F477250

General Info

Members Datasets Scaffolds Average Seq Length
719 350 705 312

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10176364|Ga0307510_101763642
Length 317
Sequence MSFPDLTTELRAALPDLRGRLDANQPMRDITWFRVGGPAQVLFTPADETDLAYVLKTIGADLPVTVVGVGSNLLVRDGGIPGLVVRLGGRGFGGFAVTEGGERMAVGAAMPDMRAAQSAAKAGLAGLAFYRGIPGTIGGALRMNAGAHGTETKDIFVSARAVDGHGIIHVLTHADMHFTYRHCGLPEDFIFTEATFQGTPGDPAEIERQMDEVTAYREANQPTKSRTGGSTFKNPPGHSAWKLVDAAGCRGFRVGGAHVSEMHANFLINDGEASAEDIERLGETVRARVQAAAGVTLEWEIKRIGVTGAGQGAVVAA

Samples

Sample ID Description Type Environment
1 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2791355199
4 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
5 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
6 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
7 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
8 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
9 2902330777 Methylobacterium sp. 2A Isolate Unclassified
10 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
11 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
204 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
230 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
348 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
349 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
350 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0.56
Rhizoplane 9.74
Rhizosphere 83.31
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10134984 3300005327 Bacteria 2058
2 Ga0070676_10001181 3300005328 Bacteria 13083
3 Ga0070683_100067788 3300005329 Bacteria 3324
4 Ga0070690_100000545 3300005330 Bacteria 18860
5 Ga0070690_100240637 3300005330 Bacteria 1276
6 Ga0070670_100005981 3300005331 Bacteria 10296
7 Ga0068869_100055145 3300005334 Bacteria 2896
8 Ga0068869_100091465 3300005334 Bacteria 2289
9 Ga0070666_10004683 3300005335 Bacteria 8357
10 Ga0070680_100003071 3300005336 Bacteria 12390
11 Ga0070680_100063518 3300005336 Bacteria 3024
12 Ga0070680_100141690 3300005336 Bacteria 2016
13 Ga0070682_100005762 3300005337 Bacteria 6911
14 Ga0070682_100010119 3300005337 Bacteria 5347
15 Ga0068868_100072838 3300005338 Bacteria 2741
16 Ga0070660_100002003 3300005339 Bacteria 14053
17 Ga0070660_100004348 3300005339 Bacteria 9786
18 Ga0070689_100001025 3300005340 Bacteria 17546
19 Ga0070691_10000109 3300005341 Bacteria 24574
20 Ga0070691_10043067 3300005341 Bacteria 2138
21 Ga0070687_100001058 3300005343 Bacteria 9417
22 Ga0070661_100010613 3300005344 Bacteria 6408
23 Ga0070661_100092817 3300005344 Bacteria 2237
24 Ga0070692_10118036 3300005345 Bacteria 1476
25 Ga0070668_100000323 3300005347 Bacteria 31536
26 Ga0070669_100015233 3300005353 Bacteria 5477
27 Ga0070669_100037889 3300005353 Bacteria 3498
28 Ga0070675_100001821 3300005354 Bacteria 15775
29 Ga0070675_100457065 3300005354 Bacteria 1146
30 Ga0070671_100001054 3300005355 Bacteria 20321
31 Ga0070674_100000932 3300005356 Bacteria 15259
32 Ga0070673_100001383 3300005364 Bacteria 14186
33 Ga0070688_100000138 3300005365 Bacteria 39542
34 Ga0070659_100000915 3300005366 Bacteria 21598
35 Ga0070659_100174085 3300005366 Bacteria 1764
36 Ga0070667_100002638 3300005367 Bacteria 15527
