105242_10013124 3300009176 Bacteria 6393
231 Ga0105242_10054403 3300009176 Bacteria 3271
232 Ga0105242_10143429 3300009176 Bacteria 2075
233 Ga0105248_10009010 3300009177 Bacteria 10973
234 Ga0105248_10056969 3300009177 Bacteria 4385
235 Ga0105248_10109769 3300009177 Bacteria 3110
236 Ga0105248_10670630 3300009177 Bacteria 1170
237 Ga0105237_10250382 3300009545 Bacteria 1774
238 Ga0105249_10261067 3300009553 Bacteria 1721
239 Ga0105246_10235698 3300011119 Bacteria 1443
240 Ga0157373_10000381 3300013100 Bacteria 35500
241 Ga0157371_10057611 3300013102 Bacteria 2756
242 Ga0157369_10021069 3300013105 Bacteria 7287
243 Ga0157374_10096758 3300013296 Bacteria 2824
244 Ga0157374_10168977 3300013296 Bacteria 2132
245 Ga0157378_10061725 3300013297 Bacteria 3346
246 Ga0157378_10081633 3300013297 Bacteria 2922
247 Ga0157378_10234798 3300013297 Bacteria 1749
248 Ga0163162_10024603 3300013306 Bacteria 5946
249 Ga0157372_10001479 3300013307 Bacteria 25510
250 Ga0157375_10470100 3300013308 Bacteria 1423
251 Ga0163163_10039033 3300014325 Bacteria 4632
252 Ga0157380_10293427 3300014326 Bacteria 1494
253 Ga0157377_10009096 3300014745 Bacteria 4865
254 Ga0157377_10071857 3300014745 Bacteria 2002
255 Ga0157379_10076905 3300014968 Bacteria 2988
256 Ga0157376_10153466 3300014969 Bacteria 2079
257 Ga0157376_10225460 3300014969 Bacteria 1738
258 Ga0182007_10044034 3300015262 Bacteria 1482
259 Ga0163161_10245892 3300017792 Bacteria 1393
260 Ga0206353_11022215 3300020082 Bacteria 3310
261 Ga0213875_10000088 3300021388 Bacteria 106188
262 Ga0224712_10034945 3300022467 Bacteria 1852
263 Ga0207653_10002272 3300025885 Bacteria 6123
264 Ga0207653_10003610 3300025885 Bacteria 4873
265 Ga0207642_10036586 3300025899 Bacteria 2108
266 Ga0207710_10004508 3300025900 Bacteria 6063
267 Ga0207680_10003662 3300025903 Bacteria 7222
268 Ga0207699_10075166 3300025906 Bacteria 2077
269 Ga0207699_10150163 3300025906 Bacteria 1541
270 Ga0207645_10002083 3300025907 Bacteria 16009
271 Ga0207645_10078469 3300025907 Bacteria 2116
272 Ga0207643_10000157 3300025908 Bacteria 46902
273 Ga0207684_10010713 3300025910 Bacteria 8051
274 Ga0207684_10034553 3300025910 Bacteria 4295
275 Ga0207684_10049280 3300025910 Bacteria 3573
276 Ga0207684_10051693 3300025910 Bacteria 3487
277 Ga0207654_10039930 3300025911 Bacteria 2642
278 Ga0207654_10045188 3300025911 Bacteria 2505
279 Ga0207707_10000258 3300025912 Bacteria 57257
280 Ga0207695_10025254 3300025913 Bacteria 6656
281 Ga0207693_10001303 3300025915 Bacteria 22126
282 Ga0207660_10001383 3300025917 Bacteria 16275
283 Ga0207662_10019281 3300025918 Bacteria 3879
284 Ga0207662_10090015 3300025918 Bacteria 1886
285 Ga0207657_10000373 3300025919 Bacteria 47375
286 Ga0207657_10155214 3300025919 Bacteria 1862
287 Ga0207649_10002783 3300025920 Bacteria 9659
288 Ga0207649_10060358 3300025920 Bacteria 2383
289 Ga0207652_10092848 3300025921 Bacteria 2655
290 Ga0207646_10019790 3300025922 Bacteria 6247
291 Ga0207646_10026953 3300025922 Bacteria 5239
292 Ga0207646_10027112 3300025922 Bacteria 5224
293 Ga0207646_10046844 3300025922 Bacteria 3879
294 Ga0207646_10050438 3300025922 Bacteria 3724
295 Ga0207646_10093447 3300025922 Bacteria 2693
296 Ga0207646_10100232 3300025922 Bacteria 2596
297 Ga0207681_10014404 3300025923 Bacteria 4913
298 Ga0207681_10149033 3300025923 Bacteria 1751
299 Ga0207681_10152090 3300025923 Bacteria 1735
300 Ga0207650_10011965 3300025925 Bacteria 5981
301 Ga0207650_10013539 3300025925 Bacteria 5649
302 Ga0207659_10000075 3300025926 Bacteria 63221
303 Ga0207687_10111543 3300025927 Bacteria 2030
304 Ga0207706_10001857 3300025933 Bacteria 20682
305 Ga0207706_10049930 3300025933 Bacteria 3697
306 Ga0207706_10187620 3300025933 Bacteria 1815
307 Ga0207686_10009644 3300025934 Bacteria 5242
308 Ga0207686_10062716 3300025934 Bacteria 2361
309 Ga0207686_10093794 3300025934 Bacteria 1988
310 Ga0207709_10086400 3300025935 Bacteria 2036
311 Ga0207670_10010126 3300025936 Bacteria 5414
312 Ga0207670_10052288 3300025936 Bacteria 2747
313 Ga0207704_10038266 3300025938 Bacteria 2780
314 Ga0207665_10003678 3300025939 Bacteria 10237
315 Ga0207691_10066559 3300025940 Bacteria 3259
316 Ga0207711_10041791 3300025941 Bacteria 3905
317 Ga0207711_10048269 3300025941 Bacteria 3642
318 Ga0207711_10254341 3300025941 Bacteria 1614
319 Ga0207689_10001419 3300025942 Bacteria 22891
320 Ga0207689_10006059 3300025942 Bacteria 10695
321 Ga0207689_10009967 3300025942 Bacteria 8194
322 Ga0207689_10061547 3300025942 Bacteria 3087
323 Ga0207679_10000455 3300025945 Bacteria 28851
324 Ga0207679_10360573 3300025945 Bacteria 1269
325 Ga0207667_10000857 3300025949 Bacteria 39178
326 Ga0207651_10264418 3300025960 Bacteria 1414
327 Ga0207712_10100038 3300025961 Bacteria 2154
328 Ga0207668_10014274 3300025972 Bacteria 4915
329 Ga0207668_10093678 3300025972 Bacteria 2214
330 Ga0207640_10003102 3300025981 Bacteria 8939
331 Ga0207640_10206291 3300025981 Bacteria 1493
332 Ga0207658_10001798 3300025986 Bacteria 16072
333 Ga0207677_10039890 3300026023 Bacteria 3091
334 Ga0207677_10054008 3300026023 Bacteria 2739
335 Ga0207703_10022323 3300026035 Bacteria 4962
336 Ga0207639_10012434 3300026041 Bacteria 5928
337 Ga0207678_10002143 3300026067 Bacteria 17878
338 Ga0207708_10061594 3300026075 Bacteria 2865
339 Ga0207708_10064125 3300026075 Bacteria 2806
340 Ga0207702_10001041 3300026078 Bacteria 28384
341 Ga0207641_10033710 3300026088 Bacteria 4255
342 Ga0207641_10207415 3300026088 Bacteria 1810
343 Ga0207648_10001790 3300026089 Bacteria 23546
344 Ga0207648_10202124 3300026089 Bacteria 1762
345 Ga0207676_10035454 3300026095 Bacteria 3786
346 Ga0207676_10056072 3300026095 Bacteria 3096
347 Ga0207674_10011931 3300026116 Bacteria 9742
348 Ga0207674_10028729 3300026116 Bacteria 5866
349 Ga0207674_10095429 3300026116 Bacteria 2960
350 Ga0207674_10142947 3300026116 Bacteria 2352
351 Ga0207675_100025620 3300026118 Bacteria 5489
352 Ga0207675_100027101 3300026118 Bacteria 5336
353 Ga0207675_100174505 3300026118 Bacteria 2056
354 Ga0207683_10292046 3300026121 Bacteria 1491
355 Ga0207698_10112498 3300026142 Bacteria 2285
356 Ga0209982_1003825 3300027552 Bacteria 2152
357 Ga0209983_1005174 3300027665 Bacteria 2711
358 Ga0209588_1009645 3300027671 Bacteria 2887
359 Ga0209971_1000031 3300027682 Bacteria 50315
360 Ga0209966_1000020 3300027695 Bacteria 68386
361 Ga0209998_10000024 3300027717 Bacteria 64123
362 Ga0209974_10005110 3300027876 Bacteria 4633
363 Ga0207428_10000409 3300027907 Bacteria 53318
364 Ga0207428_10012663 3300027907 Bacteria 7396
365 Ga0207428_10148430 3300027907 Bacteria 1786
366 Ga0268266_10006901 3300028379 Bacteria 10335
367 Ga0268265_10020408 3300028380 Bacteria 4624
368 Ga0268264_10026465 3300028381 Bacteria 4741
369 Ga0268264_10068923 3300028381 Bacteria 2991
370 Ga0268264_10100423 3300028381 Bacteria 2513
371 Ga0268264_10160291 3300028381 Bacteria 2026
372 Ga0268264_10176655 3300028381 Bacteria 1936
373 Ga0307408_100024853 3300031548 Bacteria 4096
374 Ga0307408_100122130 3300031548 Bacteria 2019
375 Ga0316575_10002573 3300031665 Bacteria 6103
376 Ga0316575_10048327 3300031665 Bacteria 1692
377 Ga0316579_10020561 3300031691 Bacteria 2931
378 Ga0316579_10030985 3300031691 Bacteria 2446
379 Ga0316579_10049648 3300031691 Bacteria 1961
380 Ga0316576_10000469 3300031727 Bacteria 18921
381 Ga0316576_10002146 3300031727 Bacteria 11113
382 Ga0316576_10049259 3300031727 Bacteria 3059
383 Ga0316576_10308771 3300031727 Bacteria 1181
384 Ga0316576_10355119 3300031727 Bacteria 1090
385 Ga0316578_10026100 3300031728 Bacteria 3292
386 Ga0316578_10146607 3300031728 Bacteria 1422
387 Ga0316577_10005791 3300031733 Bacteria 6498
388 Ga0316577_10018292 3300031733 Bacteria 3875
389 Ga0316577_10058130 3300031733 Bacteria 2159
390 Ga0316577_10102257 3300031733 Bacteria 1606
391 Ga0316577_10107698 3300031733 Bacteria 1563
392 Ga0316577_10199119 3300031733 Bacteria 1132
393 Ga0307406_10116504 3300031901 Bacteria 1849
394 Ga0307406_10148137 3300031901 Bacteria 1671
395 Ga0307416_100042740 3300032002 Bacteria 3541
396 Ga0316583_10002514 3300032133 Bacteria 6384
397 Ga0316583_10072270 3300032133 Bacteria 1207
398 Ga0316585_10004797 3300032137 Bacteria 3790
399 Ga0373958_0002230 3300034819 Bacteria 2696
400 Ga0373959_0002575 3300034820 Bacteria 2877
401 Ga0373938_0000206 3300034957 Bacteria 8908
402 Ga0373928_0000830 3300035084 Bacteria 6038
403 Ga0373928_0003859 3300035084 Bacteria 2859
404 Ga0373940_0004281 3300035088 Bacteria 3005
405 Ga0373940_0006109 3300035088 Bacteria 2650
406 Ga0373951_0000641 3300035091 Bacteria 9649
407 Ga0373952_0001452 3300035092 Bacteria 4312
408 Ga0373952_0016411 3300035092 Bacteria 1506
409 Ga0373932_0000234 3300035112 Bacteria 16783
410 Ga0373932_0001241 3300035112 Bacteria 7244
411 Ga0373939_0005279 3300035114 Bacteria 3072
412 Ga0373941_0062316 3300035115 Bacteria 1217
413 Ga0373953_0013204 3300035117 Bacteria 2945
414 Ga0373960_0002502 3300035121 Bacteria 4132
415 Ga0373955_0012509 3300035172 Bacteria 4079
416 Ga0373942_0001609 3300035207 Bacteria 5780
417 Ga0373961_0002109 3300035241 Bacteria 5278
418 Ga0373961_0013563 3300035241 Bacteria 2057
419 Ga0373962_0001193 3300035242 Bacteria 6081
420 Ga0316574_0000134 3300035398 Bacteria 23412
421 Ga0316574_0015849 3300035398 Bacteria 4379
422 Ga0316574_0048363 3300035398 Unclassified 2641
423 Ga0373931_0073623 3300035691 Bacteria 1869
424 Ga0373937_0053969 3300036401 Bacteria 3687
425 Ga0373937_0214366 3300036401 Bacteria 1812
426 Ga0316582_0001454 3300036647 Bacteria 10399
427 Ga0316582_0008856 3300036647 Bacteria 5428
428 Ga0316582_0022555 3300036647 Bacteria 3739
429 Ga0316582_0158517 3300036647 Bacteria 1532
430 Ga0316582_0275055 3300036647 Bacteria 1155
431 Ga0316584_0012720 3300036712 Bacteria 5939
432 Ga0316584_0014624 3300036712 Bacteria 5594
433 Ga0316584_0025770 3300036712 Unclassified 4315
434 Ga0316584_0079411 3300036712 Bacteria 2458
435 Ga0316584_0160334 3300036712 Bacteria 1671
436 Ga0316584_0248222 3300036712 Bacteria 1301
437 Ga0373925_0023117 3300037068 Bacteria 4536
438 Ga0395900_0413814 3300037418 Bacteria 1310
439 Ga0395905_0063962 3300037471 Bacteria 3442
440 Ga0436364_0278774 3300037853 Bacteria 400541
441 Ga0395901_0153141 3300038443 Bacteria 2422
442 Ga0400484_25964 3300038725 Unclassified 4267
443 Ga0400484_33113 3300038725 Bacteria 7526
444 Ga0400484_36753 3300038725 Bacteria 10419
445 Ga0400490_05495 3300038726 Bacteria 4928
446 Ga0400490_20302 3300038726 Bacteria 4774
447 Ga0400490_57637 3300038726 Bacteria 50105
448 Ga0400491_01284 3300038727 Bacteria 2247
449 Ga0400491_13897 3300038727 Bacteria 2028
450 Ga0400491_27916 3300038727 Bacteria 3061
451 Ga0400485_09295 3300038735 Bacteria 39082
452 Ga0400485_15200 3300038735 Bacteria 8137
453 Ga0400485_16786 3300038735 Bacteria 10886
454 Ga0400485_19110 3300038735 Bacteria 16368
455 Ga0400488_01246 3300038741 Bacteria 4269
456 Ga0400488_40064 3300038741 Bacteria 1522
457 Ga0400488_60249 3300038741 Unclassified 4641
458 Ga0400486_07017 3300038742 Bacteria 12169
459 Ga0400486_08492 3300038742 Bacteria 14004
460 Ga0400486_27991 3300038742 Bacteria 24917
461 Ga0400486_28559 3300038742 Bacteria 33164
462 Ga0400486_31626 3300038742 Bacteria 26816
463 Ga0242420_010870 3300038996 Bacteria 1519
464 Ga0400483_080006 3300039062 Bacteria 2144
465 Ga0400483_090767 3300039062 Bacteria 68941
466 Ga0400483_143902 3300039062 Bacteria 5225
467 Ga0400483_154721 3300039062 Bacteria 6384
468 Ga0400483_159073 3300039062 Bacteria 18721
469 Ga0400483_228745 3300039062 Bacteria 2011
470 Ga0400483_244471 3300039062 Bacteria 3056
471 Ga0400489_03984 3300039093 Bacteria 30691
472 Ga0400489_71101 3300039093 Bacteria 95670
473 Ga0400489_85455 3300039093 Bacteria 25057
474 Ga0400489_88098 3300039093 Bacteria 22091
475 Ga0400489_96239 3300039093 Bacteria 35043
476 Ga0400487_05468 3300039110 Bacteria 18445
