F477241

General Info

Members Datasets Scaffolds Average Seq Length
719 399 1438 382

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10019925|Ga0213874_100199252
Length 374
Sequence MPDAAAFQTSGAPIEFIDLGAQRRRLGPRVDEAILRVVDHGKYIMGPEVAVFEQELAAFCGAKHVLSCANGTDALGLALMAKGIKPGQAVLVPSFTFAATAEVVAWFDAVPVFVDVLEHTFNMDPVSLEAGIATAKRLGVEPAGIIPVDLFGLPAEYDEILAIAAAHRLWVICDAAQSFGASYKRRNIGTIGDITTTSFFPAKPLGCYGDGLKSLRVHGQGADKYDNVRIGMNARLDTIQAAILSEKLTVFADEIKARNQVAARYESALEEVVAVPTMPTGITSVWAQYTVRLPDGRDRDAVAASLKASGVPTAVYYAKPLHRQLAYRHYPTAGNGLPVSDRLASEVLSLPMHPYLEEGTQNHIVAALRASLRD

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
163 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
328 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
334 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
351 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
352 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
353 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
354 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
355 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
356 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
357 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
358 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
359 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
360 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
361 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
362 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
363 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
364 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
365 2791355199
366 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
367 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
368 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
369 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
370 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
371 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
372 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
373 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
374 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
375 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
376 2904699407
377 2906610324
378 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
379 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
380 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
381 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
382 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
383 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
384 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
385 2922425934
386 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
387 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
388 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
389 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
390 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
391 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
392 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
393 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
394 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
395 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
396 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
397 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
398 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
399 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.71
Metatranscriptomes 0
Isolates 6.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.34
Nodule 5.15
Rhizoplane 9.18
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10019925 3300021377 Bacteria 1833
2 JGI25406J46586_10000014 3300003203 Bacteria 93855
3 JGI25153J46596_10000519 3300003215 Bacteria 24283
4 JGI25160J50197_1019531 3300003354 Bacteria 2074
5 JGI25404J52841_10016926 3300003659 Bacteria 1581
6 JGI25404J52841_10021716 3300003659 Bacteria 1390
7 Ga0070683_100006136 3300005329 Bacteria 10075
8 Ga0070683_100217251 3300005329 Bacteria 1817
9 Ga0070666_10043945 3300005335 Bacteria 2992
10 Ga0070680_100013457 3300005336 Bacteria 6372
11 Ga0070680_100043545 3300005336 Bacteria 3647
12 Ga0070682_100043517 3300005337 Bacteria 2777
13 Ga0068868_100090617 3300005338 Bacteria 2463
14 Ga0070660_100038487 3300005339 Bacteria 3631
15 Ga0070691_10014147 3300005341 Bacteria 3659
16 Ga0070687_100111124 3300005343 Bacteria 1551
17 Ga0070661_100055612 3300005344 Bacteria 2897
18 Ga0070671_100058008 3300005355 Bacteria 3223
19 Ga0070674_100065770 3300005356 Bacteria 2546
20 Ga0070673_100101955 3300005364 Bacteria 2365
21 Ga0070688_100016782 3300005365 Bacteria 4192
22 Ga0070709_10002624 3300005434 Bacteria 9710
23 Ga0070709_10004205 3300005434 Bacteria 7761
24 Ga0070709_10020944 3300005434 Bacteria 3804
25 Ga0070714_100006438 3300005435 Bacteria 9068
26 Ga0070714_100177659 3300005435 Bacteria 1935
27 Ga0070713_100002174 3300005436 Bacteria 12691
28 Ga0070713_100016056 3300005436 Bacteria 5622
29 Ga0070710_10002118 3300005437 Bacteria 9403
30 Ga0070710_10054923 3300005437 Bacteria 2248
31 Ga0070711_100002093 3300005439 Bacteria 11285
32 Ga0070711_100004807 3300005439 Bacteria 8012
33 Ga0070711_100010964 3300005439 Bacteria 5619
34 Ga0070711_100047992 3300005439 Bacteria 2917
35 Ga0070711_100135021 3300005439 Bacteria 1843
36 Ga0070711_100202760 3300005439 Bacteria 1532
37 Ga0070700_100142124 3300005441 Bacteria 1633
38 Ga0070663_100059600 3300005455 Bacteria 2743
39 Ga0070663_100256409 3300005455 Bacteria 1386
40 Ga0070663_100279380 3300005455 Bacteria 1330
41 Ga0070678_100101106 3300005456 Bacteria 2234
42 Ga0070681_10065840 3300005458 Bacteria 3592
43 Ga0070681_10119737 3300005458 Bacteria 2568
44 Ga0070681_10188057 3300005458 Bacteria 1985
45 Ga0070681_10196067 3300005458 Bacteria 1938
46 Ga0068867_100113070 3300005459 Bacteria 2088
47 Ga0070685_10003228 3300005466 Bacteria 8293
48 Ga0070699_100374584 3300005518 Bacteria 1285
49 Ga0070679_100017653 3300005530 Bacteria 6908
50 Ga0070679_100022942 3300005530 Bacteria 6104
51 Ga0070679_100091642 3300005530 Bacteria 3027
52 Ga0070679_100108285 3300005530 Bacteria 2765
53 Ga0070684_100006435 3300005535 Bacteria 9087
54 Ga0070684_100035774 3300005535 Bacteria 4252
55 Ga0070684_100138959 3300005535 Bacteria 2196
56 Ga0070697_100040282 3300005536 Bacteria 3779
57 Ga0068853_100002914 3300005539 Bacteria 13010
58 Ga0068853_100006819 3300005539 Bacteria 9105
59 Ga0068853_100091570 3300005539 Bacteria 2674
60 Ga0068853_100305882 3300005539 Bacteria 1471
61 Ga0070665_100016672 3300005548 Bacteria 7362
62 Ga0070665_100071645 3300005548 Bacteria 3472
63 Ga0070665_100099361 3300005548 Bacteria 2914
64 Ga0070665_100120217 3300005548 Bacteria 2629
65 Ga0070665_100189362 3300005548 Bacteria 2058
66 Ga0070665_100203829 3300005548 Bacteria 1978
67 Ga0068855_100005255 3300005563 Bacteria 15804
68 Ga0068855_100056353 3300005563 Bacteria 4612
69 Ga0068855_100082669 3300005563 Bacteria 3722
70 Ga0068855_100139097 3300005563 Bacteria 2769
71 Ga0068855_100461813 3300005563 Bacteria 1384
72 Ga0070664_100168205 3300005564 Bacteria 1943
73 Ga0068857_100013640 3300005577 Bacteria 7081
74 Ga0068857_100019936 3300005577 Bacteria 5894
75 Ga0068857_100037481 3300005577 Bacteria 4295
76 Ga0068857_100142559 3300005577 Bacteria 2166
77 Ga0068854_100018641 3300005578 Bacteria 4662
78 Ga0068854_100057520 3300005578 Bacteria 2805
79 Ga0068854_100161294 3300005578 Bacteria 1737
80 Ga0068856_100000780 3300005614 Bacteria 34542
81 Ga0068856_100037538 3300005614 Bacteria 4753
82 Ga0068856_100066700 3300005614 Bacteria 3556
83 Ga0068856_100078653 3300005614 Bacteria 3270
84 Ga0068856_100151694 3300005614 Bacteria 2326
85 Ga0068856_100175382 3300005614 Bacteria 2156
