F477241
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 399 | 1438 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300021377|Ga0213874_10019925|Ga0213874_100199252 |
| Length | 374 |
| Sequence | MPDAAAFQTSGAPIEFIDLGAQRRRLGPRVDEAILRVVDHGKYIMGPEVAVFEQELAAFCGAKHVLSCANGTDALGLALMAKGIKPGQAVLVPSFTFAATAEVVAWFDAVPVFVDVLEHTFNMDPVSLEAGIATAKRLGVEPAGIIPVDLFGLPAEYDEILAIAAAHRLWVICDAAQSFGASYKRRNIGTIGDITTTSFFPAKPLGCYGDGLKSLRVHGQGADKYDNVRIGMNARLDTIQAAILSEKLTVFADEIKARNQVAARYESALEEVVAVPTMPTGITSVWAQYTVRLPDGRDRDAVAASLKASGVPTAVYYAKPLHRQLAYRHYPTAGNGLPVSDRLASEVLSLPMHPYLEEGTQNHIVAALRASLRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 71 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 99 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 289 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 290 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 293 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 294 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 324 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 328 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 329 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 331 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 334 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 335 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 338 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 343 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 347 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 351 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 352 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 353 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 354 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 355 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 356 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 357 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 358 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 359 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 360 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 361 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 362 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 363 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 364 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 365 | 2791355199 | |||
| 366 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 367 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 368 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 369 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 370 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 371 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 372 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 373 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 374 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 375 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 376 | 2904699407 | |||
| 377 | 2906610324 | |||
| 378 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 379 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 380 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 381 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 382 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 383 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 384 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 385 | 2922425934 | |||
| 386 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 387 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 388 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 389 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 390 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 391 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 392 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 393 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 394 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 395 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 396 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 397 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 398 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 399 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.71 |
| Metatranscriptomes | 0 |
| Isolates | 6.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.34 |
| Nodule | 5.15 |
| Rhizoplane | 9.18 |
| Rhizosphere | 67.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213874_10019925 | 3300021377 | Bacteria | 1833 |
| 2 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 3 | JGI25153J46596_10000519 | 3300003215 | Bacteria | 24283 |
| 4 | JGI25160J50197_1019531 | 3300003354 | Bacteria | 2074 |
| 5 | JGI25404J52841_10016926 | 3300003659 | Bacteria | 1581 |
| 6 | JGI25404J52841_10021716 | 3300003659 | Bacteria | 1390 |
| 7 | Ga0070683_100006136 | 3300005329 | Bacteria | 10075 |
| 8 | Ga0070683_100217251 | 3300005329 | Bacteria | 1817 |
| 9 | Ga0070666_10043945 | 3300005335 | Bacteria | 2992 |
| 10 | Ga0070680_100013457 | 3300005336 | Bacteria | 6372 |
| 11 | Ga0070680_100043545 | 3300005336 | Bacteria | 3647 |
| 12 | Ga0070682_100043517 | 3300005337 | Bacteria | 2777 |
| 13 | Ga0068868_100090617 | 3300005338 | Bacteria | 2463 |
| 14 | Ga0070660_100038487 | 3300005339 | Bacteria | 3631 |
| 15 | Ga0070691_10014147 | 3300005341 | Bacteria | 3659 |
| 16 | Ga0070687_100111124 | 3300005343 | Bacteria | 1551 |
| 17 | Ga0070661_100055612 | 3300005344 | Bacteria | 2897 |
| 18 | Ga0070671_100058008 | 3300005355 | Bacteria | 3223 |
| 19 | Ga0070674_100065770 | 3300005356 | Bacteria | 2546 |
| 20 | Ga0070673_100101955 | 3300005364 | Bacteria | 2365 |
| 21 | Ga0070688_100016782 | 3300005365 | Bacteria | 4192 |
| 22 | Ga0070709_10002624 | 3300005434 | Bacteria | 9710 |
| 23 | Ga0070709_10004205 | 3300005434 | Bacteria | 7761 |
| 24 | Ga0070709_10020944 | 3300005434 | Bacteria | 3804 |
| 25 | Ga0070714_100006438 | 3300005435 | Bacteria | 9068 |
| 26 | Ga0070714_100177659 | 3300005435 | Bacteria | 1935 |
| 27 | Ga0070713_100002174 | 3300005436 | Bacteria | 12691 |
| 28 | Ga0070713_100016056 | 3300005436 | Bacteria | 5622 |
| 29 | Ga0070710_10002118 | 3300005437 | Bacteria | 9403 |
| 30 | Ga0070710_10054923 | 3300005437 | Bacteria | 2248 |
| 31 | Ga0070711_100002093 | 3300005439 | Bacteria | 11285 |
| 32 | Ga0070711_100004807 | 3300005439 | Bacteria | 8012 |
| 33 | Ga0070711_100010964 | 3300005439 | Bacteria | 5619 |
| 34 | Ga0070711_100047992 | 3300005439 | Bacteria | 2917 |
| 35 | Ga0070711_100135021 | 3300005439 | Bacteria | 1843 |
| 36 | Ga0070711_100202760 | 3300005439 | Bacteria | 1532 |
| 37 | Ga0070700_100142124 | 3300005441 | Bacteria | 1633 |
| 38 | Ga0070663_100059600 | 3300005455 | Bacteria | 2743 |
| 39 | Ga0070663_100256409 | 3300005455 | Bacteria | 1386 |
| 40 | Ga0070663_100279380 | 3300005455 | Bacteria | 1330 |
| 41 | Ga0070678_100101106 | 3300005456 | Bacteria | 2234 |
| 42 | Ga0070681_10065840 | 3300005458 | Bacteria | 3592 |
| 43 | Ga0070681_10119737 | 3300005458 | Bacteria | 2568 |
| 44 | Ga0070681_10188057 | 3300005458 | Bacteria | 1985 |
| 45 | Ga0070681_10196067 | 3300005458 | Bacteria | 1938 |
| 46 | Ga0068867_100113070 | 3300005459 | Bacteria | 2088 |
| 47 | Ga0070685_10003228 | 3300005466 | Bacteria | 8293 |
| 48 | Ga0070699_100374584 | 3300005518 | Bacteria | 1285 |
| 49 | Ga0070679_100017653 | 3300005530 | Bacteria | 6908 |
| 50 | Ga0070679_100022942 | 3300005530 | Bacteria | 6104 |
| 51 | Ga0070679_100091642 | 3300005530 | Bacteria | 3027 |
| 52 | Ga0070679_100108285 | 3300005530 | Bacteria | 2765 |
| 53 | Ga0070684_100006435 | 3300005535 | Bacteria | 9087 |
| 54 | Ga0070684_100035774 | 3300005535 | Bacteria | 4252 |
| 55 | Ga0070684_100138959 | 3300005535 | Bacteria | 2196 |
| 56 | Ga0070697_100040282 | 3300005536 | Bacteria | 3779 |
| 57 | Ga0068853_100002914 | 3300005539 | Bacteria | 13010 |
| 58 | Ga0068853_100006819 | 3300005539 | Bacteria | 9105 |
| 59 | Ga0068853_100091570 | 3300005539 | Bacteria | 2674 |
| 60 | Ga0068853_100305882 | 3300005539 | Bacteria | 1471 |
| 61 | Ga0070665_100016672 | 3300005548 | Bacteria | 7362 |
| 62 | Ga0070665_100071645 | 3300005548 | Bacteria | 3472 |
| 63 | Ga0070665_100099361 | 3300005548 | Bacteria | 2914 |
| 64 | Ga0070665_100120217 | 3300005548 | Bacteria | 2629 |
| 65 | Ga0070665_100189362 | 3300005548 | Bacteria | 2058 |
| 66 | Ga0070665_100203829 | 3300005548 | Bacteria | 1978 |
| 67 | Ga0068855_100005255 | 3300005563 | Bacteria | 15804 |
| 68 | Ga0068855_100056353 | 3300005563 | Bacteria | 4612 |
| 69 | Ga0068855_100082669 | 3300005563 | Bacteria | 3722 |
| 70 | Ga0068855_100139097 | 3300005563 | Bacteria | 2769 |
| 71 | Ga0068855_100461813 | 3300005563 | Bacteria | 1384 |
| 72 | Ga0070664_100168205 | 3300005564 | Bacteria | 1943 |
| 73 | Ga0068857_100013640 | 3300005577 | Bacteria | 7081 |
| 74 | Ga0068857_100019936 | 3300005577 | Bacteria | 5894 |
| 75 | Ga0068857_100037481 | 3300005577 | Bacteria | 4295 |
| 76 | Ga0068857_100142559 | 3300005577 | Bacteria | 2166 |
| 77 | Ga0068854_100018641 | 3300005578 | Bacteria | 4662 |
| 78 | Ga0068854_100057520 | 3300005578 | Bacteria | 2805 |