477 Ga0439448_0003645 3300042005 Bacteria 4291
478 Ga0439448_0004102 3300042005 Bacteria 4100
479 Ga0439455_0002010 3300042012 Bacteria 3596
480 Ga0451577_0001528 3300042876 Bacteria 30399
481 Ga0451577_0002563 3300042876 Bacteria 21451
482 Ga0451577_0003197 3300042876 Bacteria 18404
483 Ga0451577_0008288 3300042876 Bacteria 10116
484 Ga0451577_0011788 3300042876 Bacteria 8250
485 Ga0451577_0023850 3300042876 Bacteria 5573
486 Ga0451577_0134764 3300042876 Bacteria 2217
487 Ga0451577_0147679 3300042876 Bacteria 2114
488 Ga0451577_0147735 3300042876 Bacteria 2114
489 Ga0451577_0243244 3300042876 Bacteria 1628
490 Ga0453683_0000048 3300044673 Bacteria 207480
491 Ga0453683_0023353 3300044673 Bacteria 3942
492 Ga0453683_0043225 3300044673 Bacteria 2828
493 Ga0453683_0071848 3300044673 Bacteria 2165
494 Ga0453683_0105022 3300044673 Bacteria 1774
495 Ga0466963_0001565 3300044694 Bacteria 12405
496 Ga0453684_0001302 3300044712 Bacteria 74077
497 Ga0453684_0001453 3300044712 Bacteria 67345
498 Ga0453684_0003094 3300044712 Bacteria 38342
499 Ga0453684_0015160 3300044712 Bacteria 12228
500 Ga0453684_0017310 3300044712 Bacteria 11177
501 Ga0453684_0068794 3300044712 Bacteria 4494
502 Ga0453684_0119023 3300044712 Bacteria 3193
503 Ga0453684_0176258 3300044712 Bacteria 2514
504 Ga0453684_0276365 3300044712 Bacteria 1917
505 Ga0451576_0013787 3300045051 Bacteria 9030
506 Ga0451576_0019829 3300045051 Bacteria 7333
507 Ga0451576_0023088 3300045051 Bacteria 6740
508 Ga0451576_0052940 3300045051 Bacteria 4253
509 Ga0451576_0074289 3300045051 Bacteria 3538
510 Ga0451576_0174259 3300045051 Bacteria 2245
511 Ga0451576_0174733 3300045051 Bacteria 2242
512 Ga0451576_0175287 3300045051 Bacteria 2238
513 Ga0451576_0251356 3300045051 Bacteria 1848
514 Ga0451576_0336528 3300045051 Bacteria 1580
515 Ga0451576_0473711 3300045051 Bacteria 1315
516 Ga0466967_0267111 3300045976 Bacteria 1638
517 Ga0495603_0080888 3300046455 Bacteria 1904
518 Ga0495580_0146187 3300046472 Bacteria 1638
519 Ga0495580_0287762 3300046472 Bacteria 1120
520 Ga0495642_0016591 3300046528 Bacteria 2873
521 Ga0495640_0048187 3300046533 Bacteria 2946
522 Ga0495587_0031898 3300046536 Bacteria 3188
523 Ga0495645_0004379 3300046543 Bacteria 9645
524 Ga0495647_0013279 3300046681 Bacteria 2851
525 Ga0495647_0042784 3300046681 Bacteria 1731
526 Ga0495658_0017715 3300046683 Bacteria 3687
527 Ga0495669_0046440 3300046684 Bacteria 1938
528 Ga0495636_0024339 3300047318 Bacteria 2455
529 Ga0495672_0014028 3300047320 Bacteria 5505
530 Ga0495680_0222783 3300047322 Bacteria 1346
531 Ga0495684_0248807 3300047471 Bacteria 1294
532 Ga0496102_0024057 3300048905 Bacteria 5414
533 Ga0496102_0053609 3300048905 Bacteria 3676
534 Ga0496102_0232581 3300048905 Bacteria 1738
535 Ga0496103_0233712 3300048906 Bacteria 1183
536 Ga0496104_0010445 3300048907 Bacteria 8292
537 Ga0496106_0053746 3300048909 Bacteria 3043
538 Ga0496106_0099843 3300048909 Bacteria 2250
539 Ga0496106_0119168 3300048909 Bacteria 2062
540 Ga0496107_0116245 3300048910 Bacteria 1969
541 Ga0496108_0009031 3300048911 Bacteria 8077
542 Ga0496109_0159420 3300048912 Bacteria 2114
543 Ga0496110_0184985 3300048913 Bacteria 1892
544 Ga0496112_0042253 3300048915 Bacteria 4459
545 Ga0496113_0011834 3300048916 Bacteria 5845
546 Ga0496113_0091689 3300048916 Bacteria 2343
547 Ga0496114_0037531 3300048917 Bacteria 4007
548 Ga0496114_0144573 3300048917 Bacteria 2061
549 Ga0496114_0157004 3300048917 Bacteria 1976
550 Ga0496115_0004390 3300048918 Bacteria 10212
551 Ga0501033_0053098 3300049570 Bacteria 3002
552 Ga0501036_0167355 3300049572 Bacteria 1852
553 Ga0501037_0151881 3300049573 Bacteria 1655
554 Ga0501038_0040865 3300049574 Bacteria 4047
555 Ga0501039_0007391 3300049575 Bacteria 8377
556 Ga0501040_0006872 3300049576 Bacteria 7374
557 Ga0501040_0074291 3300049576 Bacteria 2349
558 Ga0501040_0120156 3300049576 Bacteria 1843
559 Ga0501041_0001517 3300049577 Bacteria 12876
560 Ga0501041_0014739 3300049577 Bacteria 4642
561 Ga0501041_0176975 3300049577 Bacteria 1335
562 Ga0501042_0044771 3300049578 Bacteria 3153
563 Ga0501042_0073479 3300049578 Bacteria 2446
564 Ga0501042_0093360 3300049578 Bacteria 2161
565 Ga0501046_0000607 3300049580 Bacteria 35214
566 Ga0501046_0089977 3300049580 Bacteria 2362
567 Ga0501046_0105299 3300049580 Bacteria 2161
568 Ga0501046_0138709 3300049580 Bacteria 1841
569 Ga0501046_0189328 3300049580 Bacteria 1535
570 Ga0501047_0000115 3300049581 Bacteria 97128
571 Ga0501047_0043661 3300049581 Bacteria 4330
572 Ga0501048_0007236 3300049582 Bacteria 8420
573 Ga0501048_0039379 3300049582 Bacteria 3391
574 Ga0501069_0059282 3300049585 Bacteria 2136
575 Ga0501071_0195235 3300049587 Bacteria 1519
576 Ga0501072_0003099 3300049588 Bacteria 12529
577 Ga0501072_0093008 3300049588 Bacteria 2395
578 Ga0501072_0104005 3300049588 Bacteria 2257
579 Ga0501072_0155504 3300049588 Bacteria 1823
580 Ga0501072_0166474 3300049588 Bacteria 1759
581 Ga0501072_0220639 3300049588 Bacteria 1511
582 Ga0501073_0105256 3300049589 Bacteria 1958
583 Ga0501074_0009258 3300049590 Bacteria 7155
584 Ga0501074_0039206 3300049590 Bacteria 3431
585 Ga0501075_0001457 3300049591 Bacteria 15394
586 Ga0501075_0011581 3300049591 Bacteria 6245
587 Ga0501075_0020084 3300049591 Bacteria 4852
588 Ga0501075_0050577 3300049591 Bacteria 3124
589 Ga0501075_0062232 3300049591 Bacteria 2813
590 Ga0501075_0107835 3300049591 Bacteria 2117
591 Ga0501075_0125389 3300049591 Bacteria 1955
592 Ga0501075_0132683 3300049591 Bacteria 1897
593 Ga0501075_0237543 3300049591 Bacteria 1389
594 Ga0501076_0004888 3300049592 Bacteria 9581
595 Ga0501076_0023309 3300049592 Bacteria 4770
596 Ga0501076_0029517 3300049592 Bacteria 4264
597 Ga0501077_0007562 3300049593 Bacteria 6704
598 Ga0501077_0007616 3300049593 Bacteria 6682
599 Ga0501077_0019750 3300049593 Bacteria 4262
600 Ga0501077_0026293 3300049593 Bacteria 3694
601 Ga0501079_0004364 3300049741 Bacteria 10492
602 Ga0501079_0005322 3300049741 Bacteria 9577
603 Ga0501079_0005375 3300049741 Bacteria 9536
604 Ga0501079_0008589 3300049741 Bacteria 7753
605 Ga0501079_0012404 3300049741 Bacteria 6503
606 Ga0501079_0057901 3300049741 Bacteria 2990
607 Ga0501079_0127723 3300049741 Bacteria 1978
608 Ga0501079_0290961 3300049741 Bacteria 1277
609 Ga0501080_0076967 3300049742 Bacteria 3102
610 Ga0501080_0187909 3300049742 Bacteria 1899
611 Ga0501080_0251860 3300049742 Bacteria 1610
612 Ga0501081_0006708 3300049743 Bacteria 7486
613 Ga0501081_0008094 3300049743 Bacteria 6823
614 Ga0501081_0066508 3300049743 Bacteria 2507
615 Ga0501081_0088734 3300049743 Bacteria 2172
616 Ga0501081_0126500 3300049743 Bacteria 1823
617 Ga0501081_0155350 3300049743 Bacteria 1646
618 Ga0501083_0124332 3300049744 Bacteria 1691
619 Ga0501044_0144993 3300049823 Bacteria 2361
620 Ga0501045_0001608 3300049824 Bacteria 15107
621 Ga0501045_0019327 3300049824 Bacteria 4855
622 Ga0501045_0041923 3300049824 Bacteria 3331
623 Ga0501045_0046036 3300049824 Bacteria 3177
624 Ga0501045_0088616 3300049824 Bacteria 2286
625 nmdc:mga03n38_64423_c1 3300050490 Bacteria 1677
626 nmdc:mga0k408_78176_c1 3300050493 Bacteria 1935
627 nmdc:mga05p37_107836_c1 3300050507 Bacteria 3426
628 nmdc:mga05p37_123027_c1 3300050507 Bacteria 3187
629 nmdc:mga05p37_148317_c1 3300050507 Bacteria 2871
630 nmdc:mga05p37_17722_c1 3300050507 Bacteria 8592
631 nmdc:mga05p37_205700_c1 3300050507 Bacteria 2381
632 nmdc:mga05p37_22487_c1 3300050507 Bacteria 7645
633 nmdc:mga05p37_2722_c1 3300050507 Bacteria 20534
634 nmdc:mga05p37_344876_c1 3300050507 Bacteria 1755
635 nmdc:mga05p37_585174_c1 3300050507 Bacteria 1263
636 nmdc:mga05p37_666142_c1 3300050507 Bacteria 1162
637 nmdc:mga05p37_862_c1 3300050507 Bacteria 34113
638 nmdc:mga05p37_88173_c1 3300050507 Bacteria 3825
639 nmdc:mga05p37_94383_c1 3300050507 Bacteria 3686
640 nmdc:mga09592_10352_c1 3300050508 Bacteria 7589
641 nmdc:mga09592_144871_c1 3300050508 Bacteria 2048
642 nmdc:mga09592_228159_c1 3300050508 Bacteria 1613
643 nmdc:mga09592_31298_c1 3300050508 Bacteria 4433
644 nmdc:mga09592_33850_c1 3300050508 Bacteria 4269
645 nmdc:mga09592_3602_c1 3300050508 Bacteria 12502
646 nmdc:mga09592_91120_c1 3300050508 Bacteria 2605
647 nmdc:mga0qj67_125057_c1 3300050509 Bacteria 2081
648 nmdc:mga0qj67_20948_c1 3300050509 Bacteria 5011
649 nmdc:mga06r32_141901_c1 3300050510 Bacteria 2379
650 nmdc:mga06r32_16456_c1 3300050510 Bacteria 6741
651 nmdc:mga06r32_2118_c1 3300050510 Bacteria 17775
652 nmdc:mga06r32_67198_c1 3300050510 Bacteria 3460
653 nmdc:mga06r32_76307_c1 3300050510 Bacteria 3254
654 nmdc:mga08y16_11942_c1 3300050511 Bacteria 9122
655 nmdc:mga08y16_121449_c1 3300050511 Bacteria 2719
656 nmdc:mga08y16_1957_c1 3300050511 Bacteria 20989
657 nmdc:mga08y16_29427_c1 3300050511 Bacteria 5787
658 nmdc:mga08y16_563076_c1 3300050511 Bacteria 1152
659 nmdc:mga08y16_96372_c1 3300050511 Bacteria 3081
660 nmdc:mga0n895_12611_c1 3300050512 Bacteria 7587
661 nmdc:mga0n895_13064_c1 3300050512 Bacteria 7470
662 nmdc:mga0n895_146384_c1 3300050512 Bacteria 2392
663 nmdc:mga0n895_205032_c1 3300050512 Bacteria 2002
664 nmdc:mga0n895_230325_c1 3300050512 Bacteria 1881
665 nmdc:mga0n895_44658_c1 3300050512 Bacteria 4321
666 nmdc:mga0n895_5572_c1 3300050512 Bacteria 10541
667 nmdc:mga0n895_587827_c1 3300050512 Bacteria 1117
668 nmdc:mga0n895_78605_c1 3300050512 Bacteria 3284
669 nmdc:mga0n895_8027_c1 3300050512 Bacteria 9106
670 nmdc:mga0rr50_10927_c1 3300050513 Bacteria 5790
671 nmdc:mga0rr50_3069_c1 3300050513 Bacteria 9562
672 nmdc:mga0rr50_3354_c1 3300050513 Bacteria 9199
673 nmdc:mga0rr50_48691_c1 3300050513 Bacteria 3134
674 nmdc:mga0rr50_50816_c1 3300050513 Bacteria 3073
675 nmdc:mga08x19_13456_c1 3300050514 Bacteria 4948
676 nmdc:mga08x19_2391_c1 3300050514 Bacteria 11377
677 nmdc:mga08x19_65084_c1 3300050514 Bacteria 2367
678 nmdc:mga0a205_11305_c1 3300050515 Bacteria 8219
679 nmdc:mga0a205_12408_c1 3300050515 Bacteria 7881
680 nmdc:mga0a205_23731_c1 3300050515 Bacteria 5819
681 nmdc:mga0a205_342204_c1 3300050515 Bacteria 1364
682 nmdc:mga0a205_42525_c1 3300050515 Bacteria 2854
683 nmdc:mga0a205_46561_c1 3300050515 Bacteria 4183
684 nmdc:mga0a205_4763_c1 3300050515 Bacteria 12191
685 nmdc:mga0a205_48996_c1 3300050515 Bacteria 4077
686 nmdc:mga0a205_49897_c1 3300050515 Bacteria 4041
687 nmdc:mga0a205_5150_c1 3300050515 Bacteria 11758
688 nmdc:mga0a205_87770_c1 3300050515 Bacteria 3005
689 nmdc:mga0a205_895_c1 3300050515 Bacteria 17939
690 Ga0495601_0007688 3300053077 Bacteria 6337
691 Ga0495601_0016947 3300053077 Bacteria 4420
692 Ga0495619_0005739 3300053085 Bacteria 7865
693 Ga0495619_0179524 3300053085 Bacteria 1465
694 Ga0500555_000060 3300053103 Bacteria 55800
695 Ga0500616_0000336 3300053153 Bacteria 67042
696 Ga0500645_001532 3300053730 Bacteria 11553
697 Ga0501084_0003947 3300054114 Bacteria 12085
698 Ga0501084_0006427 3300054114 Bacteria 9660
699 Ga0501084_0013112 3300054114 Bacteria 6860
700 Ga0501084_0024768 3300054114 Bacteria 5008
701 Ga0501084_0037939 3300054114 Bacteria 4027
702 Ga0501084_0136774 3300054114 Bacteria 2063
703 Ga0501084_0316864 3300054114 Bacteria 1317
704 Ga0501082_0000058 3300060353 Bacteria 78173
705 Ga0501082_0006322 3300060353 Bacteria 10275
706 Ga0501082_0007387 3300060353 Bacteria 9483
707 Ga0501082_0019798 3300060353 Bacteria 5803
708 Ga0501082_0115469 3300060353 Bacteria 2325
709 Ga0501082_0278082 3300060353 Bacteria 1457
710 Ga0530510_0000450 3300061734 Bacteria 26655
711 Ga0530510_0000460 3300061734 Bacteria 26308
712 Ga0530510_0019190 3300061734 Bacteria 4850
713 Ga0530510_0057884 3300061734 Bacteria 2802
714 Ga0530510_0067246 3300061734 Bacteria 2600
715 Ga0530510_0068811 3300061734 Bacteria 2568
716 Ga0530510_0118286 3300061734 Bacteria 1944
717 Ga0530510_0208465 3300061734 Bacteria 1452
718 Ga0530510_0218125 3300061734 Bacteria 1418