86 Ga0070702_100102067 3300005615 Bacteria 1762
87 Ga0068852_100082378 3300005616 Bacteria 2859
88 Ga0068859_100022405 3300005617 Bacteria 6333
89 Ga0068859_100109449 3300005617 Bacteria 2824
90 Ga0068859_100281555 3300005617 Bacteria 1756
91 Ga0068864_100018659 3300005618 Bacteria 5797
92 Ga0068864_100042951 3300005618 Bacteria 3869
93 Ga0068861_100146091 3300005719 Bacteria 1935
94 Ga0068851_10011796 3300005834 Bacteria 4105
95 Ga0068863_100074960 3300005841 Bacteria 3201
96 Ga0068858_100077967 3300005842 Bacteria 3078
97 Ga0068858_100087053 3300005842 Bacteria 2905
98 Ga0068858_100149898 3300005842 Bacteria 2192
99 Ga0068860_100000724 3300005843 Bacteria 37558
100 Ga0068860_100068602 3300005843 Bacteria 3369
101 Ga0068862_100138149 3300005844 Bacteria 2161
102 Ga0068862_100244939 3300005844 Bacteria 1631
103 Ga0081455_10009713 3300005937 Bacteria 9865
104 Ga0081455_10010696 3300005937 Bacteria 9281
105 Ga0081455_10020391 3300005937 Bacteria 6242
106 Ga0081455_10040417 3300005937 Bacteria 4112
107 Ga0081455_10102682 3300005937 Bacteria 2292
108 Ga0081538_10046730 3300005981 Bacteria 2665
109 Ga0081540_1000311 3300005983 Bacteria 50309
110 Ga0081540_1003511 3300005983 Bacteria 12375
111 Ga0081540_1006842 3300005983 Bacteria 8232
112 Ga0081540_1011723 3300005983 Bacteria 5835
113 Ga0081540_1025394 3300005983 Bacteria 3410
114 Ga0081540_1025638 3300005983 Bacteria 3387
115 Ga0081539_10000008 3300005985 Bacteria 525071
116 Ga0081539_10087741 3300005985 Bacteria 1615
117 Ga0070717_10000145 3300006028 Bacteria 52677
118 Ga0070717_10071051 3300006028 Bacteria 2902
119 Ga0070717_10177938 3300006028 Bacteria 1853
120 Ga0075365_10004996 3300006038 Bacteria 7101
121 Ga0075365_10010461 3300006038 Bacteria 5405
122 Ga0075365_10042958 3300006038 Bacteria 2957
123 Ga0075363_100029350 3300006048 Bacteria 2838
124 Ga0075364_10049922 3300006051 Bacteria 2729
125 Ga0070715_10000518 3300006163 Bacteria 10086
126 Ga0070715_10002065 3300006163 Bacteria 6058
127 Ga0070716_100001181 3300006173 Bacteria 11493
128 Ga0070716_100004753 3300006173 Bacteria 6515
129 Ga0070716_100056915 3300006173 Bacteria 2245
130 Ga0070716_100149426 3300006173 Bacteria 1501
131 Ga0070712_100003369 3300006175 Bacteria 9825
132 Ga0070712_100005502 3300006175 Bacteria 7844
133 Ga0070712_100056388 3300006175 Bacteria 2756
134 Ga0070712_100148768 3300006175 Bacteria 1795
135 Ga0075367_10012781 3300006178 Bacteria 4492
136 Ga0075367_10127186 3300006178 Bacteria 1573
137 Ga0075369_10027992 3300006186 Bacteria 2360
138 Ga0097621_100014688 3300006237 Bacteria 5868
139 Ga0075430_100031338 3300006846 Bacteria 4513
140 Ga0075434_100018371 3300006871 Bacteria 6754
141 Ga0075434_100186318 3300006871 Bacteria 2096
142 Ga0075434_100212097 3300006871 Bacteria 1956
143 Ga0068865_100021154 3300006881 Bacteria 4228
144 Ga0075436_100179352 3300006914 Bacteria 1497
145 Ga0097620_100022408 3300006931 Bacteria 6333
146 Ga0097620_100109447 3300006931 Bacteria 2824
147 Ga0097620_100281553 3300006931 Bacteria 1756
148 Ga0099824_1012951 3300006942 Bacteria 8862
149 Ga0099822_1022362 3300006943 Bacteria 5978
150 Ga0075435_100088878 3300007076 Bacteria 2547
151 Ga0099794_10067435 3300007265 Bacteria 1748
152 Ga0099795_10012669 3300007788 Bacteria 2565
153 Ga0105251_10039996 3300009011 Bacteria 2288
154 Ga0105240_10022376 3300009093 Bacteria 8381
155 Ga0105240_10024287 3300009093 Bacteria 7996
156 Ga0105240_10038576 3300009093 Bacteria 6125
157 Ga0105240_10340122 3300009093 Bacteria 1705
158 Ga0105245_10145518 3300009098 Bacteria 2236
159 Ga0105245_10305752 3300009098 Bacteria 1562
160 Ga0105241_10052392 3300009174 Bacteria 3115
161 Ga0105242_10048793 3300009176 Bacteria 3442
162 Ga0105237_10084725 3300009545 Bacteria 3160
163 Ga0105238_10005212 3300009551 Bacteria 12844
164 Ga0105238_10062381 3300009551 Bacteria 3728
165 Ga0099796_10000366 3300010159 Bacteria 7370
166 Ga0105239_10006165 3300010375 Bacteria 13952
167 Ga0105239_10009620 3300010375 Bacteria 10875
168 Ga0105239_10034348 3300010375 Bacteria 5568
169 Ga0105239_10411898 3300010375 Bacteria 1530
170 Ga0105246_10013898 3300011119 Bacteria 5053
171 Ga0105246_10201093 3300011119 Bacteria 1549
172 Ga0157370_10097003 3300013104 Bacteria 2765
173 Ga0157370_10104462 3300013104 Bacteria 2652
174 Ga0157370_10120555 3300013104 Bacteria 2449
175 Ga0157370_10164459 3300013104 Bacteria 2064
176 Ga0157369_10007176 3300013105 Bacteria 12838
177 Ga0157369_10009052 3300013105 Bacteria 11400
178 Ga0157369_10014447 3300013105 Bacteria 8914
179 Ga0157369_10041320 3300013105 Bacteria 5034
180 Ga0157374_10036899 3300013296 Bacteria 4480
181 Ga0157374_10095736 3300013296 Bacteria 2839
182 Ga0157374_10196900 3300013296 Bacteria 1972
183 Ga0157374_10399976 3300013296 Bacteria 1370
184 Ga0157378_10006607 3300013297 Bacteria 10129
185 Ga0163162_10114061 3300013306 Bacteria 2801
186 Ga0157372_10151184 3300013307 Bacteria 2680
187 Ga0157375_10073723 3300013308 Bacteria 3433
188 Ga0163163_10096259 3300014325 Bacteria 2980
189 Ga0163163_10166436 3300014325 Bacteria 2251
190 Ga0163163_10265921 3300014325 Bacteria 1766
191 Ga0163163_10334529 3300014325 Bacteria 1569
192 Ga0157380_10146888 3300014326 Bacteria 2033
193 Ga0157377_10030319 3300014745 Bacteria 2929
194 Ga0157377_10183548 3300014745 Bacteria 1317
195 Ga0157376_10027176 3300014969 Bacteria 4533
196 Ga0163161_10032886 3300017792 Bacteria 3705
197 Ga0213875_10000361 3300021388 Bacteria 42326
198 Ga0213875_10000707 3300021388 Bacteria 25641
199 Ga0213871_10005669 3300021441 Bacteria 2593
200 Ga0209677_106517 3300025253 Bacteria 2742
201 Ga0209233_1005956 3300025261 Bacteria 3989
202 Ga0209564_1000468 3300025295 Bacteria 67696
203 Ga0209758_1002244 3300025297 Bacteria 20051
204 Ga0209758_1003548 3300025297 Bacteria 14034
205 Ga0207656_10037349 3300025321 Bacteria 2043
206 Ga0207653_10011019 3300025885 Bacteria 2823
207 Ga0207692_10000559 3300025898 Bacteria 13246
208 Ga0207692_10001804 3300025898 Bacteria 8121
209 Ga0207710_10038563 3300025900 Bacteria 2113
210 Ga0207680_10033605 3300025903 Bacteria 2927
211 Ga0207647_10005540 3300025904 Bacteria 9241
212 Ga0207685_10018857 3300025905 Bacteria 2262
213 Ga0207699_10002006 3300025906 Bacteria 9614
214 Ga0207699_10010283 3300025906 Bacteria 4690
215 Ga0207699_10101472 3300025906 Bacteria 1827
216 Ga0207645_10057321 3300025907 Bacteria 2487
217 Ga0207654_10000941 3300025911 Bacteria 15998
218 Ga0207707_10001221 3300025912 Bacteria 24149
219 Ga0207707_10008851 3300025912 Bacteria 8743
220 Ga0207707_10024670 3300025912 Bacteria 5262
221 Ga0207707_10079231 3300025912 Bacteria 2868
222 Ga0207695_10001321 3300025913 Bacteria 42037
223 Ga0207695_10390338 3300025913 Bacteria 1277
224 Ga0207671_10194508 3300025914 Bacteria 1582
225 Ga0207693_10000587 3300025915 Bacteria 32588
226 Ga0207693_10003437 3300025915 Bacteria 13514
227 Ga0207693_10009341 3300025915 Bacteria 7995
228 Ga0207693_10038531 3300025915 Bacteria 3764
229 Ga0207693_10324369 3300025915 Bacteria 1205
230 Ga0207663_10000147 3300025916 Bacteria 32518
231 Ga0207663_10009185 3300025916 Bacteria 5213
232 Ga0207663_10021463 3300025916 Bacteria 3677
233 Ga0207663_10105274 3300025916 Bacteria 1904
234 Ga0207663_10112273 3300025916 Bacteria 1851
235 Ga0207660_10011742 3300025917 Bacteria 5711
236 Ga0207662_10031980 3300025918 Bacteria 3059
237 Ga0207657_10001936 3300025919 Bacteria 22360
238 Ga0207657_10159700 3300025919 Bacteria 1831
239 Ga0207652_10011278 3300025921 Bacteria 7200
240 Ga0207652_10125870 3300025921 Bacteria 2282
241 Ga0207652_10226643 3300025921 Bacteria 1684
242 Ga0207694_10000135 3300025924 Bacteria 75715
243 Ga0207694_10040401 3300025924 Bacteria 3591
244 Ga0207687_10174235 3300025927 Bacteria 1662
245 Ga0207700_10003851 3300025928 Bacteria 8771
246 Ga0207700_10004315 3300025928 Bacteria 8361