| 79 | Ga0068854_100161294 | 3300005578 | Bacteria | 1737 |
| 80 | Ga0068856_100000780 | 3300005614 | Bacteria | 34542 |
| 81 | Ga0068856_100037538 | 3300005614 | Bacteria | 4753 |
| 82 | Ga0068856_100066700 | 3300005614 | Bacteria | 3556 |
| 83 | Ga0068856_100078653 | 3300005614 | Bacteria | 3270 |
| 84 | Ga0068856_100151694 | 3300005614 | Bacteria | 2326 |
| 85 | Ga0068856_100175382 | 3300005614 | Bacteria | 2156 |
| 86 | Ga0070702_100102067 | 3300005615 | Bacteria | 1762 |
| 87 | Ga0068852_100082378 | 3300005616 | Bacteria | 2859 |
| 88 | Ga0068859_100022405 | 3300005617 | Bacteria | 6333 |
| 89 | Ga0068859_100109449 | 3300005617 | Bacteria | 2824 |
| 90 | Ga0068859_100281555 | 3300005617 | Bacteria | 1756 |
| 91 | Ga0068864_100018659 | 3300005618 | Bacteria | 5797 |
| 92 | Ga0068864_100042951 | 3300005618 | Bacteria | 3869 |
| 93 | Ga0068861_100146091 | 3300005719 | Bacteria | 1935 |
| 94 | Ga0068851_10011796 | 3300005834 | Bacteria | 4105 |
| 95 | Ga0068863_100074960 | 3300005841 | Bacteria | 3201 |
| 96 | Ga0068858_100077967 | 3300005842 | Bacteria | 3078 |
| 97 | Ga0068858_100087053 | 3300005842 | Bacteria | 2905 |
| 98 | Ga0068858_100149898 | 3300005842 | Bacteria | 2192 |
| 99 | Ga0068860_100000724 | 3300005843 | Bacteria | 37558 |
| 100 | Ga0068860_100068602 | 3300005843 | Bacteria | 3369 |
| 101 | Ga0068862_100138149 | 3300005844 | Bacteria | 2161 |
| 102 | Ga0068862_100244939 | 3300005844 | Bacteria | 1631 |
| 103 | Ga0081455_10009713 | 3300005937 | Bacteria | 9865 |
| 104 | Ga0081455_10010696 | 3300005937 | Bacteria | 9281 |
| 105 | Ga0081455_10020391 | 3300005937 | Bacteria | 6242 |
| 106 | Ga0081455_10040417 | 3300005937 | Bacteria | 4112 |
| 107 | Ga0081455_10102682 | 3300005937 | Bacteria | 2292 |
| 108 | Ga0081538_10046730 | 3300005981 | Bacteria | 2665 |
| 109 | Ga0081540_1000311 | 3300005983 | Bacteria | 50309 |
| 110 | Ga0081540_1003511 | 3300005983 | Bacteria | 12375 |
| 111 | Ga0081540_1006842 | 3300005983 | Bacteria | 8232 |
| 112 | Ga0081540_1011723 | 3300005983 | Bacteria | 5835 |
| 113 | Ga0081540_1025394 | 3300005983 | Bacteria | 3410 |
| 114 | Ga0081540_1025638 | 3300005983 | Bacteria | 3387 |
| 115 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 116 | Ga0081539_10087741 | 3300005985 | Bacteria | 1615 |
| 117 | Ga0070717_10000145 | 3300006028 | Bacteria | 52677 |
| 118 | Ga0070717_10071051 | 3300006028 | Bacteria | 2902 |
| 119 | Ga0070717_10177938 | 3300006028 | Bacteria | 1853 |
| 120 | Ga0075365_10004996 | 3300006038 | Bacteria | 7101 |
| 121 | Ga0075365_10010461 | 3300006038 | Bacteria | 5405 |
| 122 | Ga0075365_10042958 | 3300006038 | Bacteria | 2957 |
| 123 | Ga0075363_100029350 | 3300006048 | Bacteria | 2838 |
| 124 | Ga0075364_10049922 | 3300006051 | Bacteria | 2729 |
| 125 | Ga0070715_10000518 | 3300006163 | Bacteria | 10086 |
| 126 | Ga0070715_10002065 | 3300006163 | Bacteria | 6058 |
| 127 | Ga0070716_100001181 | 3300006173 | Bacteria | 11493 |
| 128 | Ga0070716_100004753 | 3300006173 | Bacteria | 6515 |
| 129 | Ga0070716_100056915 | 3300006173 | Bacteria | 2245 |
| 130 | Ga0070716_100149426 | 3300006173 | Bacteria | 1501 |
| 131 | Ga0070712_100003369 | 3300006175 | Bacteria | 9825 |
| 132 | Ga0070712_100005502 | 3300006175 | Bacteria | 7844 |
| 133 | Ga0070712_100056388 | 3300006175 | Bacteria | 2756 |
| 134 | Ga0070712_100148768 | 3300006175 | Bacteria | 1795 |
| 135 | Ga0075367_10012781 | 3300006178 | Bacteria | 4492 |
| 136 | Ga0075367_10127186 | 3300006178 | Bacteria | 1573 |
| 137 | Ga0075369_10027992 | 3300006186 | Bacteria | 2360 |
| 138 | Ga0097621_100014688 | 3300006237 | Bacteria | 5868 |
| 139 | Ga0075430_100031338 | 3300006846 | Bacteria | 4513 |
| 140 | Ga0075434_100018371 | 3300006871 | Bacteria | 6754 |
| 141 | Ga0075434_100186318 | 3300006871 | Bacteria | 2096 |
| 142 | Ga0075434_100212097 | 3300006871 | Bacteria | 1956 |
| 143 | Ga0068865_100021154 | 3300006881 | Bacteria | 4228 |
| 144 | Ga0075436_100179352 | 3300006914 | Bacteria | 1497 |
| 145 | Ga0097620_100022408 | 3300006931 | Bacteria | 6333 |
| 146 | Ga0097620_100109447 | 3300006931 | Bacteria | 2824 |
| 147 | Ga0097620_100281553 | 3300006931 | Bacteria | 1756 |
| 148 | Ga0099824_1012951 | 3300006942 | Bacteria | 8862 |
| 149 | Ga0099822_1022362 | 3300006943 | Bacteria | 5978 |
| 150 | Ga0075435_100088878 | 3300007076 | Bacteria | 2547 |
| 151 | Ga0099794_10067435 | 3300007265 | Bacteria | 1748 |
| 152 | Ga0099795_10012669 | 3300007788 | Bacteria | 2565 |
| 153 | Ga0105251_10039996 | 3300009011 | Bacteria | 2288 |
| 154 | Ga0105240_10022376 | 3300009093 | Bacteria | 8381 |
| 155 | Ga0105240_10024287 | 3300009093 | Bacteria | 7996 |
| 156 | Ga0105240_10038576 | 3300009093 | Bacteria | 6125 |
| 157 | Ga0105240_10340122 | 3300009093 | Bacteria | 1705 |
| 158 | Ga0105245_10145518 | 3300009098 | Bacteria | 2236 |
| 159 | Ga0105245_10305752 | 3300009098 | Bacteria | 1562 |
| 160 | Ga0105241_10052392 | 3300009174 | Bacteria | 3115 |
| 161 | Ga0105242_10048793 | 3300009176 | Bacteria | 3442 |
| 162 | Ga0105237_10084725 | 3300009545 | Bacteria | 3160 |
| 163 | Ga0105238_10005212 | 3300009551 | Bacteria | 12844 |
| 164 | Ga0105238_10062381 | 3300009551 | Bacteria | 3728 |
| 165 | Ga0099796_10000366 | 3300010159 | Bacteria | 7370 |
| 166 | Ga0105239_10006165 | 3300010375 | Bacteria | 13952 |
| 167 | Ga0105239_10009620 | 3300010375 | Bacteria | 10875 |
| 168 | Ga0105239_10034348 | 3300010375 | Bacteria | 5568 |
| 169 | Ga0105239_10411898 | 3300010375 | Bacteria | 1530 |
| 170 | Ga0105246_10013898 | 3300011119 | Bacteria | 5053 |
| 171 | Ga0105246_10201093 | 3300011119 | Bacteria | 1549 |
| 172 | Ga0157370_10097003 | 3300013104 | Bacteria | 2765 |
| 173 | Ga0157370_10104462 | 3300013104 | Bacteria | 2652 |
| 174 | Ga0157370_10120555 | 3300013104 | Bacteria | 2449 |
| 175 | Ga0157370_10164459 | 3300013104 | Bacteria | 2064 |
| 176 | Ga0157369_10007176 | 3300013105 | Bacteria | 12838 |
| 177 | Ga0157369_10009052 | 3300013105 | Bacteria | 11400 |
| 178 | Ga0157369_10014447 | 3300013105 | Bacteria | 8914 |
| 179 | Ga0157369_10041320 | 3300013105 | Bacteria | 5034 |
| 180 | Ga0157374_10036899 | 3300013296 | Bacteria | 4480 |
| 181 | Ga0157374_10095736 | 3300013296 | Bacteria | 2839 |
| 182 | Ga0157374_10196900 | 3300013296 | Bacteria | 1972 |
| 183 | Ga0157374_10399976 | 3300013296 | Bacteria | 1370 |
| 184 | Ga0157378_10006607 | 3300013297 | Bacteria | 10129 |
| 185 | Ga0163162_10114061 | 3300013306 | Bacteria | 2801 |
| 186 | Ga0157372_10151184 | 3300013307 | Bacteria | 2680 |
| 187 | Ga0157375_10073723 | 3300013308 | Bacteria | 3433 |
| 188 | Ga0163163_10096259 | 3300014325 | Bacteria | 2980 |
| 189 | Ga0163163_10166436 | 3300014325 | Bacteria | 2251 |
| 190 | Ga0163163_10265921 | 3300014325 | Bacteria | 1766 |
| 191 | Ga0163163_10334529 | 3300014325 | Bacteria | 1569 |
| 192 | Ga0157380_10146888 | 3300014326 | Bacteria | 2033 |
| 193 | Ga0157377_10030319 | 3300014745 | Bacteria | 2929 |
| 194 | Ga0157377_10183548 | 3300014745 | Bacteria | 1317 |
| 195 | Ga0157376_10027176 | 3300014969 | Bacteria | 4533 |
| 196 | Ga0163161_10032886 | 3300017792 | Bacteria | 3705 |
| 197 | Ga0213875_10000361 | 3300021388 | Bacteria | 42326 |
| 198 | Ga0213875_10000707 | 3300021388 | Bacteria | 25641 |
| 199 | Ga0213871_10005669 | 3300021441 | Bacteria | 2593 |
| 200 | Ga0209677_106517 | 3300025253 | Bacteria | 2742 |
| 201 | Ga0209233_1005956 | 3300025261 | Bacteria | 3989 |
| 202 | Ga0209564_1000468 | 3300025295 | Bacteria | 67696 |
| 203 | Ga0209758_1002244 | 3300025297 | Bacteria | 20051 |
| 204 | Ga0209758_1003548 | 3300025297 | Bacteria | 14034 |
| 205 | Ga0207656_10037349 | 3300025321 | Bacteria | 2043 |
| 206 | Ga0207653_10011019 | 3300025885 | Bacteria | 2823 |
| 207 | Ga0207692_10000559 | 3300025898 | Bacteria | 13246 |
| 208 | Ga0207692_10001804 | 3300025898 | Bacteria | 8121 |
| 209 | Ga0207710_10038563 | 3300025900 | Bacteria | 2113 |
| 210 | Ga0207680_10033605 | 3300025903 | Bacteria | 2927 |
| 211 | Ga0207647_10005540 | 3300025904 | Bacteria | 9241 |
| 212 | Ga0207685_10018857 | 3300025905 | Bacteria | 2262 |
| 213 | Ga0207699_10002006 | 3300025906 | Bacteria | 9614 |
| 214 | Ga0207699_10010283 | 3300025906 | Bacteria | 4690 |
| 215 | Ga0207699_10101472 | 3300025906 | Bacteria | 1827 |
| 216 | Ga0207645_10057321 | 3300025907 | Bacteria | 2487 |
| 217 | Ga0207654_10000941 | 3300025911 | Bacteria | 15998 |
| 218 | Ga0207707_10001221 | 3300025912 | Bacteria | 24149 |
| 219 | Ga0207707_10008851 | 3300025912 | Bacteria | 8743 |
| 220 | Ga0207707_10024670 | 3300025912 | Bacteria | 5262 |
| 221 | Ga0207707_10079231 | 3300025912 | Bacteria | 2868 |
| 222 | Ga0207695_10001321 | 3300025913 | Bacteria | 42037 |
| 223 | Ga0207695_10390338 | 3300025913 | Bacteria | 1277 |
| 224 | Ga0207671_10194508 | 3300025914 | Bacteria | 1582 |
| 225 | Ga0207693_10000587 | 3300025915 | Bacteria | 32588 |
| 226 | Ga0207693_10003437 | 3300025915 | Bacteria | 13514 |
| 227 | Ga0207693_10009341 | 3300025915 | Bacteria | 7995 |
| 228 | Ga0207693_10038531 | 3300025915 | Bacteria | 3764 |