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_587827_c1 nmdc:mga0n895_587827_c1_36_896 269
2 3300037418 Ga0395900_0413814 Ga0395900_0413814_62_970 280
3 3300046681 Ga0495647_0013279 Ga0495647_0013279_1891_2805 288
4 3300020082 Ga0206353_11022215 Ga0206353_110222153 297
5 3300038725 Ga0400484_25964 Ga0400484_25964_3174_4232 298
6 3300044694 Ga0466963_0001565 Ga0466963_0001565_6879_7901 298
7 3300005615 Ga0070702_100020943 Ga0070702_1000209431 299
8 3300031727 Ga0316576_10308771 Ga0316576_103087712 300
9 3300031733 Ga0316577_10018292 Ga0316577_100182923 300
10 3300038727 Ga0400491_01284 Ga0400491_01284_342_1400 306
11 3300044712 Ga0453684_0068794 Ga0453684_0068794_1238_2218 306
12 3300048918 Ga0496115_0004390 Ga0496115_0004390_6202_7248 308
13 3300025907 Ga0207645_10078469 Ga0207645_100784691 310
14 3300045976 Ga0466967_0267111 Ga0466967_0267111_362_1381 310
15 3300005981 Ga0081538_10023994 Ga0081538_100239945 311
16 3300009093 Ga0105240_10033526 Ga0105240_100335268 311
17 3300025913 Ga0207695_10025254 Ga0207695_100252542 311
18 3300022467 Ga0224712_10034945 Ga0224712_100349452 312
19 3300036712 Ga0316584_0248222 Ga0316584_0248222_121_1134 312
20 3300009147 Ga0114129_10140137 Ga0114129_101401371 313
21 3300050507 nmdc:mga05p37_123027_c1 nmdc:mga05p37_123027_c1_83_1108 313
22 3300037853 Ga0436364_0278774 Ga0436364_0278774_384209_385213 314
23 3300042876 Ga0451577_0001528 Ga0451577_0001528_6874_7896 314
24 3300005334 Ga0068869_100001130 Ga0068869_1000011309 315
25 3300025923 Ga0207681_10149033 Ga0207681_101490332 315
26 3300025942 Ga0207689_10006059 Ga0207689_100060592 315
27 3300005367 Ga0070667_100001231 Ga0070667_10000123113 316
28 3300005843 Ga0068860_100258327 Ga0068860_1002583272 316
29 3300025986 Ga0207658_10001798 Ga0207658_100017989 316
30 3300028381 Ga0268264_10160291 Ga0268264_101602912 316
31 3300031691 Ga0316579_10049648 Ga0316579_100496482 316
32 3300031727 Ga0316576_10049259 Ga0316576_100492592 316
33 3300005334 Ga0068869_100062433 Ga0068869_1000624333 317
34 3300009093 Ga0105240_10037405 Ga0105240_100374053 317
35 3300050512 nmdc:mga0n895_205032_c1 nmdc:mga0n895_205032_c1_579_1583 317
36 3300021388 Ga0213875_10000088 Ga0213875_1000008886 318
37 3300038741 Ga0400488_40064 Ga0400488_40064_497_1504 318
38 3300044712 Ga0453684_0119023 Ga0453684_0119023_130_1155 318
39 3300049580 Ga0501046_0138709 Ga0501046_0138709_748_1791 318
40 3300049581 Ga0501047_0000115 Ga0501047_0000115_14114_15157 318
41 3300005341 Ga0070691_10017004 Ga0070691_100170044 319
42 3300005345 Ga0070692_10023997 Ga0070692_100239973 319
43 3300005438 Ga0070701_10005551 Ga0070701_100055515 319
44 3300005444 Ga0070694_100010230 Ga0070694_1000102306 319
45 3300005545 Ga0070695_100006806 Ga0070695_1000068064 319
46 3300005844 Ga0068862_100446816 Ga0068862_1004468161 319
47 3300006847 Ga0075431_100004465 Ga0075431_10000446514 319
48 3300025934 Ga0207686_10009644 Ga0207686_100096446 319
49 3300025938 Ga0207704_10038266 Ga0207704_100382664 319
50 3300026116 Ga0207674_10028729 Ga0207674_100287295 319
51 3300039062 Ga0400483_228745 Ga0400483_228745_846_1880 319
52 3300050510 nmdc:mga06r32_2118_c1 nmdc:mga06r32_2118_c1_16631_17644 319
53 3300050512 nmdc:mga0n895_146384_c1 nmdc:mga0n895_146384_c1_722_1732 319
54 3300050513 nmdc:mga0rr50_48691_c1 nmdc:mga0rr50_48691_c1_1345_2355 319
55 3300005344 Ga0070661_100085079 Ga0070661_1000850791 320
56 3300005564 Ga0070664_100013072 Ga0070664_1000130725 320
57 3300005577 Ga0068857_100054677 Ga0068857_1000546774 320
58 3300009177 Ga0105248_10670630 Ga0105248_106706302 320
59 3300013308 Ga0157375_10470100 Ga0157375_104701002 320
60 3300025920 Ga0207649_10060358 Ga0207649_100603583 320
61 3300025945 Ga0207679_10000455 Ga0207679_1000045527 320
62 3300026116 Ga0207674_10095429 Ga0207674_100954293 320
63 3300026142 Ga0207698_10112498 Ga0207698_101124981 320
64 3300031665 Ga0316575_10002573 Ga0316575_100025736 320
65 3300031665 Ga0316575_10048327 Ga0316575_100483272 320
66 3300031691 Ga0316579_10020561 Ga0316579_100205611 320
67 3300031691 Ga0316579_10030985 Ga0316579_100309852 320
68 3300031727 Ga0316576_10002146 Ga0316576_1000214612 320
69 3300031727 Ga0316576_10355119 Ga0316576_103551191 320
70 3300031728 Ga0316578_10026100 Ga0316578_100261003 320
71 3300031733 Ga0316577_10005791 Ga0316577_100057914 320
72 3300031733 Ga0316577_10058130 Ga0316577_100581302 320
73 3300031733 Ga0316577_10102257 Ga0316577_101022572 320
74 3300031733 Ga0316577_10107698 Ga0316577_101076982 320
75 3300031733 Ga0316577_10199119 Ga0316577_101991191 320
76 3300032133 Ga0316583_10002514 Ga0316583_100025147 320
77 3300032133 Ga0316583_10072270 Ga0316583_100722701 320
78 3300032137 Ga0316585_10004797 Ga0316585_100047974 320
79 3300035398 Ga0316574_0000134 Ga0316574_0000134_3059_4102 320
80 3300035398 Ga0316574_0048363 Ga0316574_0048363_209_1255 320
81 3300036647 Ga0316582_0001454 Ga0316582_0001454_7111_8154 320
82 3300036647 Ga0316582_0008856 Ga0316582_0008856_1312_2355 320
83 3300036647 Ga0316582_0022555 Ga0316582_0022555_1393_2433 320
84 3300036647 Ga0316582_0158517 Ga0316582_0158517_456_1499 320
85 3300036647 Ga0316582_0275055 Ga0316582_0275055_55_1095 320
86 3300036712 Ga0316584_0012720 Ga0316584_0012720_2672_3715 320
87 3300036712 Ga0316584_0014624 Ga0316584_0014624_2443_3483 320
88 3300036712 Ga0316584_0025770 Ga0316584_0025770_182_1228 320
89 3300036712 Ga0316584_0079411 Ga0316584_0079411_1145_2185 320
90 3300036712 Ga0316584_0160334 Ga0316584_0160334_317_1360 320
91 3300038725 Ga0400484_33113 Ga0400484_33113_4129_5184 320
92 3300038725 Ga0400484_36753 Ga0400484_36753_4460_5500 320
93 3300038726 Ga0400490_05495 Ga0400490_05495_1977_3017 320
94 3300038726 Ga0400490_20302 Ga0400490_20302_698_1741 320
95 3300038726 Ga0400490_57637 Ga0400490_57637_16040_17080 320
96 3300038727 Ga0400491_13897 Ga0400491_13897_410_1450 320
97 3300038727 Ga0400491_27916 Ga0400491_27916_1900_2940 320
98 3300038735 Ga0400485_09295 Ga0400485_09295_11398_12438 320
99 3300038735 Ga0400485_15200 Ga0400485_15200_4390_5430 320
100 3300038735 Ga0400485_16786 Ga0400485_16786_2345_3391 320
101 3300038735 Ga0400485_19110 Ga0400485_19110_11275_12315 320
102 3300038741 Ga0400488_01246 Ga0400488_01246_1027_2067 320
103 3300038741 Ga0400488_60249 Ga0400488_60249_317_1363 320
104 3300038742 Ga0400486_07017 Ga0400486_07017_7210_8256 320
105 3300038742 Ga0400486_08492 Ga0400486_08492_2891_3931 320
106 3300038742 Ga0400486_27991 Ga0400486_27991_10589_11629 320
107 3300038742 Ga0400486_28559 Ga0400486_28559_5521_6567 320
108 3300038742 Ga0400486_31626 Ga0400486_31626_23541_24581 320
109 3300039062 Ga0400483_080006 Ga0400483_080006_452_1489 320
110 3300039062 Ga0400483_090767 Ga0400483_090767_38560_39606 320
111 3300039062 Ga0400483_143902 Ga0400483_143902_3577_4617 320
112 3300039062 Ga0400483_154721 Ga0400483_154721_5166_6209 320
113 3300039062 Ga0400483_159073 Ga0400483_159073_12898_13938 320
114 3300039062 Ga0400483_244471 Ga0400483_244471_569_1609 320
115 3300039093 Ga0400489_71101 Ga0400489_71101_54677_55717 320
116 3300039093 Ga0400489_85455 Ga0400489_85455_17595_18641 320
117 3300039093 Ga0400489_88098 Ga0400489_88098_14862_15902 320
118 3300039093 Ga0400489_96239 Ga0400489_96239_17035_18093 320
119 3300039110 Ga0400487_05468 Ga0400487_05468_6881_7921 320
120 3300042005 Ga0439448_0004102 Ga0439448_0004102_2248_3264 320
121 3300042012 Ga0439455_0002010 Ga0439455_0002010_1291_2307 320
122 3300044673 Ga0453683_0023353 Ga0453683_0023353_1895_2908 320
123 3300044712 Ga0453684_0276365 Ga0453684_0276365_868_1884 320
124 3300045051 Ga0451576_0074289 Ga0451576_0074289_1802_2818 320
125 3300046533 Ga0495640_0048187 Ga0495640_0048187_1299_2408 320
126 3300049576 Ga0501040_0120156 Ga0501040_0120156_243_1268 320
127 3300049580 Ga0501046_0089977 Ga0501046_0089977_1141_2166 320
128 3300049582 Ga0501048_0039379 Ga0501048_0039379_1948_2973 320
129 3300049588 Ga0501072_0093008 Ga0501072_0093008_1264_2289 320
130 3300049589 Ga0501073_0105256 Ga0501073_0105256_415_1440 320
131 3300049590 Ga0501074_0039206 Ga0501074_0039206_1462_2487 320
132 3300049591 Ga0501075_0001457 Ga0501075_0001457_3697_4722 320
133 3300049592 Ga0501076_0029517 Ga0501076_0029517_1134_2159 320
134 3300049741 Ga0501079_0012404 Ga0501079_0012404_2981_4006 320
135 3300049743 Ga0501081_0006708 Ga0501081_0006708_351_1376 320
136 3300049743 Ga0501081_0066508 Ga0501081_0066508_522_1544 320
137 3300049744 Ga0501083_0124332 Ga0501083_0124332_383_1408 320
138 3300049824 Ga0501045_0019327 Ga0501045_0019327_1836_2861 320
139 3300053077 Ga0495601_0007688 Ga0495601_0007688_292_1401 320
140 3300053085 Ga0495619_0005739 Ga0495619_0005739_5636_6745 320
141 3300054114 Ga0501084_0024768 Ga0501084_0024768_2502_3527 320
142 3300060353 Ga0501082_0019798 Ga0501082_0019798_1767_2792 320
143 iso_pu_bacteria 2740891818 2740990985 320
144 3300005328 Ga0070676_10047022 Ga0070676_100470222 321
145 3300005334 Ga0068869_100012050 Ga0068869_1000120504 321
146 3300005341 Ga0070691_10024098 Ga0070691_100240983 321