247 Ga0207700_10008644 3300025928 Bacteria 6323
248 Ga0207700_10117143 3300025928 Bacteria 2153
249 Ga0207700_10220680 3300025928 Bacteria 1607
250 Ga0207664_10004039 3300025929 Bacteria 9893
251 Ga0207664_10150204 3300025929 Bacteria 1978
252 Ga0207644_10008140 3300025931 Bacteria 6868
253 Ga0207690_10110677 3300025932 Bacteria 1978
254 Ga0207706_10104170 3300025933 Bacteria 2496
255 Ga0207706_10130180 3300025933 Bacteria 2213
256 Ga0207709_10231068 3300025935 Bacteria 1340
257 Ga0207670_10021810 3300025936 Bacteria 3957
258 Ga0207670_10076584 3300025936 Bacteria 2328
259 Ga0207669_10033658 3300025937 Bacteria 2895
260 Ga0207665_10000265 3300025939 Bacteria 36482
261 Ga0207665_10000868 3300025939 Bacteria 20427
262 Ga0207665_10019708 3300025939 Bacteria 4433
263 Ga0207665_10024757 3300025939 Bacteria 3959
264 Ga0207665_10131249 3300025939 Bacteria 1779
265 Ga0207691_10047301 3300025940 Bacteria 3948
266 Ga0207691_10313070 3300025940 Bacteria 1347
267 Ga0207711_10007436 3300025941 Bacteria 9168
268 Ga0207689_10143669 3300025942 Bacteria 1966
269 Ga0207661_10001701 3300025944 Bacteria 15009
270 Ga0207661_10010680 3300025944 Bacteria 6616
271 Ga0207661_10099691 3300025944 Bacteria 2437
272 Ga0207661_10214549 3300025944 Bacteria 1698
273 Ga0207679_10071264 3300025945 Bacteria 2621
274 Ga0207667_10027192 3300025949 Bacteria 6234
275 Ga0207667_10089554 3300025949 Bacteria 3180
276 Ga0207667_10194455 3300025949 Bacteria 2081
277 Ga0207667_10469160 3300025949 Bacteria 1278
278 Ga0207668_10024726 3300025972 Bacteria 3880
279 Ga0207668_10167798 3300025972 Bacteria 1718
280 Ga0207640_10050659 3300025981 Bacteria 2696
281 Ga0207640_10135616 3300025981 Bacteria 1786
282 Ga0207677_10060095 3300026023 Bacteria 2625
283 Ga0207677_10131688 3300026023 Bacteria 1900
284 Ga0207703_10034995 3300026035 Bacteria 3990
285 Ga0207703_10039027 3300026035 Bacteria 3793
286 Ga0207703_10211074 3300026035 Bacteria 1731
287 Ga0207703_10216815 3300026035 Bacteria 1709
288 Ga0207639_10181025 3300026041 Bacteria 1793
289 Ga0207678_10019160 3300026067 Bacteria 6007
290 Ga0207678_10020831 3300026067 Bacteria 5746
291 Ga0207678_10073828 3300026067 Bacteria 2923
292 Ga0207678_10240879 3300026067 Bacteria 1549
293 Ga0207708_10030112 3300026075 Bacteria 4117
294 Ga0207702_10000026 3300026078 Bacteria 186067
295 Ga0207702_10000334 3300026078 Bacteria 54042
296 Ga0207702_10100878 3300026078 Bacteria 2548
297 Ga0207702_10272074 3300026078 Bacteria 1598
298 Ga0207648_10031210 3300026089 Bacteria 4711
299 Ga0207648_10039811 3300026089 Bacteria 4131
300 Ga0207676_10079317 3300026095 Bacteria 2662
301 Ga0207676_10146806 3300026095 Bacteria 2026
302 Ga0207674_10011940 3300026116 Bacteria 9737
303 Ga0207674_10082105 3300026116 Bacteria 3225
304 Ga0207674_10134043 3300026116 Bacteria 2440
305 Ga0207674_10212892 3300026116 Bacteria 1881
306 Ga0207675_100174465 3300026118 Bacteria 2056
307 Ga0207683_10038657 3300026121 Bacteria 4161
308 Ga0207683_10267012 3300026121 Bacteria 1563
309 Ga0207698_10079102 3300026142 Bacteria 2643
310 Ga0207698_10287174 3300026142 Bacteria 1525
311 Ga0209589_1000004 3300027357 Bacteria 578529
312 Ga0209489_100004 3300027361 Bacteria 578529
313 Ga0209700_100004 3300027363 Bacteria 578529
314 Ga0209813_10049293 3300027866 Bacteria 1310
315 Ga0268266_10012789 3300028379 Bacteria 7250
316 Ga0268266_10022968 3300028379 Bacteria 5308
317 Ga0268266_10026743 3300028379 Bacteria 4909
318 Ga0268266_10107150 3300028379 Bacteria 2471
319 Ga0268266_10136244 3300028379 Bacteria 2199
320 Ga0268265_10433400 3300028380 Bacteria 1223
321 Ga0268264_10000096 3300028381 Bacteria 230188
322 Ga0265334_10003786 3300028573 Bacteria 6837
323 Ga0265318_10019074 3300028577 Bacteria 2785
324 Ga0265323_10000913 3300028653 Bacteria 15574
325 Ga0265322_10001611 3300028654 Bacteria 7210
326 Ga0265336_10000099 3300028666 Bacteria 66151
327 Ga0307517_10000315 3300028786 Bacteria 84020
328 Ga0307515_10053148 3300028794 Bacteria 5985
329 Ga0307515_10198845 3300028794 Bacteria 1887
330 Ga0265338_10000207 3300028800 Bacteria 110193
331 Ga0265324_10001958 3300029957 Bacteria 11041
332 Ga0265330_10091349 3300031235 Bacteria 1307
333 Ga0265332_10000585 3300031238 Bacteria 24067
334 Ga0265332_10013242 3300031238 Bacteria 3658
335 Ga0265325_10000053 3300031241 Bacteria 77918
336 Ga0265325_10115871 3300031241 Bacteria 1297
337 Ga0265329_10013050 3300031242 Bacteria 2971
338 Ga0265340_10047489 3300031247 Bacteria 2090
339 Ga0265339_10001532 3300031249 Bacteria 17061
340 Ga0265339_10010735 3300031249 Bacteria 5673
341 Ga0265339_10041311 3300031249 Bacteria 2561
342 Ga0265316_10029807 3300031344 Bacteria 4481
343 Ga0265316_10158991 3300031344 Bacteria 1690
344 Ga0307408_100033037 3300031548 Bacteria 3612
345 Ga0265313_10017522 3300031595 Bacteria 4066
346 Ga0307508_10021406 3300031616 Bacteria 5879
347 Ga0307508_10081646 3300031616 Bacteria 2814
348 Ga0265314_10003384 3300031711 Bacteria 15458
349 Ga0265314_10017116 3300031711 Bacteria 5699
350 Ga0265342_10001010 3300031712 Bacteria 27698
351 Ga0307516_10007232 3300031730 Bacteria 12792
352 Ga0307516_10013179 3300031730 Bacteria 8828
353 Ga0307410_10173541 3300031852 Bacteria 1627
354 Ga0307510_10008253 3300033180 Bacteria 12409
355 Ga0315911_1000014 3300033442 Bacteria 207605
356 Ga0373926_0022692 3300035083 Bacteria 2177
357 Ga0373934_0012159 3300035086 Bacteria 3248
358 Ga0373923_0042724 3300035111 Bacteria 1873
359 Ga0373923_0124773 3300035111 Bacteria 1153
360 Ga0373936_0059185 3300035113 Bacteria 1561
361 Ga0373953_0036895 3300035117 Bacteria 1926
362 Ga0373954_0041365 3300035118 Bacteria 2149
363 Ga0373956_0004737 3300035119 Bacteria 5443
364 Ga0373956_0007387 3300035119 Bacteria 4423
365 Ga0373943_0080077 3300035170 Bacteria 1673
366 Ga0373955_0006675 3300035172 Bacteria 5264
367 Ga0373955_0013779 3300035172 Bacteria 3920
368 Ga0373955_0027666 3300035172 Bacteria 2934
369 Ga0373942_0013749 3300035207 Bacteria 1951
370 Ga0373961_0001489 3300035241 Bacteria 6855
371 Ga0373924_0013117 3300035410 Bacteria 3109
372 Ga0373931_0020616 3300035691 Bacteria 3300
373 Ga0373935_0002078 3300035692 Bacteria 11354
374 Ga0373935_0162045 3300035692 Bacteria 1525
375 Ga0373927_0003925 3300035695 Bacteria 10542
376 Ga0373927_0027376 3300035695 Bacteria 3722
377 Ga0373927_0042386 3300035695 Bacteria 2948
378 Ga0373927_0058259 3300035695 Bacteria 2498
379 Ga0373927_0168961 3300035695 Bacteria 1433
380 Ga0373933_0000020 3300035724 Bacteria 97124
381 Ga0373933_0005055 3300035724 Bacteria 7197
382 Ga0373933_0015421 3300035724 Bacteria 4258
383 Ga0373933_0089742 3300035724 Bacteria 1895
384 Ga0373947_0004109 3300035725 Bacteria 8559
385 Ga0373947_0016136 3300035725 Bacteria 4292
386 Ga0373937_0113505 3300036401 Bacteria 2521
387 Ga0373925_0008691 3300037068 Bacteria 7398
388 Ga0373925_0029927 3300037068 Bacteria 3994
389 Ga0373925_0071012 3300037068 Bacteria 2633
390 Ga0373925_0081602 3300037068 Bacteria 2459
391 Ga0373925_0164504 3300037068 Bacteria 1749
392 Ga0395900_0118079 3300037418 Bacteria 2722
393 Ga0395900_0119806 3300037418 Bacteria 2701
394 Ga0395898_0013618 3300037466 Bacteria 8369
395 Ga0395898_0023411 3300037466 Bacteria 6242
396 Ga0395898_0188151 3300037466 Bacteria 1973
397 Ga0395905_0201734 3300037471 Bacteria 1865
398 Ga0395905_0250688 3300037471 Bacteria 1654
399 Ga0395905_0290347 3300037471 Bacteria 1522
400 Ga0436364_0717863 3300037853 Bacteria 145182
401 Ga0436364_1385478 3300037853 Bacteria 81069
402 Ga0395901_0112639 3300038443 Bacteria 2857
403 Ga0436365_0833193 3300039437 Bacteria 2395
404 Ga0436365_0944955 3300039437 Bacteria 12493
405 Ga0436365_1148872 3300039437 Bacteria 1963
406 Ga0436360_0304485 3300039438 Bacteria 1858
407 Ga0436360_0597135 3300039438 Bacteria 1667