| 229 | Ga0207693_10324369 | 3300025915 | Bacteria | 1205 |
| 230 | Ga0207663_10000147 | 3300025916 | Bacteria | 32518 |
| 231 | Ga0207663_10009185 | 3300025916 | Bacteria | 5213 |
| 232 | Ga0207663_10021463 | 3300025916 | Bacteria | 3677 |
| 233 | Ga0207663_10105274 | 3300025916 | Bacteria | 1904 |
| 234 | Ga0207663_10112273 | 3300025916 | Bacteria | 1851 |
| 235 | Ga0207660_10011742 | 3300025917 | Bacteria | 5711 |
| 236 | Ga0207662_10031980 | 3300025918 | Bacteria | 3059 |
| 237 | Ga0207657_10001936 | 3300025919 | Bacteria | 22360 |
| 238 | Ga0207657_10159700 | 3300025919 | Bacteria | 1831 |
| 239 | Ga0207652_10011278 | 3300025921 | Bacteria | 7200 |
| 240 | Ga0207652_10125870 | 3300025921 | Bacteria | 2282 |
| 241 | Ga0207652_10226643 | 3300025921 | Bacteria | 1684 |
| 242 | Ga0207694_10000135 | 3300025924 | Bacteria | 75715 |
| 243 | Ga0207694_10040401 | 3300025924 | Bacteria | 3591 |
| 244 | Ga0207687_10174235 | 3300025927 | Bacteria | 1662 |
| 245 | Ga0207700_10003851 | 3300025928 | Bacteria | 8771 |
| 246 | Ga0207700_10004315 | 3300025928 | Bacteria | 8361 |
| 247 | Ga0207700_10008644 | 3300025928 | Bacteria | 6323 |
| 248 | Ga0207700_10117143 | 3300025928 | Bacteria | 2153 |
| 249 | Ga0207700_10220680 | 3300025928 | Bacteria | 1607 |
| 250 | Ga0207664_10004039 | 3300025929 | Bacteria | 9893 |
| 251 | Ga0207664_10150204 | 3300025929 | Bacteria | 1978 |
| 252 | Ga0207644_10008140 | 3300025931 | Bacteria | 6868 |
| 253 | Ga0207690_10110677 | 3300025932 | Bacteria | 1978 |
| 254 | Ga0207706_10104170 | 3300025933 | Bacteria | 2496 |
| 255 | Ga0207706_10130180 | 3300025933 | Bacteria | 2213 |
| 256 | Ga0207709_10231068 | 3300025935 | Bacteria | 1340 |
| 257 | Ga0207670_10021810 | 3300025936 | Bacteria | 3957 |
| 258 | Ga0207670_10076584 | 3300025936 | Bacteria | 2328 |
| 259 | Ga0207669_10033658 | 3300025937 | Bacteria | 2895 |
| 260 | Ga0207665_10000265 | 3300025939 | Bacteria | 36482 |
| 261 | Ga0207665_10000868 | 3300025939 | Bacteria | 20427 |
| 262 | Ga0207665_10019708 | 3300025939 | Bacteria | 4433 |
| 263 | Ga0207665_10024757 | 3300025939 | Bacteria | 3959 |
| 264 | Ga0207665_10131249 | 3300025939 | Bacteria | 1779 |
| 265 | Ga0207691_10047301 | 3300025940 | Bacteria | 3948 |
| 266 | Ga0207691_10313070 | 3300025940 | Bacteria | 1347 |
| 267 | Ga0207711_10007436 | 3300025941 | Bacteria | 9168 |
| 268 | Ga0207689_10143669 | 3300025942 | Bacteria | 1966 |
| 269 | Ga0207661_10001701 | 3300025944 | Bacteria | 15009 |
| 270 | Ga0207661_10010680 | 3300025944 | Bacteria | 6616 |
| 271 | Ga0207661_10099691 | 3300025944 | Bacteria | 2437 |
| 272 | Ga0207661_10214549 | 3300025944 | Bacteria | 1698 |
| 273 | Ga0207679_10071264 | 3300025945 | Bacteria | 2621 |
| 274 | Ga0207667_10027192 | 3300025949 | Bacteria | 6234 |
| 275 | Ga0207667_10089554 | 3300025949 | Bacteria | 3180 |
| 276 | Ga0207667_10194455 | 3300025949 | Bacteria | 2081 |
| 277 | Ga0207667_10469160 | 3300025949 | Bacteria | 1278 |
| 278 | Ga0207668_10024726 | 3300025972 | Bacteria | 3880 |
| 279 | Ga0207668_10167798 | 3300025972 | Bacteria | 1718 |
| 280 | Ga0207640_10050659 | 3300025981 | Bacteria | 2696 |
| 281 | Ga0207640_10135616 | 3300025981 | Bacteria | 1786 |
| 282 | Ga0207677_10060095 | 3300026023 | Bacteria | 2625 |
| 283 | Ga0207677_10131688 | 3300026023 | Bacteria | 1900 |
| 284 | Ga0207703_10034995 | 3300026035 | Bacteria | 3990 |
| 285 | Ga0207703_10039027 | 3300026035 | Bacteria | 3793 |
| 286 | Ga0207703_10211074 | 3300026035 | Bacteria | 1731 |
| 287 | Ga0207703_10216815 | 3300026035 | Bacteria | 1709 |
| 288 | Ga0207639_10181025 | 3300026041 | Bacteria | 1793 |
| 289 | Ga0207678_10019160 | 3300026067 | Bacteria | 6007 |
| 290 | Ga0207678_10020831 | 3300026067 | Bacteria | 5746 |
| 291 | Ga0207678_10073828 | 3300026067 | Bacteria | 2923 |
| 292 | Ga0207678_10240879 | 3300026067 | Bacteria | 1549 |
| 293 | Ga0207708_10030112 | 3300026075 | Bacteria | 4117 |
| 294 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 295 | Ga0207702_10000334 | 3300026078 | Bacteria | 54042 |
| 296 | Ga0207702_10100878 | 3300026078 | Bacteria | 2548 |
| 297 | Ga0207702_10272074 | 3300026078 | Bacteria | 1598 |
| 298 | Ga0207648_10031210 | 3300026089 | Bacteria | 4711 |
| 299 | Ga0207648_10039811 | 3300026089 | Bacteria | 4131 |
| 300 | Ga0207676_10079317 | 3300026095 | Bacteria | 2662 |
| 301 | Ga0207676_10146806 | 3300026095 | Bacteria | 2026 |
| 302 | Ga0207674_10011940 | 3300026116 | Bacteria | 9737 |
| 303 | Ga0207674_10082105 | 3300026116 | Bacteria | 3225 |
| 304 | Ga0207674_10134043 | 3300026116 | Bacteria | 2440 |
| 305 | Ga0207674_10212892 | 3300026116 | Bacteria | 1881 |
| 306 | Ga0207675_100174465 | 3300026118 | Bacteria | 2056 |
| 307 | Ga0207683_10038657 | 3300026121 | Bacteria | 4161 |
| 308 | Ga0207683_10267012 | 3300026121 | Bacteria | 1563 |
| 309 | Ga0207698_10079102 | 3300026142 | Bacteria | 2643 |
| 310 | Ga0207698_10287174 | 3300026142 | Bacteria | 1525 |
| 311 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 312 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 313 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 314 | Ga0209813_10049293 | 3300027866 | Bacteria | 1310 |
| 315 | Ga0268266_10012789 | 3300028379 | Bacteria | 7250 |
| 316 | Ga0268266_10022968 | 3300028379 | Bacteria | 5308 |
| 317 | Ga0268266_10026743 | 3300028379 | Bacteria | 4909 |
| 318 | Ga0268266_10107150 | 3300028379 | Bacteria | 2471 |
| 319 | Ga0268266_10136244 | 3300028379 | Bacteria | 2199 |
| 320 | Ga0268265_10433400 | 3300028380 | Bacteria | 1223 |
| 321 | Ga0268264_10000096 | 3300028381 | Bacteria | 230188 |
| 322 | Ga0265334_10003786 | 3300028573 | Bacteria | 6837 |
| 323 | Ga0265318_10019074 | 3300028577 | Bacteria | 2785 |
| 324 | Ga0265323_10000913 | 3300028653 | Bacteria | 15574 |
| 325 | Ga0265322_10001611 | 3300028654 | Bacteria | 7210 |
| 326 | Ga0265336_10000099 | 3300028666 | Bacteria | 66151 |
| 327 | Ga0307517_10000315 | 3300028786 | Bacteria | 84020 |
| 328 | Ga0307515_10053148 | 3300028794 | Bacteria | 5985 |
| 329 | Ga0307515_10198845 | 3300028794 | Bacteria | 1887 |
| 330 | Ga0265338_10000207 | 3300028800 | Bacteria | 110193 |
| 331 | Ga0265324_10001958 | 3300029957 | Bacteria | 11041 |
| 332 | Ga0265330_10091349 | 3300031235 | Bacteria | 1307 |
| 333 | Ga0265332_10000585 | 3300031238 | Bacteria | 24067 |
| 334 | Ga0265332_10013242 | 3300031238 | Bacteria | 3658 |
| 335 | Ga0265325_10000053 | 3300031241 | Bacteria | 77918 |
| 336 | Ga0265325_10115871 | 3300031241 | Bacteria | 1297 |
| 337 | Ga0265329_10013050 | 3300031242 | Bacteria | 2971 |
| 338 | Ga0265340_10047489 | 3300031247 | Bacteria | 2090 |
| 339 | Ga0265339_10001532 | 3300031249 | Bacteria | 17061 |
| 340 | Ga0265339_10010735 | 3300031249 | Bacteria | 5673 |
| 341 | Ga0265339_10041311 | 3300031249 | Bacteria | 2561 |
| 342 | Ga0265316_10029807 | 3300031344 | Bacteria | 4481 |
| 343 | Ga0265316_10158991 | 3300031344 | Bacteria | 1690 |
| 344 | Ga0307408_100033037 | 3300031548 | Bacteria | 3612 |
| 345 | Ga0265313_10017522 | 3300031595 | Bacteria | 4066 |
| 346 | Ga0307508_10021406 | 3300031616 | Bacteria | 5879 |
| 347 | Ga0307508_10081646 | 3300031616 | Bacteria | 2814 |
| 348 | Ga0265314_10003384 | 3300031711 | Bacteria | 15458 |
| 349 | Ga0265314_10017116 | 3300031711 | Bacteria | 5699 |
| 350 | Ga0265342_10001010 | 3300031712 | Bacteria | 27698 |
| 351 | Ga0307516_10007232 | 3300031730 | Bacteria | 12792 |
| 352 | Ga0307516_10013179 | 3300031730 | Bacteria | 8828 |
| 353 | Ga0307410_10173541 | 3300031852 | Bacteria | 1627 |
| 354 | Ga0307510_10008253 | 3300033180 | Bacteria | 12409 |
| 355 | Ga0315911_1000014 | 3300033442 | Bacteria | 207605 |
| 356 | Ga0373926_0022692 | 3300035083 | Bacteria | 2177 |
| 357 | Ga0373934_0012159 | 3300035086 | Bacteria | 3248 |
| 358 | Ga0373923_0042724 | 3300035111 | Bacteria | 1873 |
| 359 | Ga0373923_0124773 | 3300035111 | Bacteria | 1153 |
| 360 | Ga0373936_0059185 | 3300035113 | Bacteria | 1561 |
| 361 | Ga0373953_0036895 | 3300035117 | Bacteria | 1926 |
| 362 | Ga0373954_0041365 | 3300035118 | Bacteria | 2149 |
| 363 | Ga0373956_0004737 | 3300035119 | Bacteria | 5443 |
| 364 | Ga0373956_0007387 | 3300035119 | Bacteria | 4423 |
| 365 | Ga0373943_0080077 | 3300035170 | Bacteria | 1673 |
| 366 | Ga0373955_0006675 | 3300035172 | Bacteria | 5264 |
| 367 | Ga0373955_0013779 | 3300035172 | Bacteria | 3920 |
| 368 | Ga0373955_0027666 | 3300035172 | Bacteria | 2934 |
| 369 | Ga0373942_0013749 | 3300035207 | Bacteria | 1951 |
| 370 | Ga0373961_0001489 | 3300035241 | Bacteria | 6855 |
| 371 | Ga0373924_0013117 | 3300035410 | Bacteria | 3109 |
| 372 | Ga0373931_0020616 | 3300035691 | Bacteria | 3300 |
| 373 | Ga0373935_0002078 | 3300035692 | Bacteria | 11354 |
| 374 | Ga0373935_0162045 | 3300035692 | Bacteria | 1525 |
| 375 | Ga0373927_0003925 | 3300035695 | Bacteria | 10542 |
| 376 | Ga0373927_0027376 | 3300035695 | Bacteria | 3722 |
| 377 | Ga0373927_0042386 | 3300035695 | Bacteria | 2948 |
| 378 | Ga0373927_0058259 | 3300035695 | Bacteria | 2498 |
| 379 | Ga0373927_0168961 | 3300035695 | Bacteria | 1433 |
| 380 | Ga0373933_0000020 | 3300035724 | Bacteria | 97124 |