37 Ga0070667_100312877 3300005367 Bacteria 1416
38 Ga0070703_10000738 3300005406 Bacteria 10919
39 Ga0070703_10015964 3300005406 Bacteria 2152
40 Ga0070709_10000884 3300005434 Bacteria 16793
41 Ga0070714_100110855 3300005435 Bacteria 2430
42 Ga0070714_100291835 3300005435 Bacteria 1518
43 Ga0070713_100040503 3300005436 Bacteria 3787
44 Ga0070701_10001670 3300005438 Bacteria 8318
45 Ga0070701_10003932 3300005438 Bacteria 5942
46 Ga0070701_10129740 3300005438 Bacteria 1431
47 Ga0070711_100084248 3300005439 Bacteria 2274
48 Ga0070705_100001479 3300005440 Bacteria 12426
49 Ga0070705_100050475 3300005440 Bacteria 2420
50 Ga0070700_100000877 3300005441 Bacteria 14822
51 Ga0070700_100012951 3300005441 Bacteria 4675
52 Ga0070700_100161296 3300005441 Bacteria 1544
53 Ga0070694_100000159 3300005444 Bacteria 34656
54 Ga0070694_100126384 3300005444 Bacteria 1841
55 Ga0070708_100041592 3300005445 Bacteria 4030
56 Ga0070708_100061419 3300005445 Bacteria 3357
57 Ga0070663_100001241 3300005455 Bacteria 14017
58 Ga0070663_100003445 3300005455 Bacteria 9119
59 Ga0070663_100031501 3300005455 Bacteria 3644
60 Ga0070663_100090695 3300005455 Bacteria 2264
61 Ga0070678_100001723 3300005456 Bacteria 11744
62 Ga0070678_100044929 3300005456 Bacteria 3157
63 Ga0070678_100237942 3300005456 Bacteria 1521
64 Ga0070662_100002638 3300005457 Bacteria 11058
65 Ga0070662_100293407 3300005457 Bacteria 1319
66 Ga0070681_10000939 3300005458 Bacteria 24555
67 Ga0070681_10014733 3300005458 Bacteria 7774
68 Ga0070681_10015319 3300005458 Bacteria 7628
69 Ga0068867_100036668 3300005459 Bacteria 3561
70 Ga0068867_100090121 3300005459 Bacteria 2326
71 Ga0068867_100156317 3300005459 Bacteria 1795
72 Ga0070685_10002967 3300005466 Bacteria 8661
73 Ga0070707_100034678 3300005468 Bacteria 4815
74 Ga0070707_100166870 3300005468 Bacteria 2146
75 Ga0070699_100001258 3300005518 Bacteria 23358
76 Ga0070699_100455596 3300005518 Bacteria 1160
77 Ga0070679_100047103 3300005530 Bacteria 4299
78 Ga0070684_100011323 3300005535 Bacteria 7102
79 Ga0070684_100014119 3300005535 Bacteria 6458
80 Ga0070697_100017448 3300005536 Bacteria 5648
81 Ga0068853_100000477 3300005539 Bacteria 27292
82 Ga0068853_100008362 3300005539 Bacteria 8309
83 Ga0070672_100003489 3300005543 Bacteria 10191
84 Ga0070686_100005159 3300005544 Bacteria 7208
85 Ga0070686_100040502 3300005544 Bacteria 2907
86 Ga0070695_100001605 3300005545 Bacteria 12655
87 Ga0070696_100000199 3300005546 Bacteria 35525
88 Ga0070696_100001417 3300005546 Bacteria 15660
89 Ga0070696_100044315 3300005546 Bacteria 3080
90 Ga0070693_100000188 3300005547 Bacteria 28560
91 Ga0070693_100002723 3300005547 Bacteria 8130
92 Ga0070665_100006048 3300005548 Bacteria 12368
93 Ga0070665_100021991 3300005548 Bacteria 6415
94 Ga0070704_100000534 3300005549 Bacteria 18226
95 Ga0070704_100001140 3300005549 Bacteria 13866
96 Ga0070704_100081177 3300005549 Bacteria 2388
97 Ga0070704_100308289 3300005549 Bacteria 1322
98 Ga0068855_100002324 3300005563 Bacteria 23491
99 Ga0068855_100030914 3300005563 Bacteria 6399
100 Ga0068855_100042928 3300005563 Bacteria 5358
101 Ga0070664_100030975 3300005564 Bacteria 4466
102 Ga0068857_100010845 3300005577 Bacteria 7933