408 Ga0436361_1068668 3300039447 Bacteria 2293
409 Ga0436363_0034386 3300039450 Bacteria 2265
410 Ga0436362_0367954 3300039453 Bacteria 3746
411 Ga0436362_0881328 3300039453 Bacteria 2093
412 Ga0436362_1098843 3300039453 Bacteria 1904
413 Ga0451853_0587007 3300041512 Bacteria 1605
414 Ga0466966_0020722 3300044684 Bacteria 4321
415 Ga0466963_0118604 3300044694 Bacteria 1820
416 Ga0466957_0056724 3300044842 Bacteria 2396
417 Ga0466959_0191967 3300045049 Bacteria 1425
418 Ga0466958_0159871 3300045836 Bacteria 1423
419 Ga0495592_0027096 3300046454 Bacteria 4344
420 Ga0495592_0182465 3300046454 Bacteria 1428
421 Ga0495603_0007969 3300046455 Bacteria 6393
422 Ga0495603_0011811 3300046455 Bacteria 5284
423 Ga0495629_0000466 3300046459 Bacteria 33891
424 Ga0495629_0012059 3300046459 Bacteria 6265
425 Ga0495629_0044521 3300046459 Bacteria 3114
426 Ga0495638_0011966 3300046460 Bacteria 5965
427 Ga0495638_0096681 3300046460 Bacteria 1772
428 Ga0495641_0044847 3300046461 Bacteria 2038
429 Ga0495641_0052409 3300046461 Bacteria 1860
430 Ga0495651_0015966 3300046462 Bacteria 5816
431 Ga0495653_0067068 3300046463 Bacteria 2696
432 Ga0495582_0030311 3300046473 Bacteria 2969
433 Ga0495582_0032892 3300046473 Bacteria 2850
434 Ga0495639_0007911 3300046475 Bacteria 4569
435 Ga0495639_0118438 3300046475 Bacteria 1262
436 Ga0495662_0015796 3300046476 Bacteria 3663
437 Ga0495664_0015534 3300046477 Bacteria 4329
438 Ga0495664_0021335 3300046477 Bacteria 3741
439 Ga0495584_0144741 3300046491 Bacteria 1207
440 Ga0495594_0037330 3300046499 Bacteria 2650
441 Ga0495596_0061496 3300046500 Bacteria 1462
442 Ga0495606_0005211 3300046507 Bacteria 12548
443 Ga0495606_0066821 3300046507 Bacteria 2279
444 Ga0495608_0010573 3300046511 Bacteria 6438
445 Ga0495618_0008064 3300046514 Bacteria 6376
446 Ga0495618_0048697 3300046514 Bacteria 2676
447 Ga0495618_0126615 3300046514 Bacteria 1636
448 Ga0495620_0033987 3300046515 Bacteria 2309
449 Ga0495643_0051314 3300046522 Bacteria 2219
450 Ga0495644_0061352 3300046523 Bacteria 1413
451 Ga0495648_0005947 3300046524 Bacteria 10041
452 Ga0495666_0096924 3300046526 Bacteria 1390
453 Ga0495652_0073214 3300046529 Bacteria 2853
454 Ga0495665_0011670 3300046531 Bacteria 4760
455 Ga0495586_0053894 3300046535 Bacteria 2179
456 Ga0495586_0109562 3300046535 Bacteria 1536
457 Ga0495587_0012527 3300046536 Bacteria 5333
458 Ga0495597_0115967 3300046542 Bacteria 1120
459 Ga0495645_0163837 3300046543 Bacteria 1535
460 Ga0495622_0043219 3300046557 Bacteria 2095
461 Ga0495667_0091389 3300046559 Bacteria 1971
462 Ga0495634_0020776 3300046642 Bacteria 4651
463 Ga0495625_0127786 3300046660 Bacteria 1724
464 Ga0495625_0144430 3300046660 Bacteria 1603
465 Ga0495625_0156820 3300046660 Bacteria 1527
466 Ga0495661_0052512 3300046665 Bacteria 2456
467 Ga0495588_0041197 3300046674 Bacteria 2358
468 Ga0495588_0049500 3300046674 Bacteria 2161
469 Ga0495588_0099240 3300046674 Bacteria 1529
470 Ga0495599_0035060 3300046678 Bacteria 3150
471 Ga0495623_0049716 3300046679 Bacteria 2656
472 Ga0495647_0003525 3300046681 Bacteria 5011
473 Ga0495658_0002587 3300046683 Bacteria 9101
474 Ga0495613_0175298 3300046689 Bacteria 1520
475 Ga0495624_0003820 3300046690 Bacteria 11134
476 Ga0495670_0009827 3300046691 Bacteria 4704
477 Ga0495660_0072680 3300046810 Bacteria 1821
478 Ga0495604_0056974 3300047317 Bacteria 3005
479 Ga0495604_0247504 3300047317 Bacteria 1216
480 Ga0495674_0046907 3300047319 Bacteria 3833
481 Ga0495672_0025049 3300047320 Bacteria 3828
482 Ga0495672_0058436 3300047320 Bacteria 2235
483 Ga0495680_0033039 3300047322 Bacteria 4193
484 Ga0495680_0043678 3300047322 Bacteria 3547
485 Ga0495680_0251688 3300047322 Bacteria 1252
486 Ga0495675_0009663 3300047444 Bacteria 6009
487 Ga0495684_0008560 3300047471 Bacteria 7922
488 Ga0495684_0009161 3300047471 Bacteria 7644
489 Ga0495684_0053690 3300047471 Bacteria 3075
490 Ga0495686_0061190 3300047472 Bacteria 2339
491 Ga0495593_0053109 3300047673 Bacteria 2139
492 Ga0495602_0032475 3300048088 Bacteria 4913
493 Ga0495615_0021322 3300048090 Bacteria 1461
494 Ga0496100_0047657 3300048903 Bacteria 2763
495 Ga0496100_0065357 3300048903 Bacteria 2410
496 Ga0496100_0068985 3300048903 Bacteria 2353
497 Ga0496101_0084652 3300048904 Bacteria 2349
498 Ga0496102_0039922 3300048905 Bacteria 4243
499 Ga0496103_0052470 3300048906 Bacteria 2526
500 Ga0496103_0063854 3300048906 Bacteria 2294
501 Ga0496104_0000117 3300048907 Bacteria 74244
502 Ga0496104_0007504 3300048907 Bacteria 9644
503 Ga0496104_0049526 3300048907 Bacteria 3961
504 Ga0496104_0122500 3300048907 Bacteria 2496
505 Ga0496104_0319680 3300048907 Bacteria 1465
506 Ga0496105_0000094 3300048908 Bacteria 61105
507 Ga0496105_0004442 3300048908 Bacteria 10558
508 Ga0496105_0005994 3300048908 Bacteria 9281
509 Ga0496105_0023954 3300048908 Bacteria 4958
510 Ga0496105_0078970 3300048908 Bacteria 2717
511 Ga0496105_0086676 3300048908 Bacteria 2587
512 Ga0496105_0091132 3300048908 Bacteria 2518
513 Ga0496105_0214679 3300048908 Bacteria 1567
514 Ga0496105_0281198 3300048908 Bacteria 1342
515 Ga0496106_0014603 3300048909 Bacteria 5803
516 Ga0496106_0018567 3300048909 Bacteria 5146
517 Ga0496106_0044268 3300048909 Bacteria 3341
518 Ga0496107_0004733 3300048910 Bacteria 9246
519 Ga0496107_0021996 3300048910 Bacteria 4504
520 Ga0496107_0033711 3300048910 Bacteria 3665
521 Ga0496108_0020079 3300048911 Bacteria 5490
522 Ga0496108_0037147 3300048911 Bacteria 4056
523 Ga0496108_0042427 3300048911 Bacteria 3797
524 Ga0496108_0129337 3300048911 Bacteria 2170
525 Ga0496108_0278206 3300048911 Bacteria 1457
526 Ga0496109_0018926 3300048912 Bacteria 6062
527 Ga0496109_0027629 3300048912 Bacteria 5069
528 Ga0496109_0118438 3300048912 Bacteria 2465
529 Ga0496109_0130914 3300048912 Bacteria 2341
530 Ga0496110_0005325 3300048913 Bacteria 10075
531 Ga0496110_0012396 3300048913 Bacteria 7009
532 Ga0496110_0024628 3300048913 Bacteria 5132
533 Ga0496110_0195436 3300048913 Bacteria 1837
534 Ga0496110_0197556 3300048913 Bacteria 1827
535 Ga0496110_0215241 3300048913 Bacteria 1747
536 Ga0496111_0009567 3300048914 Bacteria 6476
537 Ga0496111_0024061 3300048914 Bacteria 4283
538 Ga0496112_0000008 3300048915 Bacteria 310323
539 Ga0496112_0013508 3300048915 Bacteria 7542
540 Ga0496112_0014948 3300048915 Bacteria 7224
541 Ga0496112_0017925 3300048915 Bacteria 6662
542 Ga0496112_0040156 3300048915 Bacteria 4575
543 Ga0496112_0055672 3300048915 Bacteria 3890
544 Ga0496112_0178655 3300048915 Bacteria 2086
545 Ga0496113_0005488 3300048916 Bacteria 7913
546 Ga0496113_0012948 3300048916 Bacteria 5626
547 Ga0496113_0017879 3300048916 Bacteria 4928
548 Ga0496113_0064750 3300048916 Bacteria 2765
549 Ga0496113_0104678 3300048916 Bacteria 2196
550 Ga0496113_0115606 3300048916 Bacteria 2093
551 Ga0496114_0029771 3300048917 Bacteria 4488
552 Ga0496114_0067418 3300048917 Bacteria 3002
553 Ga0496114_0250670 3300048917 Bacteria 1558
554 Ga0496115_0002098 3300048918 Bacteria 14267
555 Ga0496115_0024242 3300048918 Bacteria 4713
556 Ga0496115_0065265 3300048918 Bacteria 2940
557 Ga0496115_0172525 3300048918 Bacteria 1788
558 Ga0496116_0002352 3300048919 Bacteria 19981
559 Ga0496117_0038666 3300048920 Bacteria 3533
560 Ga0496117_0076062 3300048920 Bacteria 2228
561 Ga0496118_0014853 3300048921 Bacteria 7255
562 Ga0496118_0157757 3300048921 Bacteria 1409
563 Ga0496119_0000353 3300048922 Bacteria 64435
564 Ga0496119_0024309 3300048922 Bacteria 4266
565 Ga0496119_0045797 3300048922 Bacteria 2739
566 Ga0496120_0065220 3300048923 Bacteria 2019
567 Ga0496121_0000774 3300048924 Bacteria 58528
568 Ga0496121_0001934 3300048924 Bacteria 33033
569 Ga0496121_0002911 3300048924 Bacteria 25109
570 Ga0496121_0016680 3300048924 Bacteria 7559
571 Ga0496121_0020156 3300048924 Bacteria 6620