147 3300005353 Ga0070669_100096592 Ga0070669_1000965923 321
148 3300005444 Ga0070694_100019487 Ga0070694_1000194874 321
149 3300005518 Ga0070699_100058928 Ga0070699_1000589283 321
150 3300005545 Ga0070695_100000685 Ga0070695_10000068519 321
151 3300005545 Ga0070695_100031556 Ga0070695_1000315563 321
152 3300005549 Ga0070704_100090359 Ga0070704_1000903593 321
153 3300005563 Ga0068855_100002792 Ga0068855_10000279210 321
154 3300005564 Ga0070664_100014425 Ga0070664_1000144256 321
155 3300005577 Ga0068857_100015332 Ga0068857_1000153325 321
156 3300005578 Ga0068854_100000353 Ga0068854_1000003534 321
157 3300005614 Ga0068856_100015448 Ga0068856_1000154484 321
158 3300005617 Ga0068859_100002575 Ga0068859_1000025756 321
159 3300005618 Ga0068864_100019308 Ga0068864_1000193084 321
160 3300005840 Ga0068870_10001193 Ga0068870_100011936 321
161 3300005841 Ga0068863_100009799 Ga0068863_1000097998 321
162 3300005843 Ga0068860_100004896 Ga0068860_10000489614 321
163 3300005843 Ga0068860_100355197 Ga0068860_1003551972 321
164 3300005844 Ga0068862_100014194 Ga0068862_1000141945 321
165 3300006846 Ga0075430_100040160 Ga0075430_1000401603 321
166 3300006847 Ga0075431_100006780 Ga0075431_1000067803 321
167 3300006852 Ga0075433_10003721 Ga0075433_100037212 321
168 3300006871 Ga0075434_100012438 Ga0075434_1000124388 321
169 3300006871 Ga0075434_100022709 Ga0075434_1000227094 321
170 3300006880 Ga0075429_100168965 Ga0075429_1001689652 321
171 3300006914 Ga0075436_100099568 Ga0075436_1000995683 321
172 3300006914 Ga0075436_100144565 Ga0075436_1001445652 321
173 3300006931 Ga0097620_100002575 Ga0097620_1000025756 321
174 3300007076 Ga0075435_100002502 Ga0075435_10000250210 321
175 3300009147 Ga0114129_10082634 Ga0114129_100826345 321
176 3300009147 Ga0114129_10091152 Ga0114129_100911522 321
177 3300017792 Ga0163161_10245892 Ga0163161_102458922 321
178 3300025885 Ga0207653_10002272 Ga0207653_100022722 321
179 3300025907 Ga0207645_10002083 Ga0207645_100020836 321
180 3300025908 Ga0207643_10000157 Ga0207643_1000015735 321
181 3300025910 Ga0207684_10034553 Ga0207684_100345535 321
182 3300025912 Ga0207707_10000258 Ga0207707_1000025820 321
183 3300025917 Ga0207660_10001383 Ga0207660_1000138312 321
184 3300025918 Ga0207662_10019281 Ga0207662_100192812 321
185 3300025919 Ga0207657_10000373 Ga0207657_100003736 321
186 3300025920 Ga0207649_10002783 Ga0207649_100027835 321
187 3300025921 Ga0207652_10092848 Ga0207652_100928482 321
188 3300025925 Ga0207650_10013539 Ga0207650_100135396 321
189 3300025933 Ga0207706_10001857 Ga0207706_1000185714 321
190 3300025936 Ga0207670_10010126 Ga0207670_100101265 321
191 3300025936 Ga0207670_10052288 Ga0207670_100522882 321
192 3300025942 Ga0207689_10001419 Ga0207689_1000141911 321
193 3300025942 Ga0207689_10009967 Ga0207689_100099678 321
194 3300025949 Ga0207667_10000857 Ga0207667_1000085716 321
195 3300025981 Ga0207640_10003102 Ga0207640_100031024 321
196 3300026023 Ga0207677_10054008 Ga0207677_100540083 321
197 3300026041 Ga0207639_10012434 Ga0207639_100124346 321
198 3300026067 Ga0207678_10002143 Ga0207678_1000214316 321
199 3300026078 Ga0207702_10001041 Ga0207702_1000104123 321
200 3300026089 Ga0207648_10001790 Ga0207648_1000179011 321
201 3300026116 Ga0207674_10011931 Ga0207674_100119318 321
202 3300026118 Ga0207675_100025620 Ga0207675_1000256207 321
203 3300026118 Ga0207675_100174505 Ga0207675_1001745052 321
204 3300027552 Ga0209982_1003825 Ga0209982_10038253 321
205 3300027665 Ga0209983_1005174 Ga0209983_10051743 321
206 3300027682 Ga0209971_1000031 Ga0209971_100003110 321
207 3300027695 Ga0209966_1000020 Ga0209966_100002035 321
208 3300027717 Ga0209998_10000024 Ga0209998_1000002439 321
209 3300027876 Ga0209974_10005110 Ga0209974_100051103 321
210 3300028380 Ga0268265_10020408 Ga0268265_100204084 321
211 3300028381 Ga0268264_10026465 Ga0268264_100264652 321
212 3300031727 Ga0316576_10000469 Ga0316576_1000046916 321
213 3300031728 Ga0316578_10146607 Ga0316578_101466072 321
214 3300035084 Ga0373928_0000830 Ga0373928_0000830_2672_3688 321
215 3300035112 Ga0373932_0001241 Ga0373932_0001241_1314_2330 321
216 3300036401 Ga0373937_0214366 Ga0373937_0214366_603_1625 321
217 3300042876 Ga0451577_0002563 Ga0451577_0002563_6373_7389 321
218 3300042876 Ga0451577_0008288 Ga0451577_0008288_8052_9068 321
219 3300042876 Ga0451577_0147679 Ga0451577_0147679_764_1780 321
220 3300042876 Ga0451577_0147735 Ga0451577_0147735_161_1183 321
221 3300042876 Ga0451577_0243244 Ga0451577_0243244_17_1030 321
222 3300044673 Ga0453683_0000048 Ga0453683_0000048_114477_115493 321
223 3300044673 Ga0453683_0043225 Ga0453683_0043225_15_1031 321
224 3300044712 Ga0453684_0001302 Ga0453684_0001302_37624_38640 321
225 3300044712 Ga0453684_0001453 Ga0453684_0001453_4188_5204 321
226 3300044712 Ga0453684_0003094 Ga0453684_0003094_29825_30841 321
227 3300044712 Ga0453684_0017310 Ga0453684_0017310_2912_3928 321
228 3300045051 Ga0451576_0174259 Ga0451576_0174259_911_1927 321
229 3300045051 Ga0451576_0174733 Ga0451576_0174733_319_1332 321
230 3300046681 Ga0495647_0042784 Ga0495647_0042784_373_1389 321
231 3300048909 Ga0496106_0099843 Ga0496106_0099843_1089_2105 321
232 3300048910 Ga0496107_0116245 Ga0496107_0116245_91_1107 321
233 3300049570 Ga0501033_0053098 Ga0501033_0053098_1772_2788 321
234 3300049572 Ga0501036_0167355 Ga0501036_0167355_418_1431 321
235 3300049574 Ga0501038_0040865 Ga0501038_0040865_1845_2858 321
236 3300049575 Ga0501039_0007391 Ga0501039_0007391_6362_7375 321
237 3300049576 Ga0501040_0006872 Ga0501040_0006872_4530_5543 321
238 3300049576 Ga0501040_0074291 Ga0501040_0074291_996_2051 321
239 3300049577 Ga0501041_0001517 Ga0501041_0001517_2720_3736 321
240 3300049577 Ga0501041_0014739 Ga0501041_0014739_1778_2791 321
241 3300049578 Ga0501042_0044771 Ga0501042_0044771_1728_2741 321
242 3300049578 Ga0501042_0073479 Ga0501042_0073479_16_1029 321
243 3300049580 Ga0501046_0000607 Ga0501046_0000607_29674_30687 321
244 3300049580 Ga0501046_0189328 Ga0501046_0189328_320_1336 321
245 3300049581 Ga0501047_0043661 Ga0501047_0043661_1706_2719 321
246 3300049582 Ga0501048_0007236 Ga0501048_0007236_2881_3894 321
247 3300049585 Ga0501069_0059282 Ga0501069_0059282_949_1974 321
248 3300049587 Ga0501071_0195235 Ga0501071_0195235_317_1333 321
249 3300049588 Ga0501072_0155504 Ga0501072_0155504_126_1142 321
250 3300049590 Ga0501074_0009258 Ga0501074_0009258_1001_2014 321
251 3300049591 Ga0501075_0020084 Ga0501075_0020084_3120_4136 321
252 3300049591 Ga0501075_0062232 Ga0501075_0062232_101_1156 321
253 3300049592 Ga0501076_0004888 Ga0501076_0004888_2352_3368 321
254 3300049592 Ga0501076_0023309 Ga0501076_0023309_1909_2922 321
255 3300049593 Ga0501077_0007616 Ga0501077_0007616_2991_4007 321
256 3300049593 Ga0501077_0026293 Ga0501077_0026293_1825_2838 321
257 3300049741 Ga0501079_0004364 Ga0501079_0004364_3698_4714 321
258 3300049741 Ga0501079_0005375 Ga0501079_0005375_971_1984 321
259 3300049742 Ga0501080_0076967 Ga0501080_0076967_888_1901 321
260 3300049742 Ga0501080_0251860 Ga0501080_0251860_154_1170 321
261 3300049743 Ga0501081_0008094 Ga0501081_0008094_3200_4216 321
262 3300049824 Ga0501045_0001608 Ga0501045_0001608_2566_3579 321
263 3300049824 Ga0501045_0041923 Ga0501045_0041923_1143_2159 321
264 3300050507 nmdc:mga05p37_344876_c1 nmdc:mga05p37_344876_c1_115_1131 321
265 3300050507 nmdc:mga05p37_94383_c1 nmdc:mga05p37_94383_c1_749_1774 321
266 3300050510 nmdc:mga06r32_67198_c1 nmdc:mga06r32_67198_c1_790_1809 321
267 3300050514 nmdc:mga08x19_65084_c1 nmdc:mga08x19_65084_c1_399_1418 321
268 3300050515 nmdc:mga0a205_87770_c1 nmdc:mga0a205_87770_c1_1489_2505 321
269 3300054114 Ga0501084_0003947 Ga0501084_0003947_1896_2912 321
270 3300060353 Ga0501082_0000058 Ga0501082_0000058_75339_76352 321
271 3300060353 Ga0501082_0006322 Ga0501082_0006322_5558_6574 321
272 3300060353 Ga0501082_0115469 Ga0501082_0115469_595_1650 321
273 3300061734 Ga0530510_0000450 Ga0530510_0000450_3146_4162 321
274 3300061734 Ga0530510_0019190 Ga0530510_0019190_871_1887 321
275 3300061734 Ga0530510_0067246 Ga0530510_0067246_1091_2104 321
276 3300005719 Ga0068861_100128932 Ga0068861_1001289321 322
277 3300005841 Ga0068863_100263192 Ga0068863_1002631922 322
278 3300005842 Ga0068858_100072563 Ga0068858_1000725633 322
279 3300006178 Ga0075367_10052431 Ga0075367_100524312 322
280 3300006195 Ga0075366_10090882 Ga0075366_100908822 322
281 3300025942 Ga0207689_10061547 Ga0207689_100615474 322
282 3300026035 Ga0207703_10022323 Ga0207703_100223235 322
283 3300026089 Ga0207648_10202124 Ga0207648_102021242 322
284 3300026121 Ga0207683_10292046 Ga0207683_102920462 322
285 3300031901 Ga0307406_10148137 Ga0307406_101481371 322
286 3300039093 Ga0400489_03984 Ga0400489_03984_9317_10369 322
287 3300042876 Ga0451577_0011788 Ga0451577_0011788_2060_3082 322
288 3300047320 Ga0495672_0014028 Ga0495672_0014028_2373_3395 322
289 3300048913 Ga0496110_0184985 Ga0496110_0184985_530_1615 322
290 3300049580 Ga0501046_0105299 Ga0501046_0105299_922_1959 322