| 381 | Ga0373933_0005055 | 3300035724 | Bacteria | 7197 |
| 382 | Ga0373933_0015421 | 3300035724 | Bacteria | 4258 |
| 383 | Ga0373933_0089742 | 3300035724 | Bacteria | 1895 |
| 384 | Ga0373947_0004109 | 3300035725 | Bacteria | 8559 |
| 385 | Ga0373947_0016136 | 3300035725 | Bacteria | 4292 |
| 386 | Ga0373937_0113505 | 3300036401 | Bacteria | 2521 |
| 387 | Ga0373925_0008691 | 3300037068 | Bacteria | 7398 |
| 388 | Ga0373925_0029927 | 3300037068 | Bacteria | 3994 |
| 389 | Ga0373925_0071012 | 3300037068 | Bacteria | 2633 |
| 390 | Ga0373925_0081602 | 3300037068 | Bacteria | 2459 |
| 391 | Ga0373925_0164504 | 3300037068 | Bacteria | 1749 |
| 392 | Ga0395900_0118079 | 3300037418 | Bacteria | 2722 |
| 393 | Ga0395900_0119806 | 3300037418 | Bacteria | 2701 |
| 394 | Ga0395898_0013618 | 3300037466 | Bacteria | 8369 |
| 395 | Ga0395898_0023411 | 3300037466 | Bacteria | 6242 |
| 396 | Ga0395898_0188151 | 3300037466 | Bacteria | 1973 |
| 397 | Ga0395905_0201734 | 3300037471 | Bacteria | 1865 |
| 398 | Ga0395905_0250688 | 3300037471 | Bacteria | 1654 |
| 399 | Ga0395905_0290347 | 3300037471 | Bacteria | 1522 |
| 400 | Ga0436364_0717863 | 3300037853 | Bacteria | 145182 |
| 401 | Ga0436364_1385478 | 3300037853 | Bacteria | 81069 |
| 402 | Ga0395901_0112639 | 3300038443 | Bacteria | 2857 |
| 403 | Ga0436365_0833193 | 3300039437 | Bacteria | 2395 |
| 404 | Ga0436365_0944955 | 3300039437 | Bacteria | 12493 |
| 405 | Ga0436365_1148872 | 3300039437 | Bacteria | 1963 |
| 406 | Ga0436360_0304485 | 3300039438 | Bacteria | 1858 |
| 407 | Ga0436360_0597135 | 3300039438 | Bacteria | 1667 |
| 408 | Ga0436361_1068668 | 3300039447 | Bacteria | 2293 |
| 409 | Ga0436363_0034386 | 3300039450 | Bacteria | 2265 |
| 410 | Ga0436362_0367954 | 3300039453 | Bacteria | 3746 |
| 411 | Ga0436362_0881328 | 3300039453 | Bacteria | 2093 |
| 412 | Ga0436362_1098843 | 3300039453 | Bacteria | 1904 |
| 413 | Ga0451853_0587007 | 3300041512 | Bacteria | 1605 |
| 414 | Ga0466966_0020722 | 3300044684 | Bacteria | 4321 |
| 415 | Ga0466963_0118604 | 3300044694 | Bacteria | 1820 |
| 416 | Ga0466957_0056724 | 3300044842 | Bacteria | 2396 |
| 417 | Ga0466959_0191967 | 3300045049 | Bacteria | 1425 |
| 418 | Ga0466958_0159871 | 3300045836 | Bacteria | 1423 |
| 419 | Ga0495592_0027096 | 3300046454 | Bacteria | 4344 |
| 420 | Ga0495592_0182465 | 3300046454 | Bacteria | 1428 |
| 421 | Ga0495603_0007969 | 3300046455 | Bacteria | 6393 |
| 422 | Ga0495603_0011811 | 3300046455 | Bacteria | 5284 |
| 423 | Ga0495629_0000466 | 3300046459 | Bacteria | 33891 |
| 424 | Ga0495629_0012059 | 3300046459 | Bacteria | 6265 |
| 425 | Ga0495629_0044521 | 3300046459 | Bacteria | 3114 |
| 426 | Ga0495638_0011966 | 3300046460 | Bacteria | 5965 |
| 427 | Ga0495638_0096681 | 3300046460 | Bacteria | 1772 |
| 428 | Ga0495641_0044847 | 3300046461 | Bacteria | 2038 |
| 429 | Ga0495641_0052409 | 3300046461 | Bacteria | 1860 |
| 430 | Ga0495651_0015966 | 3300046462 | Bacteria | 5816 |
| 431 | Ga0495653_0067068 | 3300046463 | Bacteria | 2696 |
| 432 | Ga0495582_0030311 | 3300046473 | Bacteria | 2969 |
| 433 | Ga0495582_0032892 | 3300046473 | Bacteria | 2850 |
| 434 | Ga0495639_0007911 | 3300046475 | Bacteria | 4569 |
| 435 | Ga0495639_0118438 | 3300046475 | Bacteria | 1262 |
| 436 | Ga0495662_0015796 | 3300046476 | Bacteria | 3663 |
| 437 | Ga0495664_0015534 | 3300046477 | Bacteria | 4329 |
| 438 | Ga0495664_0021335 | 3300046477 | Bacteria | 3741 |
| 439 | Ga0495584_0144741 | 3300046491 | Bacteria | 1207 |
| 440 | Ga0495594_0037330 | 3300046499 | Bacteria | 2650 |
| 441 | Ga0495596_0061496 | 3300046500 | Bacteria | 1462 |
| 442 | Ga0495606_0005211 | 3300046507 | Bacteria | 12548 |
| 443 | Ga0495606_0066821 | 3300046507 | Bacteria | 2279 |
| 444 | Ga0495608_0010573 | 3300046511 | Bacteria | 6438 |
| 445 | Ga0495618_0008064 | 3300046514 | Bacteria | 6376 |
| 446 | Ga0495618_0048697 | 3300046514 | Bacteria | 2676 |
| 447 | Ga0495618_0126615 | 3300046514 | Bacteria | 1636 |
| 448 | Ga0495620_0033987 | 3300046515 | Bacteria | 2309 |
| 449 | Ga0495643_0051314 | 3300046522 | Bacteria | 2219 |
| 450 | Ga0495644_0061352 | 3300046523 | Bacteria | 1413 |
| 451 | Ga0495648_0005947 | 3300046524 | Bacteria | 10041 |
| 452 | Ga0495666_0096924 | 3300046526 | Bacteria | 1390 |
| 453 | Ga0495652_0073214 | 3300046529 | Bacteria | 2853 |
| 454 | Ga0495665_0011670 | 3300046531 | Bacteria | 4760 |
| 455 | Ga0495586_0053894 | 3300046535 | Bacteria | 2179 |
| 456 | Ga0495586_0109562 | 3300046535 | Bacteria | 1536 |
| 457 | Ga0495587_0012527 | 3300046536 | Bacteria | 5333 |
| 458 | Ga0495597_0115967 | 3300046542 | Bacteria | 1120 |
| 459 | Ga0495645_0163837 | 3300046543 | Bacteria | 1535 |
| 460 | Ga0495622_0043219 | 3300046557 | Bacteria | 2095 |
| 461 | Ga0495667_0091389 | 3300046559 | Bacteria | 1971 |
| 462 | Ga0495634_0020776 | 3300046642 | Bacteria | 4651 |
| 463 | Ga0495625_0127786 | 3300046660 | Bacteria | 1724 |
| 464 | Ga0495625_0144430 | 3300046660 | Bacteria | 1603 |
| 465 | Ga0495625_0156820 | 3300046660 | Bacteria | 1527 |
| 466 | Ga0495661_0052512 | 3300046665 | Bacteria | 2456 |
| 467 | Ga0495588_0041197 | 3300046674 | Bacteria | 2358 |
| 468 | Ga0495588_0049500 | 3300046674 | Bacteria | 2161 |
| 469 | Ga0495588_0099240 | 3300046674 | Bacteria | 1529 |
| 470 | Ga0495599_0035060 | 3300046678 | Bacteria | 3150 |
| 471 | Ga0495623_0049716 | 3300046679 | Bacteria | 2656 |
| 472 | Ga0495647_0003525 | 3300046681 | Bacteria | 5011 |
| 473 | Ga0495658_0002587 | 3300046683 | Bacteria | 9101 |
| 474 | Ga0495613_0175298 | 3300046689 | Bacteria | 1520 |
| 475 | Ga0495624_0003820 | 3300046690 | Bacteria | 11134 |
| 476 | Ga0495670_0009827 | 3300046691 | Bacteria | 4704 |
| 477 | Ga0495660_0072680 | 3300046810 | Bacteria | 1821 |
| 478 | Ga0495604_0056974 | 3300047317 | Bacteria | 3005 |
| 479 | Ga0495604_0247504 | 3300047317 | Bacteria | 1216 |
| 480 | Ga0495674_0046907 | 3300047319 | Bacteria | 3833 |
| 481 | Ga0495672_0025049 | 3300047320 | Bacteria | 3828 |
| 482 | Ga0495672_0058436 | 3300047320 | Bacteria | 2235 |
| 483 | Ga0495680_0033039 | 3300047322 | Bacteria | 4193 |
| 484 | Ga0495680_0043678 | 3300047322 | Bacteria | 3547 |
| 485 | Ga0495680_0251688 | 3300047322 | Bacteria | 1252 |
| 486 | Ga0495675_0009663 | 3300047444 | Bacteria | 6009 |
| 487 | Ga0495684_0008560 | 3300047471 | Bacteria | 7922 |
| 488 | Ga0495684_0009161 | 3300047471 | Bacteria | 7644 |
| 489 | Ga0495684_0053690 | 3300047471 | Bacteria | 3075 |
| 490 | Ga0495686_0061190 | 3300047472 | Bacteria | 2339 |
| 491 | Ga0495593_0053109 | 3300047673 | Bacteria | 2139 |
| 492 | Ga0495602_0032475 | 3300048088 | Bacteria | 4913 |
| 493 | Ga0495615_0021322 | 3300048090 | Bacteria | 1461 |
| 494 | Ga0496100_0047657 | 3300048903 | Bacteria | 2763 |
| 495 | Ga0496100_0065357 | 3300048903 | Bacteria | 2410 |
| 496 | Ga0496100_0068985 | 3300048903 | Bacteria | 2353 |
| 497 | Ga0496101_0084652 | 3300048904 | Bacteria | 2349 |
| 498 | Ga0496102_0039922 | 3300048905 | Bacteria | 4243 |
| 499 | Ga0496103_0052470 | 3300048906 | Bacteria | 2526 |
| 500 | Ga0496103_0063854 | 3300048906 | Bacteria | 2294 |
| 501 | Ga0496104_0000117 | 3300048907 | Bacteria | 74244 |
| 502 | Ga0496104_0007504 | 3300048907 | Bacteria | 9644 |
| 503 | Ga0496104_0049526 | 3300048907 | Bacteria | 3961 |
| 504 | Ga0496104_0122500 | 3300048907 | Bacteria | 2496 |
| 505 | Ga0496104_0319680 | 3300048907 | Bacteria | 1465 |
| 506 | Ga0496105_0000094 | 3300048908 | Bacteria | 61105 |
| 507 | Ga0496105_0004442 | 3300048908 | Bacteria | 10558 |
| 508 | Ga0496105_0005994 | 3300048908 | Bacteria | 9281 |
| 509 | Ga0496105_0023954 | 3300048908 | Bacteria | 4958 |
| 510 | Ga0496105_0078970 | 3300048908 | Bacteria | 2717 |
| 511 | Ga0496105_0086676 | 3300048908 | Bacteria | 2587 |
| 512 | Ga0496105_0091132 | 3300048908 | Bacteria | 2518 |
| 513 | Ga0496105_0214679 | 3300048908 | Bacteria | 1567 |
| 514 | Ga0496105_0281198 | 3300048908 | Bacteria | 1342 |
| 515 | Ga0496106_0014603 | 3300048909 | Bacteria | 5803 |
| 516 | Ga0496106_0018567 | 3300048909 | Bacteria | 5146 |
| 517 | Ga0496106_0044268 | 3300048909 | Bacteria | 3341 |
| 518 | Ga0496107_0004733 | 3300048910 | Bacteria | 9246 |
| 519 | Ga0496107_0021996 | 3300048910 | Bacteria | 4504 |
| 520 | Ga0496107_0033711 | 3300048910 | Bacteria | 3665 |
| 521 | Ga0496108_0020079 | 3300048911 | Bacteria | 5490 |
| 522 | Ga0496108_0037147 | 3300048911 | Bacteria | 4056 |
| 523 | Ga0496108_0042427 | 3300048911 | Bacteria | 3797 |
| 524 | Ga0496108_0129337 | 3300048911 | Bacteria | 2170 |
| 525 | Ga0496108_0278206 | 3300048911 | Bacteria | 1457 |
| 526 | Ga0496109_0018926 | 3300048912 | Bacteria | 6062 |
| 527 | Ga0496109_0027629 | 3300048912 | Bacteria | 5069 |
| 528 | Ga0496109_0118438 | 3300048912 | Bacteria | 2465 |
| 529 | Ga0496109_0130914 | 3300048912 | Bacteria | 2341 |
| 530 | Ga0496110_0005325 | 3300048913 | Bacteria | 10075 |
| 531 | Ga0496110_0012396 | 3300048913 | Bacteria | 7009 |
| 532 | Ga0496110_0024628 | 3300048913 | Bacteria | 5132 |
| 533 | Ga0496110_0195436 | 3300048913 | Bacteria | 1837 |