572 Ga0496121_0053472 3300048924 Bacteria 3383
573 Ga0496121_0091046 3300048924 Bacteria 2382
574 Ga0496121_0129591 3300048924 Bacteria 1890
575 Ga0496121_0131969 3300048924 Bacteria 1868
576 Ga0496121_0286779 3300048924 Bacteria 1123
577 Ga0496122_0037719 3300048925 Bacteria 3885
578 Ga0496124_0098837 3300048927 Bacteria 2367
579 Ga0496124_0135649 3300048927 Bacteria 1949
580 Ga0496124_0145091 3300048927 Bacteria 1869
581 Ga0496125_0002472 3300048928 Bacteria 23972
582 Ga0496125_0007003 3300048928 Bacteria 12067
583 Ga0496126_0002033 3300048929 Bacteria 28509
584 Ga0496126_0002400 3300048929 Bacteria 25436
585 Ga0496126_0020156 3300048929 Bacteria 6544
586 Ga0496126_0033693 3300048929 Bacteria 4817
587 Ga0496126_0059027 3300048929 Bacteria 3456
588 Ga0496126_0061742 3300048929 Bacteria 3365
589 Ga0496126_0063287 3300048929 Bacteria 3316
590 Ga0496126_0087483 3300048929 Bacteria 2745
591 Ga0496126_0119361 3300048929 Bacteria 2288
592 Ga0496126_0128843 3300048929 Bacteria 2188
593 Ga0496126_0175270 3300048929 Bacteria 1824
594 Ga0496126_0201062 3300048929 Bacteria 1683
595 Ga0496126_0286318 3300048929 Bacteria 1364
596 Ga0501033_0040401 3300049570 Bacteria 3483
597 Ga0501034_0042724 3300049571 Bacteria 4588
598 Ga0501034_0145573 3300049571 Bacteria 2347
599 Ga0501038_0004519 3300049574 Bacteria 12948
600 Ga0501047_0135327 3300049581 Bacteria 2345
601 Ga0501047_0198563 3300049581 Bacteria 1867
602 Ga0501047_0346463 3300049581 Bacteria 1323
603 Ga0501067_0021106 3300049583 Bacteria 3604
604 Ga0501067_0085250 3300049583 Bacteria 1753
605 Ga0501069_0049448 3300049585 Bacteria 2337
606 Ga0501074_0132883 3300049590 Bacteria 1780
607 Ga0501076_0087844 3300049592 Bacteria 2499
608 Ga0501080_0400202 3300049742 Bacteria 1235
609 Ga0501081_0172249 3300049743 Bacteria 1563
610 Ga0501035_0074883 3300049822 Bacteria 2994
611 Ga0501035_0082145 3300049822 Bacteria 2844
612 Ga0501044_0001046 3300049823 Bacteria 33251
613 Ga0501044_0023541 3300049823 Bacteria 6551
614 Ga0501044_0225603 3300049823 Bacteria 1823
615 nmdc:mga00v17_16765_c1 3300050491 Bacteria 4132
616 nmdc:mga00v17_215448_c1 3300050491 Bacteria 1243
617 nmdc:mga0yw44_37395_c1 3300050492 Bacteria 2866
618 nmdc:mga0k408_60329_c1 3300050493 Bacteria 2204
619 nmdc:mga06z11_168427_c1 3300050494 Bacteria 1256
620 nmdc:mga04h51_6761_c1 3300050495 Bacteria 2993
621 nmdc:mga0n895_132777_c1 3300050512 Bacteria 2515
622 nmdc:mga0n895_16469_c1 3300050512 Bacteria 6784
623 nmdc:mga0n895_437343_c1 3300050512 Bacteria 1321
624 nmdc:mga0rr50_105781_c1 3300050513 Bacteria 2219
625 nmdc:mga0rr50_245520_c1 3300050513 Bacteria 1485
626 nmdc:mga08x19_26093_c1 3300050514 Bacteria 3644
627 nmdc:mga0a205_204781_c1 3300050515 Bacteria 1862
628 nmdc:mga0sz30_1061_c1 3300050516 Bacteria 9903
629 Ga0500635_0002612 3300053080 Bacteria 4480
630 Ga0495595_0008168 3300053084 Bacteria 4293
631 Ga0495595_0024982 3300053084 Bacteria 2642
632 Ga0500644_0005676 3300053088 Bacteria 3156
633 Ga0500647_0034083 3300053091 Bacteria 2430
634 Ga0500651_0029959 3300053093 Bacteria 3422
635 Ga0500566_0000631 3300053094 Bacteria 19674
636 Ga0500566_0000771 3300053094 Bacteria 18098
637 Ga0500641_0007701 3300053096 Bacteria 3838
638 Ga0500641_0053911 3300053096 Bacteria 1661
639 Ga0500648_108119 3300053097 Bacteria 1539
640 Ga0500554_004600 3300053102 Bacteria 2937
641 Ga0500556_0000002 3300053104 Bacteria 773626
642 Ga0500595_000928 3300053119 Bacteria 16602
643 Ga0500595_001846 3300053119 Bacteria 10966
644 Ga0500595_004756 3300053119 Bacteria 6022
645 Ga0500595_026781 3300053119 Bacteria 1982
646 Ga0500607_081527 3300053121 Bacteria 1649
647 Ga0500618_003955 3300053125 Bacteria 4903
648 Ga0500642_0000026 3300053130 Bacteria 127731
649 Ga0500642_0066895 3300053130 Bacteria 1627
650 Ga0500652_017951 3300053131 Bacteria 2602
651 Ga0500559_0000973 3300053136 Bacteria 17925
652 Ga0500559_0087571 3300053136 Bacteria 1422
653 Ga0500568_0000800 3300053139 Bacteria 22201
654 Ga0500568_0023341 3300053139 Bacteria 2631
655 Ga0500568_0039806 3300053139 Bacteria 1895
656 Ga0500573_0025082 3300053140 Bacteria 3428
657 Ga0500577_0000075 3300053142 Bacteria 23037
658 Ga0500603_000825 3300053150 Bacteria 7413
659 Ga0500604_0000131 3300053151 Bacteria 22701
660 Ga0500616_0000031 3300053153 Bacteria 415013
661 Ga0500622_0000583 3300053156 Bacteria 33081
662 Ga0500627_0035169 3300053158 Bacteria 2127
663 Ga0500633_0015572 3300053160 Bacteria 2186
664 Ga0500636_0006153 3300053177 Bacteria 6890
665 Ga0500636_0066123 3300053177 Bacteria 2103
666 Ga0500637_0030439 3300053178 Bacteria 3003
667 Ga0500567_054745 3300053723 Bacteria 1810
668 Ga0501082_0078639 3300060353 Bacteria 2845
669 Ga0466962_0003950 3300061719 Bacteria 7097
670 Ga0530510_0163211 3300061734 Bacteria 1649
671 2513659024 2513237096 Bacteria 8722461
672 2513673229 2513237098 Bacteria 9902361
673 2513695367 2513237101 Bacteria 7952346
674 2513860359 2513237137 Bacteria 9558895
675 2513891818 2513237141 Bacteria 8496279
676 2513921287 2513237145 Bacteria 8979722
677 2517894173 2517572143 Bacteria 9484767
678 2524466082 2524023210 Bacteria 9029266
679 2524536101 2524023228 Bacteria 10118060
680 2603861373 2602042107 Bacteria 6226103
681 2671123484 2667528175 Bacteria 7532676
682 2723843749 2721755755 Bacteria 8322773
683 2728748724 2728368998 Bacteria 8720350
684 2793073154 2791355197 Bacteria 8420563
685 2793079419
686 2857530144 2857524615 Bacteria 6615449
687 2874612259 2874604998 Bacteria 7834745
688 2876811395 2876808645 Bacteria 8824342
689 2879114790 2879110137 Bacteria 8907982
690 2885376380 2885374607 Bacteria 8927485
691 2885391311 2885383462 Bacteria 9473874
692 2889042051 2889033259 Bacteria 9099371
693 2893066037 2893066018 Bacteria 6158120
694 2903776343 2903768456 Bacteria 9749579
695 2904697398 2904690495 Bacteria 9412302
696 2904705297
697 2906610988
698 2906639547 2906635258 Bacteria 8601019
699 2906661786 2906660503 Bacteria 8595048
700 2908744501 2908739725 Bacteria 8628932
701 2908762363 2908756301 Bacteria 8864324
702 2919079583 2919073203 Bacteria 6531949
703 2922366079 2922361189 Bacteria 7436256
704 2922387346 2922386360 Bacteria 7017218
705 2922428328
706 2935635835 2935630451 Bacteria 8169952
707 2941512466 2941507105 Bacteria 8166816
708 2941520167 2941515067 Bacteria 8166720
709 2941528437 2941523033 Bacteria 8169134
710 3005478312 3005474847 Bacteria 9259049
711 8006942904 8006933436 Bacteria 10410654
712 8006972857 8006964411 Bacteria 8966052
713 8006982624 8006973647 Bacteria 10679141
714 8006988686 8006984368 Bacteria 9651211
715 8006994394 8006994254 Bacteria 8309700
716 8019566614 8019565922 Bacteria 9639779
717 8056681110 8056673599 Bacteria 7871253
718 8056686522 8056681323 Bacteria 8472857
719 8056694739 8056689827 Bacteria 6712655
720 Ga0213874_10019925
721 JGI25406J46586_10000014
722 JGI25153J46596_10000519
723 JGI25160J50197_1019531
724 JGI25404J52841_10016926
725 JGI25404J52841_10021716
726 Ga0070683_100006136
727 Ga0070683_100217251
728 Ga0070666_10043945
729 Ga0070680_100013457
730 Ga0070680_100043545
731 Ga0070682_100043517
732 Ga0068868_100090617
733 Ga0070660_100038487
734 Ga0070691_10014147
735 Ga0070687_100111124
736 Ga0070661_100055612
737 Ga0070671_100058008
738 Ga0070674_100065770
739 Ga0070673_100101955
740 Ga0070688_100016782
741 Ga0070709_10002624
742 Ga0070709_10004205
743 Ga0070709_10020944
744 Ga0070714_100006438
745 Ga0070714_100177659
746 Ga0070713_100002174
747 Ga0070713_100016056
748 Ga0070710_10002118
749 Ga0070710_10054923
750 Ga0070711_100002093
751 Ga0070711_100004807
752 Ga0070711_100010964
753 Ga0070711_100047992
754 Ga0070711_100135021
755 Ga0070711_100202760
756 Ga0070700_100142124
757 Ga0070663_100059600
758 Ga0070663_100256409
759 Ga0070663_100279380
760 Ga0070678_100101106