291 3300049741 Ga0501079_0057901 Ga0501079_0057901_1450_2487 322
292 3300050490 nmdc:mga03n38_64423_c1 nmdc:mga03n38_64423_c1_325_1347 322
293 3300050493 nmdc:mga0k408_78176_c1 nmdc:mga0k408_78176_c1_582_1604 322
294 3300050511 nmdc:mga08y16_96372_c1 nmdc:mga08y16_96372_c1_1714_2730 322
295 3300050512 nmdc:mga0n895_230325_c1 nmdc:mga0n895_230325_c1_384_1400 322
296 3300050515 nmdc:mga0a205_11305_c1 nmdc:mga0a205_11305_c1_5132_6148 322
297 3300053103 Ga0500555_000060 Ga0500555_000060_28038_29060 322
298 3300053153 Ga0500616_0000336 Ga0500616_0000336_50932_51954 322
299 3300053730 Ga0500645_001532 Ga0500645_001532_8704_9726 322
300 3300054114 Ga0501084_0037939 Ga0501084_0037939_499_1536 322
301 3300060353 Ga0501082_0278082 Ga0501082_0278082_241_1278 322
302 3300061734 Ga0530510_0000460 Ga0530510_0000460_23529_24566 322
303 3300005365 Ga0070688_100206021 Ga0070688_1002060211 323
304 3300005445 Ga0070708_100151506 Ga0070708_1001515062 323
305 3300006844 Ga0075428_100186965 Ga0075428_1001869653 323
306 3300006880 Ga0075429_100295395 Ga0075429_1002953952 323
307 3300035084 Ga0373928_0003859 Ga0373928_0003859_824_1846 323
308 3300049573 Ga0501037_0151881 Ga0501037_0151881_569_1606 323
309 3300049591 Ga0501075_0237543 Ga0501075_0237543_212_1261 323
310 3300049743 Ga0501081_0088734 Ga0501081_0088734_841_1890 323
311 3300049823 Ga0501044_0144993 Ga0501044_0144993_188_1270 323
312 3300050508 nmdc:mga09592_31298_c1 nmdc:mga09592_31298_c1_1812_2864 323
313 3300050510 nmdc:mga06r32_16456_c1 nmdc:mga06r32_16456_c1_624_1676 323
314 3300050511 nmdc:mga08y16_121449_c1 nmdc:mga08y16_121449_c1_1022_2047 323
315 3300054114 Ga0501084_0136774 Ga0501084_0136774_887_1936 323
316 3300005330 Ga0070690_100029402 Ga0070690_1000294022 324
317 3300005335 Ga0070666_10009938 Ga0070666_100099385 324
318 3300005343 Ga0070687_100003822 Ga0070687_1000038227 324
319 3300005343 Ga0070687_100116018 Ga0070687_1001160182 324
320 3300005354 Ga0070675_100000147 Ga0070675_10000014744 324
321 3300005356 Ga0070674_100175096 Ga0070674_1001750962 324
322 3300005434 Ga0070709_10127511 Ga0070709_101275112 324
323 3300005456 Ga0070678_100212097 Ga0070678_1002120972 324
324 3300005459 Ga0068867_100025393 Ga0068867_1000253935 324
325 3300005535 Ga0070684_100179256 Ga0070684_1001792562 324
326 3300005536 Ga0070697_100009170 Ga0070697_1000091705 324
327 3300005544 Ga0070686_100028847 Ga0070686_1000288472 324
328 3300005546 Ga0070696_100006243 Ga0070696_1000062436 324
329 3300005564 Ga0070664_100347928 Ga0070664_1003479282 324
330 3300005578 Ga0068854_100170384 Ga0068854_1001703842 324
331 3300005616 Ga0068852_100296429 Ga0068852_1002964292 324
332 3300005617 Ga0068859_100098878 Ga0068859_1000988782 324
333 3300005617 Ga0068859_100273962 Ga0068859_1002739622 324
334 3300005618 Ga0068864_100002331 Ga0068864_1000023316 324
335 3300005842 Ga0068858_100013709 Ga0068858_1000137094 324
336 3300005842 Ga0068858_100035521 Ga0068858_1000355214 324
337 3300006237 Ga0097621_100008941 Ga0097621_1000089412 324
338 3300006358 Ga0068871_100009037 Ga0068871_1000090376 324
339 3300006871 Ga0075434_100006466 Ga0075434_1000064667 324
340 3300006871 Ga0075434_100040276 Ga0075434_1000402765 324
341 3300006871 Ga0075434_100128910 Ga0075434_1001289102 324
342 3300006881 Ga0068865_100074659 Ga0068865_1000746592 324
343 3300006914 Ga0075436_100018737 Ga0075436_1000187375 324
344 3300006914 Ga0075436_100021161 Ga0075436_1000211613 324
345 3300006914 Ga0075436_100195909 Ga0075436_1001959092 324
346 3300006931 Ga0097620_100098877 Ga0097620_1000988772 324
347 3300006931 Ga0097620_100273978 Ga0097620_1002739782 324
348 3300007076 Ga0075435_100000353 Ga0075435_1000003537 324
349 3300007076 Ga0075435_100003692 Ga0075435_1000036922 324
350 3300007076 Ga0075435_100006608 Ga0075435_1000066085 324
351 3300007076 Ga0075435_100041034 Ga0075435_1000410343 324
352 3300009093 Ga0105240_10414769 Ga0105240_104147692 324
353 3300009098 Ga0105245_10192365 Ga0105245_101923652 324
354 3300009147 Ga0114129_10000599 Ga0114129_1000059937 324
355 3300009147 Ga0114129_10001588 Ga0114129_1000158816 324
356 3300009147 Ga0114129_10049917 Ga0114129_100499176 324
357 3300009147 Ga0114129_10096097 Ga0114129_100960974 324
358 3300009147 Ga0114129_10177852 Ga0114129_101778524 324
359 3300009148 Ga0105243_10186225 Ga0105243_101862252 324
360 3300009174 Ga0105241_10107272 Ga0105241_101072722 324
361 3300009174 Ga0105241_10353635 Ga0105241_103536352 324
362 3300009176 Ga0105242_10013124 Ga0105242_100131244 324
363 3300009176 Ga0105242_10054403 Ga0105242_100544034 324
364 3300009177 Ga0105248_10009010 Ga0105248_100090102 324
365 3300009177 Ga0105248_10109769 Ga0105248_101097692 324
366 3300013296 Ga0157374_10096758 Ga0157374_100967584 324
367 3300013296 Ga0157374_10168977 Ga0157374_101689772 324
368 3300013297 Ga0157378_10234798 Ga0157378_102347982 324
369 3300014325 Ga0163163_10039033 Ga0163163_100390334 324
370 3300014745 Ga0157377_10009096 Ga0157377_100090964 324
371 3300014745 Ga0157377_10071857 Ga0157377_100718572 324
372 3300014968 Ga0157379_10076905 Ga0157379_100769054 324
373 3300014969 Ga0157376_10153466 Ga0157376_101534663 324
374 3300014969 Ga0157376_10225460 Ga0157376_102254602 324
375 3300025899 Ga0207642_10036586 Ga0207642_100365862 324
376 3300025900 Ga0207710_10004508 Ga0207710_100045086 324
377 3300025903 Ga0207680_10003662 Ga0207680_100036624 324
378 3300025906 Ga0207699_10150163 Ga0207699_101501632 324
379 3300025911 Ga0207654_10045188 Ga0207654_100451882 324
380 3300025925 Ga0207650_10011965 Ga0207650_100119653 324
381 3300025926 Ga0207659_10000075 Ga0207659_1000007525 324
382 3300025927 Ga0207687_10111543 Ga0207687_101115432 324
383 3300025934 Ga0207686_10062716 Ga0207686_100627163 324
384 3300025934 Ga0207686_10093794 Ga0207686_100937942 324
385 3300025941 Ga0207711_10041791 Ga0207711_100417914 324
386 3300025941 Ga0207711_10048269 Ga0207711_100482693 324
387 3300025945 Ga0207679_10360573 Ga0207679_103605732 324
388 3300025960 Ga0207651_10264418 Ga0207651_102644182 324
389 3300025981 Ga0207640_10206291 Ga0207640_102062912 324
390 3300026023 Ga0207677_10039890 Ga0207677_100398903 324
391 3300026095 Ga0207676_10035454 Ga0207676_100354544 324
392 3300026095 Ga0207676_10056072 Ga0207676_100560723 324
393 3300028379 Ga0268266_10006901 Ga0268266_100069015 324
394 3300028381 Ga0268264_10100423 Ga0268264_101004231 324
395 3300031548 Ga0307408_100122130 Ga0307408_1001221302 324
396 3300034819 Ga0373958_0002230 Ga0373958_0002230_539_1564 324
397 3300034820 Ga0373959_0002575 Ga0373959_0002575_64_1089 324
398 3300034957 Ga0373938_0000206 Ga0373938_0000206_1504_2529 324
399 3300035088 Ga0373940_0004281 Ga0373940_0004281_1411_2436 324
400 3300035091 Ga0373951_0000641 Ga0373951_0000641_7355_8380 324
401 3300035092 Ga0373952_0001452 Ga0373952_0001452_2720_3745 324
402 3300035112 Ga0373932_0000234 Ga0373932_0000234_9384_10409 324
403 3300035114 Ga0373939_0005279 Ga0373939_0005279_1056_2081 324
404 3300035115 Ga0373941_0062316 Ga0373941_0062316_52_1083 324
405 3300035117 Ga0373953_0013204 Ga0373953_0013204_1341_2369 324
406 3300035121 Ga0373960_0002502 Ga0373960_0002502_2091_3116 324
407 3300035172 Ga0373955_0012509 Ga0373955_0012509_2111_3139 324
408 3300035207 Ga0373942_0001609 Ga0373942_0001609_1530_2555 324
409 3300035241 Ga0373961_0002109 Ga0373961_0002109_1637_2662 324
410 3300035242 Ga0373962_0001193 Ga0373962_0001193_3940_4965 324
411 3300035398 Ga0316574_0015849 Ga0316574_0015849_2013_3110 324
412 3300035691 Ga0373931_0073623 Ga0373931_0073623_173_1198 324
413 3300036401 Ga0373937_0053969 Ga0373937_0053969_654_1682 324
414 3300037068 Ga0373925_0023117 Ga0373925_0023117_777_1865 324
415 3300037471 Ga0395905_0063962 Ga0395905_0063962_2295_3344 324
416 3300038443 Ga0395901_0153141 Ga0395901_0153141_975_2024 324
417 3300044712 Ga0453684_0176258 Ga0453684_0176258_1439_2464 324
418 3300045051 Ga0451576_0023088 Ga0451576_0023088_4971_5996 324
419 3300046455 Ga0495603_0080888 Ga0495603_0080888_619_1647 324
420 3300046536 Ga0495587_0031898 Ga0495587_0031898_1149_2177 324
421 3300046543 Ga0495645_0004379 Ga0495645_0004379_7903_8931 324
422 3300046683 Ga0495658_0017715 Ga0495658_0017715_1603_2631 324
423 3300047322 Ga0495680_0222783 Ga0495680_0222783_87_1115 324
424 3300047471 Ga0495684_0248807 Ga0495684_0248807_165_1193 324
425 3300048905 Ga0496102_0024057 Ga0496102_0024057_3322_4347 324
426 3300048906 Ga0496103_0233712 Ga0496103_0233712_101_1129 324
427 3300048907 Ga0496104_0010445 Ga0496104_0010445_5139_6167 324
428 3300048909 Ga0496106_0053746 Ga0496106_0053746_1687_2715 324
429 3300048909 Ga0496106_0119168 Ga0496106_0119168_73_1098 324
430 3300048911 Ga0496108_0009031 Ga0496108_0009031_1166_2194 324
431 3300048915 Ga0496112_0042253 Ga0496112_0042253_3167_4195 324
432 3300048916 Ga0496113_0011834 Ga0496113_0011834_2966_3994 324
433 3300048916 Ga0496113_0091689 Ga0496113_0091689_1127_2155 324
434 3300048917 Ga0496114_0037531 Ga0496114_0037531_1124_2152 324
435 3300048917 Ga0496114_0144573 Ga0496114_0144573_587_1615 324