103 Ga0068857_100021812 3300005577 Bacteria 5637
104 Ga0068857_100085275 3300005577 Bacteria 2823
105 Ga0068854_100060234 3300005578 Bacteria 2745
106 Ga0068856_100001302 3300005614 Bacteria 26252
107 Ga0070702_100000205 3300005615 Bacteria 19426
108 Ga0068852_100161808 3300005616 Bacteria 2090
109 Ga0068859_100002806 3300005617 Bacteria 17654
110 Ga0068859_100195348 3300005617 Bacteria 2108
111 Ga0068859_100768927 3300005617 Bacteria 1052
112 Ga0068864_100004194 3300005618 Bacteria 11850
113 Ga0068864_100013353 3300005618 Bacteria 6805
114 Ga0068864_100326283 3300005618 Bacteria 1443
115 Ga0068866_10011117 3300005718 Bacteria 3882
116 Ga0068866_10030357 3300005718 Bacteria 2594
117 Ga0068866_10057930 3300005718 Bacteria 1998
118 Ga0068861_100000196 3300005719 Bacteria 32472
119 Ga0068861_100221076 3300005719 Bacteria 1601
120 Ga0068870_10064936 3300005840 Bacteria 1973
121 Ga0068863_100022888 3300005841 Bacteria 5971
122 Ga0068863_100139933 3300005841 Bacteria 2313
123 Ga0068863_100386187 3300005841 Bacteria 1368
124 Ga0068858_100001779 3300005842 Bacteria 21986
125 Ga0068858_100024420 3300005842 Bacteria 5632
126 Ga0068858_100118767 3300005842 Bacteria 2472
127 Ga0068858_100209204 3300005842 Bacteria 1846
128 Ga0068860_100000872 3300005843 Bacteria 33488
129 Ga0068860_100012706 3300005843 Bacteria 8284
130 Ga0068860_100313817 3300005843 Bacteria 1538
131 Ga0068862_100002619 3300005844 Bacteria 15837
132 Ga0068862_100004157 3300005844 Bacteria 12265
133 Ga0068862_100214141 3300005844 Bacteria 1741
134 Ga0081455_10002009 3300005937 Bacteria 24312
135 Ga0081455_10006756 3300005937 Bacteria 12243
136 Ga0081538_10114849 3300005981 Bacteria 1310
137 Ga0081540_1008498 3300005983 Bacteria 7165
138 Ga0081539_10043185 3300005985 Bacteria 2616
139 Ga0075365_10022286 3300006038 Bacteria 3967
140 Ga0075365_10167966 3300006038 Bacteria 1531
141 Ga0075368_10002354 3300006042 Bacteria 6145
142 Ga0075363_100013015 3300006048 Bacteria 4020
143 Ga0075363_100061813 3300006048 Bacteria 2019
144 Ga0075363_100147974 3300006048 Bacteria 1325
145 Ga0075364_10001857 3300006051 Bacteria 11717
146 Ga0070715_10000410 3300006163 Bacteria 10909
147 Ga0070715_10058258 3300006163 Bacteria 1686
148 Ga0070715_10099577 3300006163 Bacteria 1353
149 Ga0070716_100002026 3300006173 Bacteria 9254
150 Ga0070716_100009188 3300006173 Bacteria 4922
151 Ga0070712_100010253 3300006175 Bacteria 5908
152 Ga0070712_100263942 3300006175 Bacteria 1381
153 Ga0075367_10007598 3300006178 Bacteria 5565
154 Ga0075367_10027267 3300006178 Bacteria 3248
155 Ga0097621_100021184 3300006237 Bacteria 5023
156 Ga0068871_100065695 3300006358 Bacteria 2972
157 Ga0068871_100093790 3300006358 Bacteria 2505
158 Ga0068871_100186662 3300006358 Bacteria 1784
159 Ga0075428_100006002 3300006844 Bacteria 13494
160 Ga0075428_100138493 3300006844 Bacteria 2646
161 Ga0075428_100235198 3300006844 Bacteria 1977
162 Ga0075430_100006827 3300006846 Bacteria 9621
163 Ga0075430_100008098 3300006846 Bacteria 8883
164 Ga0075430_100057057 3300006846 Bacteria 3285
165 Ga0075431_100001669 3300006847 Bacteria 20817
166 Ga0075431_100015632 3300006847 Bacteria 7693
167 Ga0075431_100016133 3300006847 Bacteria 7580