761 Ga0070681_10065840
762 Ga0070681_10119737
763 Ga0070681_10188057
764 Ga0070681_10196067
765 Ga0068867_100113070
766 Ga0070685_10003228
767 Ga0070699_100374584
768 Ga0070679_100017653
769 Ga0070679_100022942
770 Ga0070679_100091642
771 Ga0070679_100108285
772 Ga0070684_100006435
773 Ga0070684_100035774
774 Ga0070684_100138959
775 Ga0070697_100040282
776 Ga0068853_100002914
777 Ga0068853_100006819
778 Ga0068853_100091570
779 Ga0068853_100305882
780 Ga0070665_100016672
781 Ga0070665_100071645
782 Ga0070665_100099361
783 Ga0070665_100120217
784 Ga0070665_100189362
785 Ga0070665_100203829
786 Ga0068855_100005255
787 Ga0068855_100056353
788 Ga0068855_100082669
789 Ga0068855_100139097
790 Ga0068855_100461813
791 Ga0070664_100168205
792 Ga0068857_100013640
793 Ga0068857_100019936
794 Ga0068857_100037481
795 Ga0068857_100142559
796 Ga0068854_100018641
797 Ga0068854_100057520
798 Ga0068854_100161294
799 Ga0068856_100000780
800 Ga0068856_100037538
801 Ga0068856_100066700
802 Ga0068856_100078653
803 Ga0068856_100151694
804 Ga0068856_100175382
805 Ga0070702_100102067
806 Ga0068852_100082378
807 Ga0068859_100022405
808 Ga0068859_100109449
809 Ga0068859_100281555
810 Ga0068864_100018659
811 Ga0068864_100042951
812 Ga0068861_100146091
813 Ga0068851_10011796
814 Ga0068863_100074960
815 Ga0068858_100077967
816 Ga0068858_100087053
817 Ga0068858_100149898
818 Ga0068860_100000724
819 Ga0068860_100068602
820 Ga0068862_100138149
821 Ga0068862_100244939
822 Ga0081455_10009713
823 Ga0081455_10010696
824 Ga0081455_10020391
825 Ga0081455_10040417
826 Ga0081455_10102682
827 Ga0081538_10046730
828 Ga0081540_1000311
829 Ga0081540_1003511
830 Ga0081540_1006842
831 Ga0081540_1011723
832 Ga0081540_1025394
833 Ga0081540_1025638
834 Ga0081539_10000008
835 Ga0081539_10087741
836 Ga0070717_10000145
837 Ga0070717_10071051
838 Ga0070717_10177938
839 Ga0075365_10004996
840 Ga0075365_10010461
841 Ga0075365_10042958
842 Ga0075363_100029350
843 Ga0075364_10049922
844 Ga0070715_10000518
845 Ga0070715_10002065
846 Ga0070716_100001181
847 Ga0070716_100004753
848 Ga0070716_100056915
849 Ga0070716_100149426
850 Ga0070712_100003369
851 Ga0070712_100005502
852 Ga0070712_100056388
853 Ga0070712_100148768
854 Ga0075367_10012781
855 Ga0075367_10127186
856 Ga0075369_10027992
857 Ga0097621_100014688
858 Ga0075430_100031338
859 Ga0075434_100018371
860 Ga0075434_100186318
861 Ga0075434_100212097
862 Ga0068865_100021154
863 Ga0075436_100179352
864 Ga0097620_100022408
865 Ga0097620_100109447
866 Ga0097620_100281553
867 Ga0099824_1012951
868 Ga0099822_1022362
869 Ga0075435_100088878
870 Ga0099794_10067435
871 Ga0099795_10012669
872 Ga0105251_10039996
873 Ga0105240_10022376
874 Ga0105240_10024287
875 Ga0105240_10038576
876 Ga0105240_10340122
877 Ga0105245_10145518
878 Ga0105245_10305752
879 Ga0105241_10052392
880 Ga0105242_10048793
881 Ga0105237_10084725
882 Ga0105238_10005212
883 Ga0105238_10062381
884 Ga0099796_10000366
885 Ga0105239_10006165
886 Ga0105239_10009620
887 Ga0105239_10034348
888 Ga0105239_10411898
889 Ga0105246_10013898
890 Ga0105246_10201093
891 Ga0157370_10097003
892 Ga0157370_10104462
893 Ga0157370_10120555
894 Ga0157370_10164459
895 Ga0157369_10007176
896 Ga0157369_10009052
897 Ga0157369_10014447
898 Ga0157369_10041320
899 Ga0157374_10036899
900 Ga0157374_10095736
901 Ga0157374_10196900
902 Ga0157374_10399976
903 Ga0157378_10006607
904 Ga0163162_10114061
905 Ga0157372_10151184
906 Ga0157375_10073723
907 Ga0163163_10096259
908 Ga0163163_10166436
909 Ga0163163_10265921
910 Ga0163163_10334529
911 Ga0157380_10146888
912 Ga0157377_10030319
913 Ga0157377_10183548
914 Ga0157376_10027176
915 Ga0163161_10032886
916 Ga0213875_10000361
917 Ga0213875_10000707
918 Ga0213871_10005669
919 Ga0209677_106517
920 Ga0209233_1005956
921 Ga0209564_1000468
922 Ga0209758_1002244
923 Ga0209758_1003548
924 Ga0207656_10037349
925 Ga0207653_10011019
926 Ga0207692_10000559
927 Ga0207692_10001804
928 Ga0207710_10038563
929 Ga0207680_10033605
930 Ga0207647_10005540
931 Ga0207685_10018857
932 Ga0207699_10002006
933 Ga0207699_10010283
934 Ga0207699_10101472
935 Ga0207645_10057321
936 Ga0207654_10000941
937 Ga0207707_10001221
938 Ga0207707_10008851
939 Ga0207707_10024670
940 Ga0207707_10079231
941 Ga0207695_10001321
942 Ga0207695_10390338
943 Ga0207671_10194508
944 Ga0207693_10000587
945 Ga0207693_10003437
946 Ga0207693_10009341
947 Ga0207693_10038531
948 Ga0207693_10324369
949 Ga0207663_10000147
950 Ga0207663_10009185
951 Ga0207663_10021463
952 Ga0207663_10105274
953 Ga0207663_10112273
954 Ga0207660_10011742
955 Ga0207662_10031980
956 Ga0207657_10001936
957 Ga0207657_10159700
958 Ga0207652_10011278
959 Ga0207652_10125870
960 Ga0207652_10226643
961 Ga0207694_10000135
962 Ga0207694_10040401
963 Ga0207687_10174235
964 Ga0207700_10003851
965 Ga0207700_10004315
966 Ga0207700_10008644
967 Ga0207700_10117143
968 Ga0207700_10220680
969 Ga0207664_10004039
970 Ga0207664_10150204
971 Ga0207644_10008140
972 Ga0207690_10110677
973 Ga0207706_10104170
974 Ga0207706_10130180
975 Ga0207709_10231068
976 Ga0207670_10021810
977 Ga0207670_10076584
978 Ga0207669_10033658
979 Ga0207665_10000265
980 Ga0207665_10000868
981 Ga0207665_10019708
982 Ga0207665_10024757
983 Ga0207665_10131249
984 Ga0207691_10047301
985 Ga0207691_10313070
986 Ga0207711_10007436
987 Ga0207689_10143669
988 Ga0207661_10001701
989 Ga0207661_10010680
990 Ga0207661_10099691
991 Ga0207661_10214549
992 Ga0207679_10071264
993 Ga0207667_10027192
994 Ga0207667_10089554
995 Ga0207667_10194455
996 Ga0207667_10469160
997 Ga0207668_10024726
998 Ga0207668_10167798
999 Ga0207640_10050659
1000 Ga0207640_10135616
1001 Ga0207677_10060095
1002 Ga0207677_10131688
1003 Ga0207703_10034995
1004 Ga0207703_10039027
1005 Ga0207703_10211074
1006 Ga0207703_10216815
1007 Ga0207639_10181025
1008 Ga0207678_10019160
1009 Ga0207678_10020831
1010 Ga0207678_10073828
1011 Ga0207678_10240879
1012 Ga0207708_10030112
1013 Ga0207702_10000026
1014 Ga0207702_10000334
1015 Ga0207702_10100878
1016 Ga0207702_10272074
1017 Ga0207648_10031210
1018 Ga0207648_10039811
1019 Ga0207676_10079317
1020 Ga0207676_10146806
1021 Ga0207674_10011940
1022 Ga0207674_10082105
1023 Ga0207674_10134043
1024 Ga0207674_10212892
1025 Ga0207675_100174465
1026 Ga0207683_10038657
1027 Ga0207683_10267012
1028 Ga0207698_10079102
1029 Ga0207698_10287174
1030 Ga0209589_1000004
1031 Ga0209489_100004
1032 Ga0209700_100004
1033 Ga0209813_10049293
1034 Ga0268266_10012789
1035 Ga0268266_10022968
1036 Ga0268266_10026743
1037 Ga0268266_10107150
1038 Ga0268266_10136244
1039 Ga0268265_10433400
1040 Ga0268264_10000096
1041 Ga0265334_10003786
1042 Ga0265318_10019074
1043 Ga0265323_10000913
1044 Ga0265322_10001611
1045 Ga0265336_10000099
1046 Ga0307517_10000315
1047 Ga0307515_10053148
1048 Ga0307515_10198845
1049 Ga0265338_10000207
1050 Ga0265324_10001958
1051 Ga0265330_10091349
1052 Ga0265332_10000585
1053 Ga0265332_10013242
1054 Ga0265325_10000053
1055 Ga0265325_10115871
1056 Ga0265329_10013050
1057 Ga0265340_10047489
1058 Ga0265339_10001532
1059 Ga0265339_10010735
1060 Ga0265339_10041311
1061 Ga0265316_10029807
1062 Ga0265316_10158991
1063 Ga0307408_100033037
1064 Ga0265313_10017522
1065 Ga0307508_10021406
1066 Ga0307508_10081646
1067 Ga0265314_10003384
1068 Ga0265314_10017116
1069 Ga0265342_10001010
1070 Ga0307516_10007232
1071 Ga0307516_10013179
1072 Ga0307410_10173541
1073 Ga0307510_10008253
1074 Ga0315911_1000014
1075 Ga0373926_0022692
1076 Ga0373934_0012159
1077 Ga0373923_0042724
1078 Ga0373923_0124773
1079 Ga0373936_0059185
1080 Ga0373953_0036895
1081 Ga0373954_0041365
1082 Ga0373956_0004737
1083 Ga0373956_0007387
1084 Ga0373943_0080077
1085 Ga0373955_0006675
1086 Ga0373955_0013779
1087 Ga0373955_0027666
1088 Ga0373942_0013749
1089 Ga0373961_0001489
1090 Ga0373924_0013117