436 3300048917 Ga0496114_0157004 Ga0496114_0157004_88_1116 324
437 3300050507 nmdc:mga05p37_107836_c1 nmdc:mga05p37_107836_c1_1608_2633 324
438 3300050507 nmdc:mga05p37_17722_c1 nmdc:mga05p37_17722_c1_104_1132 324
439 3300050507 nmdc:mga05p37_666142_c1 nmdc:mga05p37_666142_c1_119_1150 324
440 3300050507 nmdc:mga05p37_862_c1 nmdc:mga05p37_862_c1_9622_10650 324
441 3300050512 nmdc:mga0n895_8027_c1 nmdc:mga0n895_8027_c1_190_1215 324
442 3300050513 nmdc:mga0rr50_10927_c1 nmdc:mga0rr50_10927_c1_3164_4192 324
443 3300050513 nmdc:mga0rr50_3354_c1 nmdc:mga0rr50_3354_c1_2619_3644 324
444 3300050513 nmdc:mga0rr50_50816_c1 nmdc:mga0rr50_50816_c1_313_1338 324
445 3300050514 nmdc:mga08x19_13456_c1 nmdc:mga08x19_13456_c1_1427_2452 324
446 3300050515 nmdc:mga0a205_23731_c1 nmdc:mga0a205_23731_c1_655_1683 324
447 3300050515 nmdc:mga0a205_42525_c1 nmdc:mga0a205_42525_c1_1755_2780 324
448 3300053077 Ga0495601_0016947 Ga0495601_0016947_1639_2667 324
449 3300053085 Ga0495619_0179524 Ga0495619_0179524_402_1430 324
450 3300061734 Ga0530510_0218125 Ga0530510_0218125_323_1354 324
451 3300005444 Ga0070694_100240019 Ga0070694_1002400192 325
452 3300005445 Ga0070708_100094405 Ga0070708_1000944054 325
453 3300005518 Ga0070699_100001741 Ga0070699_1000017416 325
454 3300005536 Ga0070697_100012093 Ga0070697_1000120934 325
455 3300005546 Ga0070696_100078406 Ga0070696_1000784063 325
456 3300005617 Ga0068859_100519076 Ga0068859_1005190762 325
457 3300006844 Ga0075428_100053120 Ga0075428_1000531204 325
458 3300006846 Ga0075430_100068786 Ga0075430_1000687863 325
459 3300006847 Ga0075431_100054782 Ga0075431_1000547823 325
460 3300006852 Ga0075433_10009354 Ga0075433_100093548 325
461 3300006852 Ga0075433_10031005 Ga0075433_100310055 325
462 3300006871 Ga0075434_100219667 Ga0075434_1002196672 325
463 3300006880 Ga0075429_100026975 Ga0075429_1000269753 325
464 3300006880 Ga0075429_100110824 Ga0075429_1001108243 325
465 3300006931 Ga0097620_100519094 Ga0097620_1005190942 325
466 3300009147 Ga0114129_10100951 Ga0114129_101009513 325
467 3300009147 Ga0114129_10317226 Ga0114129_103172263 325
468 3300025919 Ga0207657_10155214 Ga0207657_101552142 325
469 3300031548 Ga0307408_100024853 Ga0307408_1000248535 325
470 3300032002 Ga0307416_100042740 Ga0307416_1000427403 325
471 3300050507 nmdc:mga05p37_205700_c1 nmdc:mga05p37_205700_c1_771_1811 325
472 3300050508 nmdc:mga09592_228159_c1 nmdc:mga09592_228159_c1_258_1301 325
473 3300050512 nmdc:mga0n895_78605_c1 nmdc:mga0n895_78605_c1_1188_2228 325
474 3300050515 nmdc:mga0a205_12408_c1 nmdc:mga0a205_12408_c1_3614_4654 325
475 3300050515 nmdc:mga0a205_895_c1 nmdc:mga0a205_895_c1_15198_16232 325
476 3300061734 Ga0530510_0208465 Ga0530510_0208465_379_1425 325
477 3300005441 Ga0070700_100005861 Ga0070700_1000058613 326
478 3300005445 Ga0070708_100094591 Ga0070708_1000945911 326
479 3300005471 Ga0070698_100236197 Ga0070698_1002361972 326
480 3300005535 Ga0070684_100046615 Ga0070684_1000466152 326
481 3300005546 Ga0070696_100039506 Ga0070696_1000395064 326
482 3300005549 Ga0070704_100043264 Ga0070704_1000432643 326
483 3300006844 Ga0075428_100249476 Ga0075428_1002494762 326
484 3300006880 Ga0075429_100001793 Ga0075429_1000017937 326
485 3300006914 Ga0075436_100065946 Ga0075436_1000659462 326
486 3300009094 Ga0111539_10008974 Ga0111539_100089749 326
487 3300009147 Ga0114129_10008029 Ga0114129_1000802911 326
488 3300009148 Ga0105243_10016738 Ga0105243_100167386 326
489 3300009176 Ga0105242_10006162 Ga0105242_100061626 326
490 3300013297 Ga0157378_10061725 Ga0157378_100617252 326
491 3300025972 Ga0207668_10093678 Ga0207668_100936782 326
492 3300026075 Ga0207708_10061594 Ga0207708_100615943 326
493 3300026088 Ga0207641_10033710 Ga0207641_100337104 326
494 3300027671 Ga0209588_1009645 Ga0209588_10096453 326
495 3300027907 Ga0207428_10148430 Ga0207428_101484302 326
496 3300031901 Ga0307406_10116504 Ga0307406_101165042 326
497 3300048905 Ga0496102_0232581 Ga0496102_0232581_427_1506 326
498 3300049588 Ga0501072_0220639 Ga0501072_0220639_155_1195 326
499 3300050507 nmdc:mga05p37_88173_c1 nmdc:mga05p37_88173_c1_173_1216 326
500 3300050508 nmdc:mga09592_33850_c1 nmdc:mga09592_33850_c1_1915_2958 326
501 3300050511 nmdc:mga08y16_29427_c1 nmdc:mga08y16_29427_c1_2610_3653 326
502 3300050512 nmdc:mga0n895_5572_c1 nmdc:mga0n895_5572_c1_6358_7404 326
503 3300005347 Ga0070668_100034892 Ga0070668_1000348924 327
504 3300005353 Ga0070669_100002755 Ga0070669_10000275510 327
505 3300005457 Ga0070662_100104757 Ga0070662_1001047572 327
506 3300005467 Ga0070706_100057489 Ga0070706_1000574894 327
507 3300005468 Ga0070707_100027866 Ga0070707_1000278664 327
508 3300005518 Ga0070699_100200134 Ga0070699_1002001341 327
509 3300005543 Ga0070672_100054067 Ga0070672_1000540673 327
510 3300005549 Ga0070704_100205617 Ga0070704_1002056172 327
511 3300005719 Ga0068861_100176541 Ga0068861_1001765413 327
512 3300005843 Ga0068860_100104122 Ga0068860_1001041223 327
513 3300006871 Ga0075434_100113208 Ga0075434_1001132083 327
514 3300006880 Ga0075429_100189347 Ga0075429_1001893472 327
515 3300007076 Ga0075435_100005683 Ga0075435_1000056833 327
516 3300009094 Ga0111539_10007648 Ga0111539_100076488 327
517 3300009147 Ga0114129_10013395 Ga0114129_100133952 327
518 3300009174 Ga0105241_10067794 Ga0105241_100677943 327
519 3300013297 Ga0157378_10081633 Ga0157378_100816332 327
520 3300013306 Ga0163162_10024603 Ga0163162_100246035 327
521 3300025910 Ga0207684_10049280 Ga0207684_100492803 327
522 3300025911 Ga0207654_10039930 Ga0207654_100399302 327
523 3300025922 Ga0207646_10027112 Ga0207646_100271125 327
524 3300025923 Ga0207681_10014404 Ga0207681_100144047 327
525 3300025933 Ga0207706_10049930 Ga0207706_100499303 327
526 3300025935 Ga0207709_10086400 Ga0207709_100864002 327
527 3300025940 Ga0207691_10066559 Ga0207691_100665593 327
528 3300025972 Ga0207668_10014274 Ga0207668_100142744 327
529 3300026118 Ga0207675_100027101 Ga0207675_1000271013 327
530 3300027907 Ga0207428_10012663 Ga0207428_100126633 327
531 3300028381 Ga0268264_10068923 Ga0268264_100689232 327
532 3300046528 Ga0495642_0016591 Ga0495642_0016591_1495_2547 327
533 3300046684 Ga0495669_0046440 Ga0495669_0046440_172_1224 327
534 3300047318 Ga0495636_0024339 Ga0495636_0024339_679_1725 327
535 3300049578 Ga0501042_0093360 Ga0501042_0093360_957_2003 327
536 3300049588 Ga0501072_0003099 Ga0501072_0003099_10775_11830 327
537 3300049591 Ga0501075_0011581 Ga0501075_0011581_1358_2413 327
538 3300049591 Ga0501075_0125389 Ga0501075_0125389_619_1662 327
539 3300049593 Ga0501077_0007562 Ga0501077_0007562_3696_4751 327
540 3300049593 Ga0501077_0019750 Ga0501077_0019750_836_1882 327
541 3300049741 Ga0501079_0005322 Ga0501079_0005322_2741_3796 327
542 3300049741 Ga0501079_0127723 Ga0501079_0127723_35_1081 327
543 3300049824 Ga0501045_0046036 Ga0501045_0046036_1481_2536 327
544 3300050507 nmdc:mga05p37_22487_c1 nmdc:mga05p37_22487_c1_893_1948 327
545 3300050507 nmdc:mga05p37_2722_c1 nmdc:mga05p37_2722_c1_16112_17200 327
546 3300050507 nmdc:mga05p37_585174_c1 nmdc:mga05p37_585174_c1_111_1166 327
547 3300050508 nmdc:mga09592_10352_c1 nmdc:mga09592_10352_c1_2977_4032 327
548 3300050508 nmdc:mga09592_144871_c1 nmdc:mga09592_144871_c1_348_1415 327
549 3300050508 nmdc:mga09592_3602_c1 nmdc:mga09592_3602_c1_1021_2109 327
550 3300050509 nmdc:mga0qj67_125057_c1 nmdc:mga0qj67_125057_c1_826_1881 327
551 3300050509 nmdc:mga0qj67_20948_c1 nmdc:mga0qj67_20948_c1_206_1294 327
552 3300050510 nmdc:mga06r32_141901_c1 nmdc:mga06r32_141901_c1_68_1123 327
553 3300050511 nmdc:mga08y16_1957_c1 nmdc:mga08y16_1957_c1_16863_17918 327
554 3300050512 nmdc:mga0n895_13064_c1 nmdc:mga0n895_13064_c1_1653_2774 327
555 3300050513 nmdc:mga0rr50_3069_c1 nmdc:mga0rr50_3069_c1_6950_7993 327
556 3300050515 nmdc:mga0a205_4763_c1 nmdc:mga0a205_4763_c1_1118_2239 327
557 3300050515 nmdc:mga0a205_48996_c1 nmdc:mga0a205_48996_c1_157_1209 327
558 3300054114 Ga0501084_0006427 Ga0501084_0006427_4869_5924 327
559 3300060353 Ga0501082_0007387 Ga0501082_0007387_7229_8284 327
560 3300061734 Ga0530510_0057884 Ga0530510_0057884_656_1702 327
561 3300061734 Ga0530510_0118286 Ga0530510_0118286_325_1371 327
562 3300005293 Ga0065715_10208653 Ga0065715_102086532 328
563 3300005328 Ga0070676_10000920 Ga0070676_1000092010 328
564 3300005329 Ga0070683_100056652 Ga0070683_1000566525 328
565 3300005334 Ga0068869_100006522 Ga0068869_1000065224 328
566 3300005336 Ga0070680_100004576 Ga0070680_1000045768 328
567 3300005337 Ga0070682_100005442 Ga0070682_1000054425 328
568 3300005338 Ga0068868_100089220 Ga0068868_1000892203 328
569 3300005339 Ga0070660_100000332 Ga0070660_10000033230 328
570 3300005340 Ga0070689_100058703 Ga0070689_1000587034 328
571 3300005343 Ga0070687_100010610 Ga0070687_1000106104 328
572 3300005344 Ga0070661_100009598 Ga0070661_1000095982 328
573 3300005345 Ga0070692_10002146 Ga0070692_100021463 328
574 3300005353 Ga0070669_100032732 Ga0070669_1000327324 328
575 3300005354 Ga0070675_100209221 Ga0070675_1002092211 328