| 534 | Ga0496110_0197556 | 3300048913 | Bacteria | 1827 |
| 535 | Ga0496110_0215241 | 3300048913 | Bacteria | 1747 |
| 536 | Ga0496111_0009567 | 3300048914 | Bacteria | 6476 |
| 537 | Ga0496111_0024061 | 3300048914 | Bacteria | 4283 |
| 538 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 539 | Ga0496112_0013508 | 3300048915 | Bacteria | 7542 |
| 540 | Ga0496112_0014948 | 3300048915 | Bacteria | 7224 |
| 541 | Ga0496112_0017925 | 3300048915 | Bacteria | 6662 |
| 542 | Ga0496112_0040156 | 3300048915 | Bacteria | 4575 |
| 543 | Ga0496112_0055672 | 3300048915 | Bacteria | 3890 |
| 544 | Ga0496112_0178655 | 3300048915 | Bacteria | 2086 |
| 545 | Ga0496113_0005488 | 3300048916 | Bacteria | 7913 |
| 546 | Ga0496113_0012948 | 3300048916 | Bacteria | 5626 |
| 547 | Ga0496113_0017879 | 3300048916 | Bacteria | 4928 |
| 548 | Ga0496113_0064750 | 3300048916 | Bacteria | 2765 |
| 549 | Ga0496113_0104678 | 3300048916 | Bacteria | 2196 |
| 550 | Ga0496113_0115606 | 3300048916 | Bacteria | 2093 |
| 551 | Ga0496114_0029771 | 3300048917 | Bacteria | 4488 |
| 552 | Ga0496114_0067418 | 3300048917 | Bacteria | 3002 |
| 553 | Ga0496114_0250670 | 3300048917 | Bacteria | 1558 |
| 554 | Ga0496115_0002098 | 3300048918 | Bacteria | 14267 |
| 555 | Ga0496115_0024242 | 3300048918 | Bacteria | 4713 |
| 556 | Ga0496115_0065265 | 3300048918 | Bacteria | 2940 |
| 557 | Ga0496115_0172525 | 3300048918 | Bacteria | 1788 |
| 558 | Ga0496116_0002352 | 3300048919 | Bacteria | 19981 |
| 559 | Ga0496117_0038666 | 3300048920 | Bacteria | 3533 |
| 560 | Ga0496117_0076062 | 3300048920 | Bacteria | 2228 |
| 561 | Ga0496118_0014853 | 3300048921 | Bacteria | 7255 |
| 562 | Ga0496118_0157757 | 3300048921 | Bacteria | 1409 |
| 563 | Ga0496119_0000353 | 3300048922 | Bacteria | 64435 |
| 564 | Ga0496119_0024309 | 3300048922 | Bacteria | 4266 |
| 565 | Ga0496119_0045797 | 3300048922 | Bacteria | 2739 |
| 566 | Ga0496120_0065220 | 3300048923 | Bacteria | 2019 |
| 567 | Ga0496121_0000774 | 3300048924 | Bacteria | 58528 |
| 568 | Ga0496121_0001934 | 3300048924 | Bacteria | 33033 |
| 569 | Ga0496121_0002911 | 3300048924 | Bacteria | 25109 |
| 570 | Ga0496121_0016680 | 3300048924 | Bacteria | 7559 |
| 571 | Ga0496121_0020156 | 3300048924 | Bacteria | 6620 |
| 572 | Ga0496121_0053472 | 3300048924 | Bacteria | 3383 |
| 573 | Ga0496121_0091046 | 3300048924 | Bacteria | 2382 |
| 574 | Ga0496121_0129591 | 3300048924 | Bacteria | 1890 |
| 575 | Ga0496121_0131969 | 3300048924 | Bacteria | 1868 |
| 576 | Ga0496121_0286779 | 3300048924 | Bacteria | 1123 |
| 577 | Ga0496122_0037719 | 3300048925 | Bacteria | 3885 |
| 578 | Ga0496124_0098837 | 3300048927 | Bacteria | 2367 |
| 579 | Ga0496124_0135649 | 3300048927 | Bacteria | 1949 |
| 580 | Ga0496124_0145091 | 3300048927 | Bacteria | 1869 |
| 581 | Ga0496125_0002472 | 3300048928 | Bacteria | 23972 |
| 582 | Ga0496125_0007003 | 3300048928 | Bacteria | 12067 |
| 583 | Ga0496126_0002033 | 3300048929 | Bacteria | 28509 |
| 584 | Ga0496126_0002400 | 3300048929 | Bacteria | 25436 |
| 585 | Ga0496126_0020156 | 3300048929 | Bacteria | 6544 |
| 586 | Ga0496126_0033693 | 3300048929 | Bacteria | 4817 |
| 587 | Ga0496126_0059027 | 3300048929 | Bacteria | 3456 |
| 588 | Ga0496126_0061742 | 3300048929 | Bacteria | 3365 |
| 589 | Ga0496126_0063287 | 3300048929 | Bacteria | 3316 |
| 590 | Ga0496126_0087483 | 3300048929 | Bacteria | 2745 |
| 591 | Ga0496126_0119361 | 3300048929 | Bacteria | 2288 |
| 592 | Ga0496126_0128843 | 3300048929 | Bacteria | 2188 |
| 593 | Ga0496126_0175270 | 3300048929 | Bacteria | 1824 |
| 594 | Ga0496126_0201062 | 3300048929 | Bacteria | 1683 |
| 595 | Ga0496126_0286318 | 3300048929 | Bacteria | 1364 |
| 596 | Ga0501033_0040401 | 3300049570 | Bacteria | 3483 |
| 597 | Ga0501034_0042724 | 3300049571 | Bacteria | 4588 |
| 598 | Ga0501034_0145573 | 3300049571 | Bacteria | 2347 |
| 599 | Ga0501038_0004519 | 3300049574 | Bacteria | 12948 |
| 600 | Ga0501047_0135327 | 3300049581 | Bacteria | 2345 |
| 601 | Ga0501047_0198563 | 3300049581 | Bacteria | 1867 |
| 602 | Ga0501047_0346463 | 3300049581 | Bacteria | 1323 |
| 603 | Ga0501067_0021106 | 3300049583 | Bacteria | 3604 |
| 604 | Ga0501067_0085250 | 3300049583 | Bacteria | 1753 |
| 605 | Ga0501069_0049448 | 3300049585 | Bacteria | 2337 |
| 606 | Ga0501074_0132883 | 3300049590 | Bacteria | 1780 |
| 607 | Ga0501076_0087844 | 3300049592 | Bacteria | 2499 |
| 608 | Ga0501080_0400202 | 3300049742 | Bacteria | 1235 |
| 609 | Ga0501081_0172249 | 3300049743 | Bacteria | 1563 |
| 610 | Ga0501035_0074883 | 3300049822 | Bacteria | 2994 |
| 611 | Ga0501035_0082145 | 3300049822 | Bacteria | 2844 |
| 612 | Ga0501044_0001046 | 3300049823 | Bacteria | 33251 |
| 613 | Ga0501044_0023541 | 3300049823 | Bacteria | 6551 |
| 614 | Ga0501044_0225603 | 3300049823 | Bacteria | 1823 |
| 615 | nmdc:mga00v17_16765_c1 | 3300050491 | Bacteria | 4132 |
| 616 | nmdc:mga00v17_215448_c1 | 3300050491 | Bacteria | 1243 |
| 617 | nmdc:mga0yw44_37395_c1 | 3300050492 | Bacteria | 2866 |
| 618 | nmdc:mga0k408_60329_c1 | 3300050493 | Bacteria | 2204 |
| 619 | nmdc:mga06z11_168427_c1 | 3300050494 | Bacteria | 1256 |
| 620 | nmdc:mga04h51_6761_c1 | 3300050495 | Bacteria | 2993 |
| 621 | nmdc:mga0n895_132777_c1 | 3300050512 | Bacteria | 2515 |
| 622 | nmdc:mga0n895_16469_c1 | 3300050512 | Bacteria | 6784 |
| 623 | nmdc:mga0n895_437343_c1 | 3300050512 | Bacteria | 1321 |
| 624 | nmdc:mga0rr50_105781_c1 | 3300050513 | Bacteria | 2219 |
| 625 | nmdc:mga0rr50_245520_c1 | 3300050513 | Bacteria | 1485 |
| 626 | nmdc:mga08x19_26093_c1 | 3300050514 | Bacteria | 3644 |
| 627 | nmdc:mga0a205_204781_c1 | 3300050515 | Bacteria | 1862 |
| 628 | nmdc:mga0sz30_1061_c1 | 3300050516 | Bacteria | 9903 |
| 629 | Ga0500635_0002612 | 3300053080 | Bacteria | 4480 |
| 630 | Ga0495595_0008168 | 3300053084 | Bacteria | 4293 |
| 631 | Ga0495595_0024982 | 3300053084 | Bacteria | 2642 |
| 632 | Ga0500644_0005676 | 3300053088 | Bacteria | 3156 |
| 633 | Ga0500647_0034083 | 3300053091 | Bacteria | 2430 |
| 634 | Ga0500651_0029959 | 3300053093 | Bacteria | 3422 |
| 635 | Ga0500566_0000631 | 3300053094 | Bacteria | 19674 |
| 636 | Ga0500566_0000771 | 3300053094 | Bacteria | 18098 |
| 637 | Ga0500641_0007701 | 3300053096 | Bacteria | 3838 |
| 638 | Ga0500641_0053911 | 3300053096 | Bacteria | 1661 |
| 639 | Ga0500648_108119 | 3300053097 | Bacteria | 1539 |
| 640 | Ga0500554_004600 | 3300053102 | Bacteria | 2937 |
| 641 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 642 | Ga0500595_000928 | 3300053119 | Bacteria | 16602 |
| 643 | Ga0500595_001846 | 3300053119 | Bacteria | 10966 |
| 644 | Ga0500595_004756 | 3300053119 | Bacteria | 6022 |
| 645 | Ga0500595_026781 | 3300053119 | Bacteria | 1982 |
| 646 | Ga0500607_081527 | 3300053121 | Bacteria | 1649 |
| 647 | Ga0500618_003955 | 3300053125 | Bacteria | 4903 |
| 648 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 649 | Ga0500642_0066895 | 3300053130 | Bacteria | 1627 |
| 650 | Ga0500652_017951 | 3300053131 | Bacteria | 2602 |
| 651 | Ga0500559_0000973 | 3300053136 | Bacteria | 17925 |
| 652 | Ga0500559_0087571 | 3300053136 | Bacteria | 1422 |
| 653 | Ga0500568_0000800 | 3300053139 | Bacteria | 22201 |
| 654 | Ga0500568_0023341 | 3300053139 | Bacteria | 2631 |
| 655 | Ga0500568_0039806 | 3300053139 | Bacteria | 1895 |
| 656 | Ga0500573_0025082 | 3300053140 | Bacteria | 3428 |
| 657 | Ga0500577_0000075 | 3300053142 | Bacteria | 23037 |
| 658 | Ga0500603_000825 | 3300053150 | Bacteria | 7413 |
| 659 | Ga0500604_0000131 | 3300053151 | Bacteria | 22701 |
| 660 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 661 | Ga0500622_0000583 | 3300053156 | Bacteria | 33081 |
| 662 | Ga0500627_0035169 | 3300053158 | Bacteria | 2127 |
| 663 | Ga0500633_0015572 | 3300053160 | Bacteria | 2186 |
| 664 | Ga0500636_0006153 | 3300053177 | Bacteria | 6890 |
| 665 | Ga0500636_0066123 | 3300053177 | Bacteria | 2103 |
| 666 | Ga0500637_0030439 | 3300053178 | Bacteria | 3003 |
| 667 | Ga0500567_054745 | 3300053723 | Bacteria | 1810 |
| 668 | Ga0501082_0078639 | 3300060353 | Bacteria | 2845 |
| 669 | Ga0466962_0003950 | 3300061719 | Bacteria | 7097 |
| 670 | Ga0530510_0163211 | 3300061734 | Bacteria | 1649 |
| 671 | 2513659024 | 2513237096 | Bacteria | 8722461 |
| 672 | 2513673229 | 2513237098 | Bacteria | 9902361 |
| 673 | 2513695367 | 2513237101 | Bacteria | 7952346 |
| 674 | 2513860359 | 2513237137 | Bacteria | 9558895 |
| 675 | 2513891818 | 2513237141 | Bacteria | 8496279 |
| 676 | 2513921287 | 2513237145 | Bacteria | 8979722 |
| 677 | 2517894173 | 2517572143 | Bacteria | 9484767 |
| 678 | 2524466082 | 2524023210 | Bacteria | 9029266 |
| 679 | 2524536101 | 2524023228 | Bacteria | 10118060 |
| 680 | 2603861373 | 2602042107 | Bacteria | 6226103 |
| 681 | 2671123484 | 2667528175 | Bacteria | 7532676 |
| 682 | 2723843749 | 2721755755 | Bacteria | 8322773 |
| 683 | 2728748724 | 2728368998 | Bacteria | 8720350 |
| 684 | 2793073154 | 2791355197 | Bacteria | 8420563 |
| 685 | 2793079419 | |||
| 686 | 2857530144 | 2857524615 | Bacteria | 6615449 |
| 687 | 2874612259 | 2874604998 | Bacteria | 7834745 |