1091 Ga0373931_0020616
1092 Ga0373935_0002078
1093 Ga0373935_0162045
1094 Ga0373927_0003925
1095 Ga0373927_0027376
1096 Ga0373927_0042386
1097 Ga0373927_0058259
1098 Ga0373927_0168961
1099 Ga0373933_0000020
1100 Ga0373933_0005055
1101 Ga0373933_0015421
1102 Ga0373933_0089742
1103 Ga0373947_0004109
1104 Ga0373947_0016136
1105 Ga0373937_0113505
1106 Ga0373925_0008691
1107 Ga0373925_0029927
1108 Ga0373925_0071012
1109 Ga0373925_0081602
1110 Ga0373925_0164504
1111 Ga0395900_0118079
1112 Ga0395900_0119806
1113 Ga0395898_0013618
1114 Ga0395898_0023411
1115 Ga0395898_0188151
1116 Ga0395905_0201734
1117 Ga0395905_0250688
1118 Ga0395905_0290347
1119 Ga0436364_0717863
1120 Ga0436364_1385478
1121 Ga0395901_0112639
1122 Ga0436365_0833193
1123 Ga0436365_0944955
1124 Ga0436365_1148872
1125 Ga0436360_0304485
1126 Ga0436360_0597135
1127 Ga0436361_1068668
1128 Ga0436363_0034386
1129 Ga0436362_0367954
1130 Ga0436362_0881328
1131 Ga0436362_1098843
1132 Ga0451853_0587007
1133 Ga0466966_0020722
1134 Ga0466963_0118604
1135 Ga0466957_0056724
1136 Ga0466959_0191967
1137 Ga0466958_0159871
1138 Ga0495592_0027096
1139 Ga0495592_0182465
1140 Ga0495603_0007969
1141 Ga0495603_0011811
1142 Ga0495629_0000466
1143 Ga0495629_0012059
1144 Ga0495629_0044521
1145 Ga0495638_0011966
1146 Ga0495638_0096681
1147 Ga0495641_0044847
1148 Ga0495641_0052409
1149 Ga0495651_0015966
1150 Ga0495653_0067068
1151 Ga0495582_0030311
1152 Ga0495582_0032892
1153 Ga0495639_0007911
1154 Ga0495639_0118438
1155 Ga0495662_0015796
1156 Ga0495664_0015534
1157 Ga0495664_0021335
1158 Ga0495584_0144741
1159 Ga0495594_0037330
1160 Ga0495596_0061496
1161 Ga0495606_0005211
1162 Ga0495606_0066821
1163 Ga0495608_0010573
1164 Ga0495618_0008064
1165 Ga0495618_0048697
1166 Ga0495618_0126615
1167 Ga0495620_0033987
1168 Ga0495643_0051314
1169 Ga0495644_0061352
1170 Ga0495648_0005947
1171 Ga0495666_0096924
1172 Ga0495652_0073214
1173 Ga0495665_0011670
1174 Ga0495586_0053894
1175 Ga0495586_0109562
1176 Ga0495587_0012527
1177 Ga0495597_0115967
1178 Ga0495645_0163837
1179 Ga0495622_0043219
1180 Ga0495667_0091389
1181 Ga0495634_0020776
1182 Ga0495625_0127786
1183 Ga0495625_0144430
1184 Ga0495625_0156820
1185 Ga0495661_0052512
1186 Ga0495588_0041197
1187 Ga0495588_0049500
1188 Ga0495588_0099240
1189 Ga0495599_0035060
1190 Ga0495623_0049716
1191 Ga0495647_0003525
1192 Ga0495658_0002587
1193 Ga0495613_0175298
1194 Ga0495624_0003820
1195 Ga0495670_0009827
1196 Ga0495660_0072680
1197 Ga0495604_0056974
1198 Ga0495604_0247504
1199 Ga0495674_0046907
1200 Ga0495672_0025049
1201 Ga0495672_0058436
1202 Ga0495680_0033039
1203 Ga0495680_0043678
1204 Ga0495680_0251688
1205 Ga0495675_0009663
1206 Ga0495684_0008560
1207 Ga0495684_0009161
1208 Ga0495684_0053690
1209 Ga0495686_0061190
1210 Ga0495593_0053109
1211 Ga0495602_0032475
1212 Ga0495615_0021322
1213 Ga0496100_0047657
1214 Ga0496100_0065357
1215 Ga0496100_0068985
1216 Ga0496101_0084652
1217 Ga0496102_0039922
1218 Ga0496103_0052470
1219 Ga0496103_0063854
1220 Ga0496104_0000117
1221 Ga0496104_0007504
1222 Ga0496104_0049526
1223 Ga0496104_0122500
1224 Ga0496104_0319680
1225 Ga0496105_0000094
1226 Ga0496105_0004442
1227 Ga0496105_0005994
1228 Ga0496105_0023954
1229 Ga0496105_0078970
1230 Ga0496105_0086676
1231 Ga0496105_0091132
1232 Ga0496105_0214679
1233 Ga0496105_0281198
1234 Ga0496106_0014603
1235 Ga0496106_0018567
1236 Ga0496106_0044268
1237 Ga0496107_0004733
1238 Ga0496107_0021996
1239 Ga0496107_0033711
1240 Ga0496108_0020079
1241 Ga0496108_0037147
1242 Ga0496108_0042427
1243 Ga0496108_0129337
1244 Ga0496108_0278206
1245 Ga0496109_0018926
1246 Ga0496109_0027629
1247 Ga0496109_0118438
1248 Ga0496109_0130914
1249 Ga0496110_0005325
1250 Ga0496110_0012396
1251 Ga0496110_0024628
1252 Ga0496110_0195436
1253 Ga0496110_0197556
1254 Ga0496110_0215241
1255 Ga0496111_0009567
1256 Ga0496111_0024061
1257 Ga0496112_0000008
1258 Ga0496112_0013508
1259 Ga0496112_0014948
1260 Ga0496112_0017925
1261 Ga0496112_0040156
1262 Ga0496112_0055672
1263 Ga0496112_0178655
1264 Ga0496113_0005488
1265 Ga0496113_0012948
1266 Ga0496113_0017879
1267 Ga0496113_0064750
1268 Ga0496113_0104678
1269 Ga0496113_0115606
1270 Ga0496114_0029771
1271 Ga0496114_0067418
1272 Ga0496114_0250670
1273 Ga0496115_0002098
1274 Ga0496115_0024242
1275 Ga0496115_0065265
1276 Ga0496115_0172525
1277 Ga0496116_0002352
1278 Ga0496117_0038666
1279 Ga0496117_0076062
1280 Ga0496118_0014853
1281 Ga0496118_0157757
1282 Ga0496119_0000353
1283 Ga0496119_0024309
1284 Ga0496119_0045797
1285 Ga0496120_0065220
1286 Ga0496121_0000774
1287 Ga0496121_0001934
1288 Ga0496121_0002911
1289 Ga0496121_0016680
1290 Ga0496121_0020156
1291 Ga0496121_0053472
1292 Ga0496121_0091046
1293 Ga0496121_0129591
1294 Ga0496121_0131969
1295 Ga0496121_0286779
1296 Ga0496122_0037719
1297 Ga0496124_0098837
1298 Ga0496124_0135649
1299 Ga0496124_0145091
1300 Ga0496125_0002472
1301 Ga0496125_0007003
1302 Ga0496126_0002033
1303 Ga0496126_0002400
1304 Ga0496126_0020156
1305 Ga0496126_0033693
1306 Ga0496126_0059027
1307 Ga0496126_0061742
1308 Ga0496126_0063287
1309 Ga0496126_0087483
1310 Ga0496126_0119361
1311 Ga0496126_0128843
1312 Ga0496126_0175270
1313 Ga0496126_0201062
1314 Ga0496126_0286318
1315 Ga0501033_0040401
1316 Ga0501034_0042724
1317 Ga0501034_0145573
1318 Ga0501038_0004519
1319 Ga0501047_0135327
1320 Ga0501047_0198563
1321 Ga0501047_0346463
1322 Ga0501067_0021106
1323 Ga0501067_0085250
1324 Ga0501069_0049448
1325 Ga0501074_0132883
1326 Ga0501076_0087844
1327 Ga0501080_0400202
1328 Ga0501081_0172249
1329 Ga0501035_0074883
1330 Ga0501035_0082145
1331 Ga0501044_0001046
1332 Ga0501044_0023541
1333 Ga0501044_0225603
1334 nmdc:mga00v17_16765_c1
1335 nmdc:mga00v17_215448_c1
1336 nmdc:mga0yw44_37395_c1
1337 nmdc:mga0k408_60329_c1
1338 nmdc:mga06z11_168427_c1
1339 nmdc:mga04h51_6761_c1
1340 nmdc:mga0n895_132777_c1
1341 nmdc:mga0n895_16469_c1
1342 nmdc:mga0n895_437343_c1
1343 nmdc:mga0rr50_105781_c1
1344 nmdc:mga0rr50_245520_c1
1345 nmdc:mga08x19_26093_c1
1346 nmdc:mga0a205_204781_c1
1347 nmdc:mga0sz30_1061_c1
1348 Ga0500635_0002612
1349 Ga0495595_0008168
1350 Ga0495595_0024982
1351 Ga0500644_0005676
1352 Ga0500647_0034083
1353 Ga0500651_0029959
1354 Ga0500566_0000631
1355 Ga0500566_0000771
1356 Ga0500641_0007701
1357 Ga0500641_0053911
1358 Ga0500648_108119
1359 Ga0500554_004600
1360 Ga0500556_0000002
1361 Ga0500595_000928
1362 Ga0500595_001846
1363 Ga0500595_004756
1364 Ga0500595_026781
1365 Ga0500607_081527
1366 Ga0500618_003955
1367 Ga0500642_0000026
1368 Ga0500642_0066895
1369 Ga0500652_017951
1370 Ga0500559_0000973
1371 Ga0500559_0087571
1372 Ga0500568_0000800
1373 Ga0500568_0023341
1374 Ga0500568_0039806
1375 Ga0500573_0025082
1376 Ga0500577_0000075
1377 Ga0500603_000825
1378 Ga0500604_0000131
1379 Ga0500616_0000031
1380 Ga0500622_0000583
1381 Ga0500627_0035169
1382 Ga0500633_0015572
1383 Ga0500636_0006153
1384 Ga0500636_0066123
1385 Ga0500637_0030439
1386 Ga0500567_054745
1387 Ga0501082_0078639
1388 Ga0466962_0003950
1389 Ga0530510_0163211
1390 2513659024
1391 2513673229
1392 2513695367
1393 2513860359
1394 2513891818
1395 2513921287
1396 2517894173
1397 2524466082
1398 2524536101
1399 2603861373
1400 2671123484
1401 2723843749
1402 2728748724
1403 2793073154
1404 2793079419
1405 2857530144
1406 2874612259
1407 2876811395
1408 2879114790
1409 2885376380
1410 2885391311
1411 2889042051
1412 2893066037
1413 2903776343
1414 2904697398
1415 2904705297
1416 2906610988
1417 2906639547
1418 2906661786
1419 2908744501
1420 2908762363
1421 2919079583
1422 2922366079
1423 2922387346
1424 2922428328
1425 2935635835
1426 2941512466
1427 2941520167
1428 2941528437
1429 3005478312
1430 8006942904
1431 8006972857
1432 8006982624
1433 8006988686
1434 8006994394
1435 8019566614
1436 8056681110
1437 8056686522
1438 8056694739