576 3300005366 Ga0070659_100001428 Ga0070659_10000142810 328
577 3300005406 Ga0070703_10007460 Ga0070703_100074602 328
578 3300005434 Ga0070709_10026406 Ga0070709_100264064 328
579 3300005438 Ga0070701_10041825 Ga0070701_100418253 328
580 3300005440 Ga0070705_100000542 Ga0070705_10000054210 328
581 3300005444 Ga0070694_100000839 Ga0070694_10000083910 328
582 3300005444 Ga0070694_100003904 Ga0070694_1000039048 328
583 3300005445 Ga0070708_100028783 Ga0070708_1000287836 328
584 3300005445 Ga0070708_100036585 Ga0070708_1000365852 328
585 3300005445 Ga0070708_100271637 Ga0070708_1002716371 328
586 3300005445 Ga0070708_100306122 Ga0070708_1003061222 328
587 3300005455 Ga0070663_100002069 Ga0070663_1000020692 328
588 3300005457 Ga0070662_100009230 Ga0070662_1000092305 328
589 3300005457 Ga0070662_100115885 Ga0070662_1001158852 328
590 3300005458 Ga0070681_10018854 Ga0070681_100188545 328
591 3300005459 Ga0068867_100000884 Ga0068867_10000088412 328
592 3300005467 Ga0070706_100010113 Ga0070706_10001011310 328
593 3300005467 Ga0070706_100024833 Ga0070706_1000248335 328
594 3300005467 Ga0070706_100036412 Ga0070706_1000364125 328
595 3300005468 Ga0070707_100007265 Ga0070707_1000072656 328
596 3300005468 Ga0070707_100032051 Ga0070707_1000320512 328
597 3300005468 Ga0070707_100098450 Ga0070707_1000984503 328
598 3300005468 Ga0070707_100142874 Ga0070707_1001428741 328
599 3300005471 Ga0070698_100014079 Ga0070698_1000140795 328
600 3300005471 Ga0070698_100063516 Ga0070698_1000635164 328
601 3300005518 Ga0070699_100009282 Ga0070699_1000092827 328
602 3300005518 Ga0070699_100022694 Ga0070699_1000226943 328
603 3300005518 Ga0070699_100028105 Ga0070699_1000281055 328
604 3300005518 Ga0070699_100119845 Ga0070699_1001198452 328
605 3300005530 Ga0070679_100000895 Ga0070679_10000089514 328
606 3300005535 Ga0070684_100046493 Ga0070684_1000464932 328
607 3300005536 Ga0070697_100031758 Ga0070697_1000317583 328
608 3300005536 Ga0070697_100154827 Ga0070697_1001548272 328
609 3300005536 Ga0070697_100161285 Ga0070697_1001612853 328
610 3300005539 Ga0068853_100002471 Ga0068853_1000024716 328
611 3300005545 Ga0070695_100004819 Ga0070695_1000048198 328
612 3300005546 Ga0070696_100008767 Ga0070696_1000087675 328
613 3300005547 Ga0070693_100001933 Ga0070693_1000019335 328
614 3300005549 Ga0070704_100000570 Ga0070704_1000005708 328
615 3300005615 Ga0070702_100151707 Ga0070702_1001517071 328
616 3300005841 Ga0068863_100018065 Ga0068863_1000180655 328
617 3300005843 Ga0068860_100199773 Ga0068860_1001997732 328
618 3300005981 Ga0081538_10013563 Ga0081538_100135635 328
619 3300005983 Ga0081540_1015632 Ga0081540_10156325 328
620 3300006173 Ga0070716_100035601 Ga0070716_1000356014 328
621 3300006175 Ga0070712_100013158 Ga0070712_1000131585 328
622 3300006358 Ga0068871_100195523 Ga0068871_1001955232 328
623 3300006844 Ga0075428_100105380 Ga0075428_1001053802 328
624 3300006844 Ga0075428_100189129 Ga0075428_1001891292 328
625 3300006847 Ga0075431_100225077 Ga0075431_1002250773 328
626 3300006847 Ga0075431_100306812 Ga0075431_1003068122 328
627 3300006847 Ga0075431_100315366 Ga0075431_1003153662 328
628 3300006852 Ga0075433_10002435 Ga0075433_100024354 328
629 3300006852 Ga0075433_10011237 Ga0075433_100112376 328
630 3300006852 Ga0075433_10124271 Ga0075433_101242712 328
631 3300006871 Ga0075434_100005150 Ga0075434_1000051506 328
632 3300006871 Ga0075434_100109296 Ga0075434_1001092962 328
633 3300006880 Ga0075429_100027715 Ga0075429_1000277154 328
634 3300007076 Ga0075435_100039378 Ga0075435_1000393783 328
635 3300009094 Ga0111539_10000370 Ga0111539_100003704 328
636 3300009094 Ga0111539_10064712 Ga0111539_100647126 328
637 3300009174 Ga0105241_10000218 Ga0105241_100002185 328
638 3300009176 Ga0105242_10143429 Ga0105242_101434292 328
639 3300009177 Ga0105248_10056969 Ga0105248_100569695 328
640 3300009545 Ga0105237_10250382 Ga0105237_102503822 328
641 3300009553 Ga0105249_10261067 Ga0105249_102610673 328
642 3300011119 Ga0105246_10235698 Ga0105246_102356982 328
643 3300013100 Ga0157373_10000381 Ga0157373_1000038111 328
644 3300013102 Ga0157371_10057611 Ga0157371_100576113 328
645 3300013105 Ga0157369_10021069 Ga0157369_100210696 328
646 3300013307 Ga0157372_10001479 Ga0157372_1000147912 328
647 3300014326 Ga0157380_10293427 Ga0157380_102934272 328
648 3300015262 Ga0182007_10044034 Ga0182007_100440343 328
649 3300025885 Ga0207653_10003610 Ga0207653_100036104 328
650 3300025906 Ga0207699_10075166 Ga0207699_100751663 328
651 3300025910 Ga0207684_10010713 Ga0207684_100107137 328
652 3300025910 Ga0207684_10051693 Ga0207684_100516934 328
653 3300025915 Ga0207693_10001303 Ga0207693_100013037 328
654 3300025918 Ga0207662_10090015 Ga0207662_100900152 328
655 3300025922 Ga0207646_10019790 Ga0207646_100197907 328
656 3300025922 Ga0207646_10026953 Ga0207646_100269535 328
657 3300025922 Ga0207646_10046844 Ga0207646_100468443 328
658 3300025922 Ga0207646_10050438 Ga0207646_100504382 328
659 3300025922 Ga0207646_10093447 Ga0207646_100934473 328
660 3300025922 Ga0207646_10100232 Ga0207646_101002322 328
661 3300025923 Ga0207681_10152090 Ga0207681_101520902 328
662 3300025933 Ga0207706_10187620 Ga0207706_101876203 328
663 3300025939 Ga0207665_10003678 Ga0207665_100036786 328
664 3300025941 Ga0207711_10254341 Ga0207711_102543412 328
665 3300025961 Ga0207712_10100038 Ga0207712_101000382 328
666 3300026075 Ga0207708_10064125 Ga0207708_100641253 328
667 3300026088 Ga0207641_10207415 Ga0207641_102074153 328
668 3300026116 Ga0207674_10142947 Ga0207674_101429474 328
669 3300027907 Ga0207428_10000409 Ga0207428_1000040945 328
670 3300028381 Ga0268264_10176655 Ga0268264_101766552 328
671 3300035088 Ga0373940_0006109 Ga0373940_0006109_723_1757 328
672 3300035092 Ga0373952_0016411 Ga0373952_0016411_426_1460 328
673 3300035241 Ga0373961_0013563 Ga0373961_0013563_730_1764 328
674 3300038996 Ga0242420_010870 Ga0242420_010870_321_1355 328
675 3300042005 Ga0439448_0003645 Ga0439448_0003645_1467_2501 328
676 3300042876 Ga0451577_0003197 Ga0451577_0003197_12721_13755 328
677 3300042876 Ga0451577_0023850 Ga0451577_0023850_1837_2871 328
678 3300042876 Ga0451577_0134764 Ga0451577_0134764_1046_2080 328
679 3300044673 Ga0453683_0071848 Ga0453683_0071848_441_1475 328
680 3300044673 Ga0453683_0105022 Ga0453683_0105022_20_1054 328
681 3300044712 Ga0453684_0015160 Ga0453684_0015160_3916_4950 328
682 3300045051 Ga0451576_0013787 Ga0451576_0013787_6622_7656 328
683 3300045051 Ga0451576_0019829 Ga0451576_0019829_4505_5539 328
684 3300045051 Ga0451576_0052940 Ga0451576_0052940_1460_2494 328
685 3300045051 Ga0451576_0175287 Ga0451576_0175287_377_1411 328
686 3300045051 Ga0451576_0251356 Ga0451576_0251356_41_1075 328
687 3300045051 Ga0451576_0336528 Ga0451576_0336528_258_1292 328
688 3300045051 Ga0451576_0473711 Ga0451576_0473711_160_1194 328
689 3300046472 Ga0495580_0146187 Ga0495580_0146187_417_1451 328
690 3300046472 Ga0495580_0287762 Ga0495580_0287762_56_1090 328
691 3300048905 Ga0496102_0053609 Ga0496102_0053609_799_1833 328
692 3300048912 Ga0496109_0159420 Ga0496109_0159420_484_1518 328
693 3300049577 Ga0501041_0176975 Ga0501041_0176975_140_1177 328
694 3300049588 Ga0501072_0104005 Ga0501072_0104005_186_1220 328
695 3300049588 Ga0501072_0166474 Ga0501072_0166474_441_1475 328
696 3300049591 Ga0501075_0050577 Ga0501075_0050577_1020_2054 328
697 3300049591 Ga0501075_0107835 Ga0501075_0107835_276_1310 328
698 3300049591 Ga0501075_0132683 Ga0501075_0132683_678_1712 328
699 3300049741 Ga0501079_0008589 Ga0501079_0008589_4631_5668 328
700 3300049741 Ga0501079_0290961 Ga0501079_0290961_207_1241 328
701 3300049742 Ga0501080_0187909 Ga0501080_0187909_575_1609 328
702 3300049743 Ga0501081_0126500 Ga0501081_0126500_226_1263 328
703 3300049743 Ga0501081_0155350 Ga0501081_0155350_293_1327 328
704 3300049824 Ga0501045_0088616 Ga0501045_0088616_552_1589 328
705 3300050507 nmdc:mga05p37_148317_c1 nmdc:mga05p37_148317_c1_1381_2415 328
706 3300050508 nmdc:mga09592_91120_c1 nmdc:mga09592_91120_c1_333_1367 328
707 3300050510 nmdc:mga06r32_76307_c1 nmdc:mga06r32_76307_c1_506_1543 328
708 3300050511 nmdc:mga08y16_11942_c1 nmdc:mga08y16_11942_c1_5557_6591 328
709 3300050511 nmdc:mga08y16_563076_c1 nmdc:mga08y16_563076_c1_11_1045 328
710 3300050512 nmdc:mga0n895_12611_c1 nmdc:mga0n895_12611_c1_4466_5500 328
711 3300050512 nmdc:mga0n895_44658_c1 nmdc:mga0n895_44658_c1_589_1623 328
712 3300050514 nmdc:mga08x19_2391_c1 nmdc:mga08x19_2391_c1_8969_10003 328
713 3300050515 nmdc:mga0a205_342204_c1 nmdc:mga0a205_342204_c1_112_1146 328
714 3300050515 nmdc:mga0a205_46561_c1 nmdc:mga0a205_46561_c1_1052_2086 328
715 3300050515 nmdc:mga0a205_49897_c1 nmdc:mga0a205_49897_c1_1976_3010 328
716 3300050515 nmdc:mga0a205_5150_c1 nmdc:mga0a205_5150_c1_576_1610 328
717 3300054114 Ga0501084_0013112 Ga0501084_0013112_4826_5863 328
718 3300054114 Ga0501084_0316864 Ga0501084_0316864_49_1083 328
719 3300061734 Ga0530510_0068811 Ga0530510_0068811_562_1596 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05496