168 Ga0075431_100098618 3300006847 Bacteria 3017
169 Ga0075434_100006094 3300006871 Bacteria 11036
170 Ga0075429_100013543 3300006880 Bacteria 7076
171 Ga0075429_100378431 3300006880 Bacteria 1239
172 Ga0068865_100001326 3300006881 Bacteria 14415
173 Ga0068865_100159867 3300006881 Bacteria 1717
174 Ga0068865_100323847 3300006881 Bacteria 1241
175 Ga0075436_100037850 3300006914 Bacteria 3330
176 Ga0097620_100002806 3300006931 Bacteria 17654
177 Ga0097620_100195348 3300006931 Bacteria 2108
178 Ga0097620_100768888 3300006931 Bacteria 1052
179 Ga0075435_100045719 3300007076 Bacteria 3511
180 Ga0105244_10032109 3300009036 Bacteria 2783
181 Ga0105250_10005666 3300009092 Bacteria 5575
182 Ga0105240_10017201 3300009093 Bacteria 9755
183 Ga0105240_10020968 3300009093 Bacteria 8699
184 Ga0111539_10002984 3300009094 Bacteria 22446
185 Ga0111539_10013581 3300009094 Bacteria 10181
186 Ga0111539_10029331 3300009094 Bacteria 6703
187 Ga0111539_10472320 3300009094 Bacteria 1460
188 Ga0105245_10001489 3300009098 Bacteria 21183
189 Ga0105245_10052351 3300009098 Bacteria 3662
190 Ga0105247_10002044 3300009101 Bacteria 13970
191 Ga0105247_10084000 3300009101 Bacteria 2012
192 Ga0105247_10172977 3300009101 Bacteria 1437
193 Ga0114129_10006490 3300009147 Bacteria 16591
194 Ga0114129_10039389 3300009147 Bacteria 6662
195 Ga0114129_10115511 3300009147 Bacteria 3699
196 Ga0114129_10286667 3300009147 Bacteria 2199
197 Ga0114129_10342191 3300009147 Bacteria 1983
198 Ga0114129_10405923 3300009147 Bacteria 1795
199 Ga0105243_10002388 3300009148 Bacteria 15736
200 Ga0105243_10058138 3300009148 Bacteria 3081
201 Ga0105243_10059120 3300009148 Bacteria 3058
202 Ga0105243_10077781 3300009148 Bacteria 2699
203 Ga0105241_10006466 3300009174 Bacteria 8638
204 Ga0105241_10124317 3300009174 Bacteria 2081
205 Ga0105248_10001500 3300009177 Bacteria 25954
206 Ga0105248_10036884 3300009177 Bacteria 5467
207 Ga0105248_10344234 3300009177 Bacteria 1678
208 Ga0105237_10002959 3300009545 Bacteria 20556
209 Ga0105237_10006667 3300009545 Bacteria 12761
210 Ga0105237_10013047 3300009545 Bacteria 8725
211 Ga0105238_10056851 3300009551 Bacteria 3924
212 Ga0105238_10074495 3300009551 Bacteria 3387
213 Ga0105249_10000775 3300009553 Bacteria 28627
214 Ga0105249_10005964 3300009553 Bacteria 10558
215 Ga0105249_10020835 3300009553 Bacteria 5863
216 Ga0105249_10048959 3300009553 Bacteria 3854
217 Ga0105239_10056224 3300010375 Bacteria 4316
218 Ga0105239_10202847 3300010375 Bacteria 2222
219 Ga0105246_10001892 3300011119 Bacteria 12602
220 Ga0105246_10012955 3300011119 Bacteria 5218
221 Ga0105246_10137577 3300011119 Bacteria 1832
222 Ga0157371_10006736 3300013102 Bacteria 9393
223 Ga0157369_10006271 3300013105 Bacteria 13803
224 Ga0157378_10002206 3300013297 Bacteria 17281
225 Ga0157378_10069630 3300013297 Bacteria 3156
226 Ga0157378_10164863 3300013297 Bacteria 2075
227 Ga0163162_10002752 3300013306 Bacteria 16697
228 Ga0163162_10329713 3300013306 Bacteria 1659
229 Ga0163162_10344829 3300013306 Bacteria 1622
230 Ga0157375_10003722 3300013308 Bacteria 13234
231 Ga0157375_10004209 3300013308 Bacteria 12481
232 Ga0157375_10297543 3300013308 Bacteria 1777