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

25

369

0.96

PF00155

Aminotran_1_2

Aminotransferase class I and II

39

210

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qgr-assembly1.cif.gz_B crystal structure of a degt dnrj eryc1 strs aminotransferase from brucella abortus 0.9572 10 379
7b0d-assembly1.cif.gz_B sugar transaminase from archaeoglobus veneficus 0.945 8 381
8e75-assembly1.cif.gz_A crystal structure of pcryo_0616, the aminotransferase required to synthesize udp-n-acetyl-3-amino-d-glucosaminuronic acid (udp-glcnac3na) 0.9442 10 376
4qgr-assembly1.cif.gz_B crystal structure of a degt dnrj eryc1 strs aminotransferase from brucella abortus 0.9422 10 379
3nys-assembly1.cif.gz_A x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution 0.9384 10 377
ID Description Score Start End Superfamily
af_L0T6V0_4_199_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9546 41 214 3.40.640.10
4qgrB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9496 261 379 3.90.1150.10
4qgrB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9401 10 259 3.40.640.10
4qgrB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9326 10 259 3.40.640.10
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9249 10 258 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A382ZPZ7-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9839 42 205 GO:0000271
GO:0008483
GO:0030170
AF-A0A0F9A822-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9819 10 165 GO:0000271
GO:0008483
GO:0030170
AF-A0A800BFW7-F1-model_v4 deleted 0.9733 9 184
AF-A0A382ZPZ7-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9722 42 205 GO:0000271
GO:0008483
GO:0030170
AF-A0A354TK86-F1-model_v4 Erythromycin biosynthesis sensory transduction protein eryC1 0.9693 40 220 GO:0000271
GO:0008483
GO:0030170

Map