RuvB_N

Holliday junction DNA helicase RuvB P-loop domain

41

199

0.99

PF17864

AAA_lid_4

RuvB AAA lid domain

202

275

0.99

PF05491

RuvB_C

RuvB C-terminal winged helix domain

276

347

0.98

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

76

201

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o5v-assembly1.cif.gz_A crystal structure of t. acidophilum ider 0.8425 249 312
1g3s-assembly1.cif.gz_A cys102ser dtxr 0.8286 247 310
2dtr-assembly1.cif.gz_A-2 structure of diphtheria toxin repressor 0.8285 249 312
3glx-assembly1.cif.gz_A-2 crystal structure analysis of the dtxr(e175k) complexed with ni(ii) 0.8278 249 312
2qqa-assembly1.cif.gz_A-2 crystal structure of dtxr(e9a c102d) complexed with nickel(ii) 0.8204 249 307
ID Description Score Start End Superfamily
6blbA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9835 184 246 1.10.8.60
1in5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9738 247 316 1.10.10.10
6blbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9735 24 183 3.40.50.300
3pfiB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9615 27 184 3.40.50.300
1hqcB03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9582 249 317 1.10.10.10
ID Description Score Start End GO Terms
AF-X0WPH5-F1-model_v4 RuvB C-terminal winged helix domain-containing protein 0.9932 248 318 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7Y2ISW1-F1-model_v4 AAA family ATPase 0.9928 29 138 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A6G2DWS7-F1-model_v4 AAA family ATPase 0.9905 31 137 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A661LGM7-F1-model_v4 Holliday junction branch migration DNA helicase RuvB 0.9902 249 317 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-X1G2L0-F1-model_v4 AAA+ ATPase domain-containing protein 0.9894 42 203 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.04 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map