| 688 | 2876811395 | 2876808645 | Bacteria | 8824342 |
| 689 | 2879114790 | 2879110137 | Bacteria | 8907982 |
| 690 | 2885376380 | 2885374607 | Bacteria | 8927485 |
| 691 | 2885391311 | 2885383462 | Bacteria | 9473874 |
| 692 | 2889042051 | 2889033259 | Bacteria | 9099371 |
| 693 | 2893066037 | 2893066018 | Bacteria | 6158120 |
| 694 | 2903776343 | 2903768456 | Bacteria | 9749579 |
| 695 | 2904697398 | 2904690495 | Bacteria | 9412302 |
| 696 | 2904705297 | |||
| 697 | 2906610988 | |||
| 698 | 2906639547 | 2906635258 | Bacteria | 8601019 |
| 699 | 2906661786 | 2906660503 | Bacteria | 8595048 |
| 700 | 2908744501 | 2908739725 | Bacteria | 8628932 |
| 701 | 2908762363 | 2908756301 | Bacteria | 8864324 |
| 702 | 2919079583 | 2919073203 | Bacteria | 6531949 |
| 703 | 2922366079 | 2922361189 | Bacteria | 7436256 |
| 704 | 2922387346 | 2922386360 | Bacteria | 7017218 |
| 705 | 2922428328 | |||
| 706 | 2935635835 | 2935630451 | Bacteria | 8169952 |
| 707 | 2941512466 | 2941507105 | Bacteria | 8166816 |
| 708 | 2941520167 | 2941515067 | Bacteria | 8166720 |
| 709 | 2941528437 | 2941523033 | Bacteria | 8169134 |
| 710 | 3005478312 | 3005474847 | Bacteria | 9259049 |
| 711 | 8006942904 | 8006933436 | Bacteria | 10410654 |
| 712 | 8006972857 | 8006964411 | Bacteria | 8966052 |
| 713 | 8006982624 | 8006973647 | Bacteria | 10679141 |
| 714 | 8006988686 | 8006984368 | Bacteria | 9651211 |
| 715 | 8006994394 | 8006994254 | Bacteria | 8309700 |
| 716 | 8019566614 | 8019565922 | Bacteria | 9639779 |
| 717 | 8056681110 | 8056673599 | Bacteria | 7871253 |
| 718 | 8056686522 | 8056681323 | Bacteria | 8472857 |
| 719 | 8056694739 | 8056689827 | Bacteria | 6712655 |
| 720 | Ga0213874_10019925 | |||
| 721 | JGI25406J46586_10000014 | |||
| 722 | JGI25153J46596_10000519 | |||
| 723 | JGI25160J50197_1019531 | |||
| 724 | JGI25404J52841_10016926 | |||
| 725 | JGI25404J52841_10021716 | |||
| 726 | Ga0070683_100006136 | |||
| 727 | Ga0070683_100217251 | |||
| 728 | Ga0070666_10043945 | |||
| 729 | Ga0070680_100013457 | |||
| 730 | Ga0070680_100043545 | |||
| 731 | Ga0070682_100043517 | |||
| 732 | Ga0068868_100090617 | |||
| 733 | Ga0070660_100038487 | |||
| 734 | Ga0070691_10014147 | |||
| 735 | Ga0070687_100111124 | |||
| 736 | Ga0070661_100055612 | |||
| 737 | Ga0070671_100058008 | |||
| 738 | Ga0070674_100065770 | |||
| 739 | Ga0070673_100101955 | |||
| 740 | Ga0070688_100016782 | |||
| 741 | Ga0070709_10002624 | |||
| 742 | Ga0070709_10004205 | |||
| 743 | Ga0070709_10020944 | |||
| 744 | Ga0070714_100006438 | |||
| 745 | Ga0070714_100177659 | |||
| 746 | Ga0070713_100002174 | |||
| 747 | Ga0070713_100016056 | |||
| 748 | Ga0070710_10002118 | |||
| 749 | Ga0070710_10054923 | |||
| 750 | Ga0070711_100002093 | |||
| 751 | Ga0070711_100004807 | |||
| 752 | Ga0070711_100010964 | |||
| 753 | Ga0070711_100047992 | |||
| 754 | Ga0070711_100135021 | |||
| 755 | Ga0070711_100202760 | |||
| 756 | Ga0070700_100142124 | |||
| 757 | Ga0070663_100059600 | |||
| 758 | Ga0070663_100256409 | |||
| 759 | Ga0070663_100279380 | |||
| 760 | Ga0070678_100101106 | |||
| 761 | Ga0070681_10065840 | |||
| 762 | Ga0070681_10119737 | |||
| 763 | Ga0070681_10188057 | |||
| 764 | Ga0070681_10196067 | |||
| 765 | Ga0068867_100113070 | |||
| 766 | Ga0070685_10003228 | |||
| 767 | Ga0070699_100374584 | |||
| 768 | Ga0070679_100017653 | |||
| 769 | Ga0070679_100022942 | |||
| 770 | Ga0070679_100091642 | |||
| 771 | Ga0070679_100108285 | |||
| 772 | Ga0070684_100006435 | |||
| 773 | Ga0070684_100035774 | |||
| 774 | Ga0070684_100138959 | |||
| 775 | Ga0070697_100040282 | |||
| 776 | Ga0068853_100002914 | |||
| 777 | Ga0068853_100006819 | |||
| 778 | Ga0068853_100091570 | |||
| 779 | Ga0068853_100305882 | |||
| 780 | Ga0070665_100016672 | |||
| 781 | Ga0070665_100071645 | |||
| 782 | Ga0070665_100099361 | |||
| 783 | Ga0070665_100120217 | |||
| 784 | Ga0070665_100189362 | |||
| 785 | Ga0070665_100203829 | |||
| 786 | Ga0068855_100005255 | |||
| 787 | Ga0068855_100056353 | |||
| 788 | Ga0068855_100082669 | |||
| 789 | Ga0068855_100139097 | |||
| 790 | Ga0068855_100461813 | |||
| 791 | Ga0070664_100168205 | |||
| 792 | Ga0068857_100013640 | |||
| 793 | Ga0068857_100019936 | |||
| 794 | Ga0068857_100037481 | |||
| 795 | Ga0068857_100142559 | |||
| 796 | Ga0068854_100018641 | |||
| 797 | Ga0068854_100057520 | |||
| 798 | Ga0068854_100161294 | |||
| 799 | Ga0068856_100000780 | |||
| 800 | Ga0068856_100037538 | |||
| 801 | Ga0068856_100066700 | |||
| 802 | Ga0068856_100078653 | |||
| 803 | Ga0068856_100151694 | |||
| 804 | Ga0068856_100175382 | |||
| 805 | Ga0070702_100102067 | |||
| 806 | Ga0068852_100082378 | |||
| 807 | Ga0068859_100022405 | |||
| 808 | Ga0068859_100109449 | |||
| 809 | Ga0068859_100281555 | |||
| 810 | Ga0068864_100018659 | |||
| 811 | Ga0068864_100042951 | |||
| 812 | Ga0068861_100146091 | |||
| 813 | Ga0068851_10011796 | |||
| 814 | Ga0068863_100074960 | |||
| 815 | Ga0068858_100077967 | |||
| 816 | Ga0068858_100087053 | |||
| 817 | Ga0068858_100149898 | |||
| 818 | Ga0068860_100000724 | |||
| 819 | Ga0068860_100068602 | |||
| 820 | Ga0068862_100138149 | |||
| 821 | Ga0068862_100244939 | |||
| 822 | Ga0081455_10009713 | |||
| 823 | Ga0081455_10010696 | |||
| 824 | Ga0081455_10020391 | |||
| 825 | Ga0081455_10040417 | |||
| 826 | Ga0081455_10102682 | |||
| 827 | Ga0081538_10046730 | |||
| 828 | Ga0081540_1000311 | |||
| 829 | Ga0081540_1003511 | |||
| 830 | Ga0081540_1006842 | |||
| 831 | Ga0081540_1011723 | |||
| 832 | Ga0081540_1025394 | |||
| 833 | Ga0081540_1025638 | |||
| 834 | Ga0081539_10000008 | |||
| 835 | Ga0081539_10087741 | |||
| 836 | Ga0070717_10000145 | |||
| 837 | Ga0070717_10071051 | |||
| 838 | Ga0070717_10177938 | |||
| 839 | Ga0075365_10004996 | |||
| 840 | Ga0075365_10010461 | |||
| 841 | Ga0075365_10042958 | |||
| 842 | Ga0075363_100029350 | |||
| 843 | Ga0075364_10049922 | |||
| 844 | Ga0070715_10000518 | |||
| 845 | Ga0070715_10002065 | |||
| 846 | Ga0070716_100001181 | |||
| 847 | Ga0070716_100004753 | |||
| 848 | Ga0070716_100056915 | |||
| 849 | Ga0070716_100149426 | |||
| 850 | Ga0070712_100003369 | |||
| 851 | Ga0070712_100005502 | |||
| 852 | Ga0070712_100056388 | |||
| 853 | Ga0070712_100148768 | |||
| 854 | Ga0075367_10012781 | |||
| 855 | Ga0075367_10127186 | |||
| 856 | Ga0075369_10027992 | |||
| 857 | Ga0097621_100014688 | |||
| 858 | Ga0075430_100031338 | |||
| 859 | Ga0075434_100018371 | |||
| 860 | Ga0075434_100186318 | |||
| 861 | Ga0075434_100212097 | |||
| 862 | Ga0068865_100021154 | |||
| 863 | Ga0075436_100179352 | |||
| 864 | Ga0097620_100022408 | |||
| 865 | Ga0097620_100109447 | |||
| 866 | Ga0097620_100281553 | |||
| 867 | Ga0099824_1012951 | |||
| 868 | Ga0099822_1022362 | |||
| 869 | Ga0075435_100088878 | |||
| 870 | Ga0099794_10067435 | |||
| 871 | Ga0099795_10012669 | |||
| 872 | Ga0105251_10039996 | |||
| 873 | Ga0105240_10022376 | |||
| 874 | Ga0105240_10024287 | |||
| 875 | Ga0105240_10038576 | |||
| 876 | Ga0105240_10340122 | |||
| 877 | Ga0105245_10145518 | |||
| 878 | Ga0105245_10305752 | |||
| 879 | Ga0105241_10052392 | |||
| 880 | Ga0105242_10048793 | |||
| 881 | Ga0105237_10084725 | |||
| 882 | Ga0105238_10005212 | |||
| 883 | Ga0105238_10062381 | |||
| 884 | Ga0099796_10000366 | |||
| 885 | Ga0105239_10006165 | |||
| 886 | Ga0105239_10009620 | |||
| 887 | Ga0105239_10034348 | |||
| 888 | Ga0105239_10411898 | |||
| 889 | Ga0105246_10013898 | |||
| 890 | Ga0105246_10201093 | |||
| 891 | Ga0157370_10097003 | |||
| 892 | Ga0157370_10104462 | |||
| 893 | Ga0157370_10120555 | |||
| 894 | Ga0157370_10164459 | |||
| 895 | Ga0157369_10007176 | |||
| 896 | Ga0157369_10009052 | |||
| 897 | Ga0157369_10014447 | |||
| 898 | Ga0157369_10041320 | |||
| 899 | Ga0157374_10036899 | |||
| 900 | Ga0157374_10095736 | |||
| 901 | Ga0157374_10196900 | |||
| 902 | Ga0157374_10399976 | |||
| 903 | Ga0157378_10006607 | |||
| 904 | Ga0163162_10114061 | |||
| 905 | Ga0157372_10151184 | |||
| 906 | Ga0157375_10073723 | |||
| 907 | Ga0163163_10096259 | |||
| 908 | Ga0163163_10166436 | |||
| 909 | Ga0163163_10265921 | |||
| 910 | Ga0163163_10334529 | |||
| 911 | Ga0157380_10146888 | |||
| 912 | Ga0157377_10030319 | |||
| 913 | Ga0157377_10183548 | |||
| 914 | Ga0157376_10027176 | |||
| 915 | Ga0163161_10032886 | |||
| 916 | Ga0213875_10000361 | |||
| 917 | Ga0213875_10000707 | |||
| 918 | Ga0213871_10005669 | |||
| 919 | Ga0209677_106517 | |||
| 920 | Ga0209233_1005956 | |||
| 921 | Ga0209564_1000468 | |||
| 922 | Ga0209758_1002244 | |||
| 923 | Ga0209758_1003548 | |||
| 924 | Ga0207656_10037349 | |||
| 925 | Ga0207653_10011019 | |||
| 926 | Ga0207692_10000559 | |||
| 927 | Ga0207692_10001804 | |||
| 928 | Ga0207710_10038563 | |||
| 929 | Ga0207680_10033605 | |||
| 930 | Ga0207647_10005540 | |||
| 931 | Ga0207685_10018857 | |||
| 932 | Ga0207699_10002006 | |||
| 933 | Ga0207699_10010283 | |||
| 934 | Ga0207699_10101472 | |||
| 935 | Ga0207645_10057321 | |||
| 936 | Ga0207654_10000941 | |||
| 937 | Ga0207707_10001221 | |||
| 938 | Ga0207707_10008851 | |||
| 939 | Ga0207707_10024670 | |||
| 940 | Ga0207707_10079231 | |||
| 941 | Ga0207695_10001321 | |||
| 942 | Ga0207695_10390338 | |||
| 943 | Ga0207671_10194508 | |||
| 944 | Ga0207693_10000587 | |||
| 945 | Ga0207693_10003437 | |||
| 946 | Ga0207693_10009341 | |||
| 947 | Ga0207693_10038531 | |||
| 948 | Ga0207693_10324369 | |||
| 949 | Ga0207663_10000147 | |||
| 950 | Ga0207663_10009185 | |||
| 951 | Ga0207663_10021463 | |||
| 952 | Ga0207663_10105274 | |||
| 953 | Ga0207663_10112273 | |||
| 954 | Ga0207660_10011742 | |||
| 955 | Ga0207662_10031980 | |||
| 956 | Ga0207657_10001936 | |||
| 957 | Ga0207657_10159700 | |||
| 958 | Ga0207652_10011278 | |||
| 959 | Ga0207652_10125870 | |||
| 960 | Ga0207652_10226643 | |||
| 961 | Ga0207694_10000135 | |||
| 962 | Ga0207694_10040401 | |||
| 963 | Ga0207687_10174235 | |||
| 964 | Ga0207700_10003851 | |||
| 965 | Ga0207700_10004315 | |||
| 966 | Ga0207700_10008644 | |||
| 967 | Ga0207700_10117143 | |||
| 968 | Ga0207700_10220680 | |||
| 969 | Ga0207664_10004039 | |||
| 970 | Ga0207664_10150204 | |||
| 971 | Ga0207644_10008140 | |||
| 972 | Ga0207690_10110677 | |||
| 973 | Ga0207706_10104170 | |||
| 974 | Ga0207706_10130180 | |||
| 975 | Ga0207709_10231068 | |||
| 976 | Ga0207670_10021810 | |||
| 977 | Ga0207670_10076584 | |||
| 978 | Ga0207669_10033658 | |||
| 979 | Ga0207665_10000265 | |||
| 980 | Ga0207665_10000868 | |||
| 981 | Ga0207665_10019708 | |||
| 982 | Ga0207665_10024757 | |||
| 983 | Ga0207665_10131249 | |||
| 984 | Ga0207691_10047301 | |||
| 985 | Ga0207691_10313070 | |||
| 986 | Ga0207711_10007436 | |||
| 987 | Ga0207689_10143669 | |||
| 988 | Ga0207661_10001701 | |||
| 989 | Ga0207661_10010680 | |||
| 990 | Ga0207661_10099691 | |||
| 991 | Ga0207661_10214549 | |||
| 992 | Ga0207679_10071264 | |||
| 993 | Ga0207667_10027192 | |||
| 994 | Ga0207667_10089554 | |||
| 995 | Ga0207667_10194455 | |||
| 996 | Ga0207667_10469160 | |||
| 997 | Ga0207668_10024726 | |||
| 998 | Ga0207668_10167798 | |||
| 999 | Ga0207640_10050659 | |||
| 1000 | Ga0207640_10135616 | |||
| 1001 | Ga0207677_10060095 | |||
| 1002 | Ga0207677_10131688 | |||
| 1003 | Ga0207703_10034995 | |||
| 1004 | Ga0207703_10039027 | |||
| 1005 | Ga0207703_10211074 | |||
| 1006 | Ga0207703_10216815 | |||
| 1007 | Ga0207639_10181025 | |||
| 1008 | Ga0207678_10019160 | |||
| 1009 | Ga0207678_10020831 | |||
| 1010 | Ga0207678_10073828 | |||
| 1011 | Ga0207678_10240879 | |||
| 1012 | Ga0207708_10030112 | |||
| 1013 | Ga0207702_10000026 | |||
| 1014 | Ga0207702_10000334 | |||
| 1015 | Ga0207702_10100878 | |||
| 1016 | Ga0207702_10272074 | |||
| 1017 | Ga0207648_10031210 | |||
| 1018 | Ga0207648_10039811 | |||
| 1019 | Ga0207676_10079317 | |||
| 1020 | Ga0207676_10146806 | |||
| 1021 | Ga0207674_10011940 | |||
| 1022 | Ga0207674_10082105 | |||
| 1023 | Ga0207674_10134043 | |||
| 1024 | Ga0207674_10212892 | |||
| 1025 | Ga0207675_100174465 | |||
| 1026 | Ga0207683_10038657 | |||
| 1027 | Ga0207683_10267012 | |||
| 1028 | Ga0207698_10079102 | |||
| 1029 | Ga0207698_10287174 | |||
| 1030 | Ga0209589_1000004 | |||
| 1031 | Ga0209489_100004 | |||
| 1032 | Ga0209700_100004 | |||
| 1033 | Ga0209813_10049293 | |||
| 1034 | Ga0268266_10012789 | |||
| 1035 | Ga0268266_10022968 | |||
| 1036 | Ga0268266_10026743 | |||
| 1037 | Ga0268266_10107150 | |||
| 1038 | Ga0268266_10136244 | |||
| 1039 | Ga0268265_10433400 | |||
| 1040 | Ga0268264_10000096 | |||
| 1041 | Ga0265334_10003786 | |||
| 1042 | Ga0265318_10019074 | |||
| 1043 | Ga0265323_10000913 | |||
| 1044 | Ga0265322_10001611 | |||
| 1045 | Ga0265336_10000099 | |||
| 1046 | Ga0307517_10000315 | |||
| 1047 | Ga0307515_10053148 | |||
| 1048 | Ga0307515_10198845 | |||
| 1049 | Ga0265338_10000207 | |||
| 1050 | Ga0265324_10001958 | |||
| 1051 | Ga0265330_10091349 | |||
| 1052 | Ga0265332_10000585 | |||
| 1053 | Ga0265332_10013242 | |||
| 1054 | Ga0265325_10000053 | |||
| 1055 | Ga0265325_10115871 | |||
| 1056 | Ga0265329_10013050 | |||
| 1057 | Ga0265340_10047489 | |||
| 1058 | Ga0265339_10001532 | |||
| 1059 | Ga0265339_10010735 | |||
| 1060 | Ga0265339_10041311 | |||
| 1061 | Ga0265316_10029807 | |||
| 1062 | Ga0265316_10158991 | |||
| 1063 | Ga0307408_100033037 | |||
| 1064 | Ga0265313_10017522 | |||
| 1065 | Ga0307508_10021406 | |||
| 1066 | Ga0307508_10081646 | |||
| 1067 | Ga0265314_10003384 | |||
| 1068 | Ga0265314_10017116 | |||
| 1069 | Ga0265342_10001010 | |||
| 1070 | Ga0307516_10007232 | |||
| 1071 | Ga0307516_10013179 | |||
| 1072 | Ga0307410_10173541 | |||
| 1073 | Ga0307510_10008253 | |||
| 1074 | Ga0315911_1000014 | |||
| 1075 | Ga0373926_0022692 | |||
| 1076 | Ga0373934_0012159 | |||
| 1077 | Ga0373923_0042724 | |||
| 1078 | Ga0373923_0124773 | |||
| 1079 | Ga0373936_0059185 | |||
| 1080 | Ga0373953_0036895 | |||
| 1081 | Ga0373954_0041365 | |||
| 1082 | Ga0373956_0004737 | |||
| 1083 | Ga0373956_0007387 | |||
| 1084 | Ga0373943_0080077 | |||
| 1085 | Ga0373955_0006675 | |||
| 1086 | Ga0373955_0013779 | |||
| 1087 | Ga0373955_0027666 | |||
| 1088 | Ga0373942_0013749 | |||
| 1089 | Ga0373961_0001489 | |||
| 1090 | Ga0373924_0013117 | |||
| 1091 | Ga0373931_0020616 | |||
| 1092 | Ga0373935_0002078 | |||
| 1093 | Ga0373935_0162045 | |||
| 1094 | Ga0373927_0003925 | |||
| 1095 | Ga0373927_0027376 | |||
| 1096 | Ga0373927_0042386 | |||
| 1097 | Ga0373927_0058259 | |||
| 1098 | Ga0373927_0168961 | |||
| 1099 | Ga0373933_0000020 | |||
| 1100 | Ga0373933_0005055 | |||
| 1101 | Ga0373933_0015421 | |||
| 1102 | Ga0373933_0089742 | |||
| 1103 | Ga0373947_0004109 | |||
| 1104 | Ga0373947_0016136 | |||
| 1105 | Ga0373937_0113505 | |||
| 1106 | Ga0373925_0008691 | |||
| 1107 | Ga0373925_0029927 | |||
| 1108 | Ga0373925_0071012 | |||
| 1109 | Ga0373925_0081602 | |||
| 1110 | Ga0373925_0164504 | |||
| 1111 | Ga0395900_0118079 | |||
| 1112 | Ga0395900_0119806 | |||
| 1113 | Ga0395898_0013618 | |||
| 1114 | Ga0395898_0023411 | |||
| 1115 | Ga0395898_0188151 | |||
| 1116 | Ga0395905_0201734 | |||
| 1117 | Ga0395905_0250688 | |||
| 1118 | Ga0395905_0290347 | |||
| 1119 | Ga0436364_0717863 | |||
| 1120 | Ga0436364_1385478 | |||
| 1121 | Ga0395901_0112639 | |||
| 1122 | Ga0436365_0833193 | |||
| 1123 | Ga0436365_0944955 | |||
| 1124 | Ga0436365_1148872 | |||
| 1125 | Ga0436360_0304485 | |||
| 1126 | Ga0436360_0597135 | |||
| 1127 | Ga0436361_1068668 | |||
| 1128 | Ga0436363_0034386 | |||
| 1129 | Ga0436362_0367954 | |||
| 1130 | Ga0436362_0881328 | |||
| 1131 | Ga0436362_1098843 | |||
| 1132 | Ga0451853_0587007 | |||
| 1133 | Ga0466966_0020722 | |||
| 1134 | Ga0466963_0118604 | |||
| 1135 | Ga0466957_0056724 | |||
| 1136 | Ga0466959_0191967 | |||
| 1137 | Ga0466958_0159871 | |||
| 1138 | Ga0495592_0027096 | |||
| 1139 | Ga0495592_0182465 | |||
| 1140 | Ga0495603_0007969 | |||
| 1141 | Ga0495603_0011811 | |||
| 1142 | Ga0495629_0000466 | |||
| 1143 | Ga0495629_0012059 | |||
| 1144 | Ga0495629_0044521 | |||
| 1145 | Ga0495638_0011966 | |||
| 1146 | Ga0495638_0096681 | |||
| 1147 | Ga0495641_0044847 | |||
| 1148 | Ga0495641_0052409 | |||
| 1149 | Ga0495651_0015966 | |||
| 1150 | Ga0495653_0067068 | |||
| 1151 | Ga0495582_0030311 | |||
| 1152 | Ga0495582_0032892 | |||
| 1153 | Ga0495639_0007911 | |||
| 1154 | Ga0495639_0118438 | |||
| 1155 | Ga0495662_0015796 | |||
| 1156 | Ga0495664_0015534 | |||
| 1157 | Ga0495664_0021335 | |||
| 1158 | Ga0495584_0144741 | |||
| 1159 | Ga0495594_0037330 | |||
| 1160 | Ga0495596_0061496 | |||
| 1161 | Ga0495606_0005211 | |||
| 1162 | Ga0495606_0066821 | |||
| 1163 | Ga0495608_0010573 | |||
| 1164 | Ga0495618_0008064 | |||
| 1165 | Ga0495618_0048697 | |||
| 1166 | Ga0495618_0126615 | |||
| 1167 | Ga0495620_0033987 | |||
| 1168 | Ga0495643_0051314 | |||
| 1169 | Ga0495644_0061352 | |||
| 1170 | Ga0495648_0005947 | |||
| 1171 | Ga0495666_0096924 | |||
| 1172 | Ga0495652_0073214 | |||
| 1173 | Ga0495665_0011670 | |||
| 1174 | Ga0495586_0053894 | |||
| 1175 | Ga0495586_0109562 | |||
| 1176 | Ga0495587_0012527 | |||
| 1177 | Ga0495597_0115967 | |||
| 1178 | Ga0495645_0163837 | |||
| 1179 | Ga0495622_0043219 | |||
| 1180 | Ga0495667_0091389 | |||
| 1181 | Ga0495634_0020776 | |||
| 1182 | Ga0495625_0127786 | |||
| 1183 | Ga0495625_0144430 | |||
| 1184 | Ga0495625_0156820 | |||
| 1185 | Ga0495661_0052512 | |||
| 1186 | Ga0495588_0041197 | |||
| 1187 | Ga0495588_0049500 | |||
| 1188 | Ga0495588_0099240 | |||
| 1189 | Ga0495599_0035060 | |||
| 1190 | Ga0495623_0049716 | |||
| 1191 | Ga0495647_0003525 | |||
| 1192 | Ga0495658_0002587 | |||
| 1193 | Ga0495613_0175298 | |||
| 1194 | Ga0495624_0003820 | |||
| 1195 | Ga0495670_0009827 | |||
| 1196 | Ga0495660_0072680 | |||
| 1197 | Ga0495604_0056974 | |||
| 1198 | Ga0495604_0247504 | |||
| 1199 | Ga0495674_0046907 | |||
| 1200 | Ga0495672_0025049 | |||
| 1201 | Ga0495672_0058436 | |||
| 1202 | Ga0495680_0033039 | |||
| 1203 | Ga0495680_0043678 | |||
| 1204 | Ga0495680_0251688 | |||
| 1205 | Ga0495675_0009663 | |||
| 1206 | Ga0495684_0008560 | |||
| 1207 | Ga0495684_0009161 | |||
| 1208 | Ga0495684_0053690 | |||
| 1209 | Ga0495686_0061190 | |||
| 1210 | Ga0495593_0053109 | |||
| 1211 | Ga0495602_0032475 | |||
| 1212 | Ga0495615_0021322 | |||
| 1213 | Ga0496100_0047657 | |||
| 1214 | Ga0496100_0065357 | |||
| 1215 | Ga0496100_0068985 | |||
| 1216 | Ga0496101_0084652 | |||
| 1217 | Ga0496102_0039922 | |||
| 1218 | Ga0496103_0052470 | |||
| 1219 | Ga0496103_0063854 | |||
| 1220 | Ga0496104_0000117 | |||
| 1221 | Ga0496104_0007504 | |||
| 1222 | Ga0496104_0049526 | |||
| 1223 | Ga0496104_0122500 | |||
| 1224 | Ga0496104_0319680 | |||
| 1225 | Ga0496105_0000094 | |||
| 1226 | Ga0496105_0004442 | |||
| 1227 | Ga0496105_0005994 | |||
| 1228 | Ga0496105_0023954 | |||
| 1229 | Ga0496105_0078970 | |||
| 1230 | Ga0496105_0086676 | |||
| 1231 | Ga0496105_0091132 | |||
| 1232 | Ga0496105_0214679 | |||
| 1233 | Ga0496105_0281198 | |||
| 1234 | Ga0496106_0014603 | |||
| 1235 | Ga0496106_0018567 | |||
| 1236 | Ga0496106_0044268 | |||
| 1237 | Ga0496107_0004733 | |||
| 1238 | Ga0496107_0021996 | |||
| 1239 | Ga0496107_0033711 | |||
| 1240 | Ga0496108_0020079 | |||
| 1241 | Ga0496108_0037147 | |||
| 1242 | Ga0496108_0042427 | |||
| 1243 | Ga0496108_0129337 | |||
| 1244 | Ga0496108_0278206 | |||
| 1245 | Ga0496109_0018926 | |||
| 1246 | Ga0496109_0027629 | |||
| 1247 | Ga0496109_0118438 | |||
| 1248 | Ga0496109_0130914 | |||
| 1249 | Ga0496110_0005325 | |||
| 1250 | Ga0496110_0012396 | |||
| 1251 | Ga0496110_0024628 | |||
| 1252 | Ga0496110_0195436 | |||
| 1253 | Ga0496110_0197556 | |||
| 1254 | Ga0496110_0215241 | |||
| 1255 | Ga0496111_0009567 | |||
| 1256 | Ga0496111_0024061 | |||
| 1257 | Ga0496112_0000008 | |||
| 1258 | Ga0496112_0013508 | |||
| 1259 | Ga0496112_0014948 | |||
| 1260 | Ga0496112_0017925 | |||
| 1261 | Ga0496112_0040156 | |||
| 1262 | Ga0496112_0055672 | |||
| 1263 | Ga0496112_0178655 | |||
| 1264 | Ga0496113_0005488 | |||
| 1265 | Ga0496113_0012948 | |||
| 1266 | Ga0496113_0017879 | |||
| 1267 | Ga0496113_0064750 | |||
| 1268 | Ga0496113_0104678 | |||
| 1269 | Ga0496113_0115606 | |||
| 1270 | Ga0496114_0029771 | |||
| 1271 | Ga0496114_0067418 | |||
| 1272 | Ga0496114_0250670 | |||
| 1273 | Ga0496115_0002098 | |||
| 1274 | Ga0496115_0024242 | |||
| 1275 | Ga0496115_0065265 | |||
| 1276 | Ga0496115_0172525 | |||
| 1277 | Ga0496116_0002352 | |||
| 1278 | Ga0496117_0038666 | |||
| 1279 | Ga0496117_0076062 | |||
| 1280 | Ga0496118_0014853 | |||
| 1281 | Ga0496118_0157757 | |||
| 1282 | Ga0496119_0000353 | |||
| 1283 | Ga0496119_0024309 | |||
| 1284 | Ga0496119_0045797 | |||
| 1285 | Ga0496120_0065220 | |||
| 1286 | Ga0496121_0000774 | |||
| 1287 | Ga0496121_0001934 | |||
| 1288 | Ga0496121_0002911 | |||
| 1289 | Ga0496121_0016680 | |||
| 1290 | Ga0496121_0020156 | |||
| 1291 | Ga0496121_0053472 | |||
| 1292 | Ga0496121_0091046 | |||
| 1293 | Ga0496121_0129591 | |||
| 1294 | Ga0496121_0131969 | |||
| 1295 | Ga0496121_0286779 | |||
| 1296 | Ga0496122_0037719 | |||
| 1297 | Ga0496124_0098837 | |||
| 1298 | Ga0496124_0135649 | |||
| 1299 | Ga0496124_0145091 | |||
| 1300 | Ga0496125_0002472 | |||
| 1301 | Ga0496125_0007003 | |||
| 1302 | Ga0496126_0002033 | |||
| 1303 | Ga0496126_0002400 | |||
| 1304 | Ga0496126_0020156 | |||
| 1305 | Ga0496126_0033693 | |||
| 1306 | Ga0496126_0059027 | |||
| 1307 | Ga0496126_0061742 | |||
| 1308 | Ga0496126_0063287 | |||
| 1309 | Ga0496126_0087483 | |||
| 1310 | Ga0496126_0119361 | |||
| 1311 | Ga0496126_0128843 | |||
| 1312 | Ga0496126_0175270 | |||
| 1313 | Ga0496126_0201062 | |||
| 1314 | Ga0496126_0286318 | |||
| 1315 | Ga0501033_0040401 | |||
| 1316 | Ga0501034_0042724 | |||
| 1317 | Ga0501034_0145573 | |||
| 1318 | Ga0501038_0004519 | |||
| 1319 | Ga0501047_0135327 | |||
| 1320 | Ga0501047_0198563 | |||
| 1321 | Ga0501047_0346463 | |||
| 1322 | Ga0501067_0021106 | |||
| 1323 | Ga0501067_0085250 | |||
| 1324 | Ga0501069_0049448 | |||
| 1325 | Ga0501074_0132883 | |||
| 1326 | Ga0501076_0087844 | |||
| 1327 | Ga0501080_0400202 | |||
| 1328 | Ga0501081_0172249 | |||
| 1329 | Ga0501035_0074883 | |||
| 1330 | Ga0501035_0082145 | |||
| 1331 | Ga0501044_0001046 | |||
| 1332 | Ga0501044_0023541 | |||
| 1333 | Ga0501044_0225603 | |||
| 1334 | nmdc:mga00v17_16765_c1 | |||
| 1335 | nmdc:mga00v17_215448_c1 | |||
| 1336 | nmdc:mga0yw44_37395_c1 | |||
| 1337 | nmdc:mga0k408_60329_c1 | |||
| 1338 | nmdc:mga06z11_168427_c1 | |||
| 1339 | nmdc:mga04h51_6761_c1 | |||
| 1340 | nmdc:mga0n895_132777_c1 | |||
| 1341 | nmdc:mga0n895_16469_c1 | |||
| 1342 | nmdc:mga0n895_437343_c1 | |||
| 1343 | nmdc:mga0rr50_105781_c1 | |||
| 1344 | nmdc:mga0rr50_245520_c1 | |||
| 1345 | nmdc:mga08x19_26093_c1 | |||
| 1346 | nmdc:mga0a205_204781_c1 | |||
| 1347 | nmdc:mga0sz30_1061_c1 | |||
| 1348 | Ga0500635_0002612 | |||
| 1349 | Ga0495595_0008168 | |||
| 1350 | Ga0495595_0024982 | |||
| 1351 | Ga0500644_0005676 | |||
| 1352 | Ga0500647_0034083 | |||
| 1353 | Ga0500651_0029959 | |||
| 1354 | Ga0500566_0000631 | |||
| 1355 | Ga0500566_0000771 | |||
| 1356 | Ga0500641_0007701 | |||
| 1357 | Ga0500641_0053911 | |||
| 1358 | Ga0500648_108119 | |||
| 1359 | Ga0500554_004600 | |||
| 1360 | Ga0500556_0000002 | |||
| 1361 | Ga0500595_000928 | |||
| 1362 | Ga0500595_001846 | |||
| 1363 | Ga0500595_004756 | |||
| 1364 | Ga0500595_026781 | |||
| 1365 | Ga0500607_081527 | |||
| 1366 | Ga0500618_003955 | |||
| 1367 | Ga0500642_0000026 | |||
| 1368 | Ga0500642_0066895 | |||
| 1369 | Ga0500652_017951 | |||
| 1370 | Ga0500559_0000973 | |||
| 1371 | Ga0500559_0087571 | |||
| 1372 | Ga0500568_0000800 | |||
| 1373 | Ga0500568_0023341 | |||
| 1374 | Ga0500568_0039806 | |||
| 1375 | Ga0500573_0025082 | |||
| 1376 | Ga0500577_0000075 | |||
| 1377 | Ga0500603_000825 | |||
| 1378 | Ga0500604_0000131 | |||
| 1379 | Ga0500616_0000031 | |||
| 1380 | Ga0500622_0000583 | |||
| 1381 | Ga0500627_0035169 | |||
| 1382 | Ga0500633_0015572 | |||
| 1383 | Ga0500636_0006153 | |||
| 1384 | Ga0500636_0066123 | |||
| 1385 | Ga0500637_0030439 | |||
| 1386 | Ga0500567_054745 | |||
| 1387 | Ga0501082_0078639 | |||
| 1388 | Ga0466962_0003950 | |||
| 1389 | Ga0530510_0163211 | |||
| 1390 | 2513659024 | |||
| 1391 | 2513673229 | |||
| 1392 | 2513695367 | |||
| 1393 | 2513860359 | |||
| 1394 | 2513891818 | |||
| 1395 | 2513921287 | |||
| 1396 | 2517894173 | |||
| 1397 | 2524466082 | |||
| 1398 | 2524536101 | |||
| 1399 | 2603861373 | |||
| 1400 | 2671123484 | |||
| 1401 | 2723843749 | |||
| 1402 | 2728748724 | |||
| 1403 | 2793073154 | |||
| 1404 | 2793079419 | |||
| 1405 | 2857530144 | |||
| 1406 | 2874612259 | |||
| 1407 | 2876811395 | |||
| 1408 | 2879114790 | |||
| 1409 | 2885376380 | |||
| 1410 | 2885391311 | |||
| 1411 | 2889042051 | |||
| 1412 | 2893066037 | |||
| 1413 | 2903776343 | |||
| 1414 | 2904697398 | |||
| 1415 | 2904705297 | |||
| 1416 | 2906610988 | |||
| 1417 | 2906639547 | |||
| 1418 | 2906661786 | |||
| 1419 | 2908744501 | |||
| 1420 | 2908762363 | |||
| 1421 | 2919079583 | |||
| 1422 | 2922366079 | |||
| 1423 | 2922387346 | |||
| 1424 | 2922428328 | |||
| 1425 | 2935635835 | |||
| 1426 | 2941512466 | |||
| 1427 | 2941520167 | |||
| 1428 | 2941528437 | |||
| 1429 | 3005478312 | |||
| 1430 | 8006942904 | |||
| 1431 | 8006972857 | |||
| 1432 | 8006982624 | |||
| 1433 | 8006988686 | |||
| 1434 | 8006994394 | |||
| 1435 | 8019566614 | |||
| 1436 | 8056681110 | |||
| 1437 | 8056686522 | |||
| 1438 | 8056694739 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qgr-assembly1.cif.gz_B | crystal structure of a degt dnrj eryc1 strs aminotransferase from brucella abortus | 0.9572 | 10 | 379 |
| 7b0d-assembly1.cif.gz_B | sugar transaminase from archaeoglobus veneficus | 0.945 | 8 | 381 |
| 8e75-assembly1.cif.gz_A | crystal structure of pcryo_0616, the aminotransferase required to synthesize udp-n-acetyl-3-amino-d-glucosaminuronic acid (udp-glcnac3na) | 0.9442 | 10 | 376 |
| 4qgr-assembly1.cif.gz_B | crystal structure of a degt dnrj eryc1 strs aminotransferase from brucella abortus | 0.9422 | 10 | 379 |
| 3nys-assembly1.cif.gz_A | x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution | 0.9384 | 10 | 377 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L0T6V0_4_199_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9546 | 41 | 214 | 3.40.640.10 |
| 4qgrB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9496 | 261 | 379 | 3.90.1150.10 |
| 4qgrB01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9401 | 10 | 259 | 3.40.640.10 |
| 4qgrB01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9326 | 10 | 259 | 3.40.640.10 |
| 5u1zA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9249 | 10 | 258 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382ZPZ7-F1-model_v4 | Aminotransferase class I/classII domain-containing protein | 0.9839 | 42 | 205 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A0F9A822-F1-model_v4 | Aminotransferase class I/classII domain-containing protein | 0.9819 | 10 | 165 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A800BFW7-F1-model_v4 | deleted | 0.9733 | 9 | 184 |
|
| AF-A0A382ZPZ7-F1-model_v4 | Aminotransferase class I/classII domain-containing protein | 0.9722 | 42 | 205 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A354TK86-F1-model_v4 | Erythromycin biosynthesis sensory transduction protein eryC1 | 0.9693 | 40 | 220 |
GO:0000271
GO:0008483 GO:0030170 |