233 Ga0157375_10308030 3300013308 Bacteria 1748
234 Ga0157380_10039991 3300014326 Bacteria 3650
235 Ga0157380_10100365 3300014326 Bacteria 2409
236 Ga0157380_10141486 3300014326 Bacteria 2068
237 Ga0157380_10476500 3300014326 Bacteria 1206
238 Ga0157379_10034256 3300014968 Bacteria 4526
239 Ga0157379_10092823 3300014968 Bacteria 2708
240 Ga0157379_10188887 3300014968 Bacteria 1862
241 Ga0157379_10266007 3300014968 Bacteria 1559
242 Ga0157376_10000823 3300014969 Bacteria 20317
243 Ga0157376_10011387 3300014969 Bacteria 6554
244 Ga0157376_10125052 3300014969 Bacteria 2286
245 Ga0157376_10205715 3300014969 Bacteria 1814
246 Ga0157376_10382186 3300014969 Bacteria 1357
247 Ga0163161_10006062 3300017792 Bacteria 8380
248 Ga0163161_10210100 3300017792 Bacteria 1503
249 Ga0213874_10031407 3300021377 Bacteria 1537
250 Ga0209564_1000485 3300025295 Bacteria 66032
251 Ga0207653_10001221 3300025885 Bacteria 8404
252 Ga0207692_10083908 3300025898 Bacteria 1711
253 Ga0207642_10002770 3300025899 Bacteria 5471
254 Ga0207710_10001172 3300025900 Bacteria 13328
255 Ga0207710_10062342 3300025900 Bacteria 1694
256 Ga0207688_10005595 3300025901 Bacteria 6834
257 Ga0207688_10082994 3300025901 Bacteria 1832
258 Ga0207680_10004778 3300025903 Bacteria 6450
259 Ga0207685_10000332 3300025905 Bacteria 7623
260 Ga0207699_10001135 3300025906 Bacteria 12602
261 Ga0207645_10005698 3300025907 Bacteria 8999
262 Ga0207643_10053536 3300025908 Bacteria 2293
263 Ga0207705_10279722 3300025909 Bacteria 1277
264 Ga0207684_10063894 3300025910 Bacteria 3125
265 Ga0207654_10032096 3300025911 Bacteria 2898
266 Ga0207654_10057474 3300025911 Bacteria 2261
267 Ga0207707_10020800 3300025912 Bacteria 5732
268 Ga0207707_10021729 3300025912 Bacteria 5609
269 Ga0207707_10055109 3300025912 Bacteria 3459
270 Ga0207707_10118204 3300025912 Bacteria 2317
271 Ga0207695_10060681 3300025913 Bacteria 3913
272 Ga0207671_10013744 3300025914 Bacteria 6427
273 Ga0207671_10015825 3300025914 Bacteria 5885
274 Ga0207693_10000313 3300025915 Bacteria 45228
275 Ga0207693_10027789 3300025915 Bacteria 4471
276 Ga0207693_10031514 3300025915 Bacteria 4189
277 Ga0207693_10099806 3300025915 Bacteria 2276
278 Ga0207663_10028091 3300025916 Bacteria 3288
279 Ga0207660_10044863 3300025917 Bacteria 3111
280 Ga0207660_10046845 3300025917 Bacteria 3054
281 Ga0207660_10065983 3300025917 Bacteria 2617
282 Ga0207662_10013266 3300025918 Bacteria 4606
283 Ga0207662_10039597 3300025918 Bacteria 2766
284 Ga0207657_10000112 3300025919 Bacteria 79849
285 Ga0207657_10002910 3300025919 Bacteria 18383
286 Ga0207649_10295662 3300025920 Bacteria 1182
287 Ga0207652_10019094 3300025921 Bacteria 5632
288 Ga0207652_10065819 3300025921 Bacteria 3139
289 Ga0207652_10118830 3300025921 Bacteria 2350
290 Ga0207646_10050170 3300025922 Bacteria 3735
291 Ga0207646_10056330 3300025922 Bacteria 3514
292 Ga0207694_10090191 3300025924 Bacteria 2418
293 Ga0207659_10010412 3300025926 Bacteria 5845
294 Ga0207659_10226482 3300025926 Bacteria 1506
295 Ga0207687_10004391 3300025927 Bacteria 9411
296 Ga0207687_10067076 3300025927 Bacteria 2552
297 Ga0207664_10106423 3300025929 Bacteria 2325
298 Ga0207664_10234462 3300025929 Bacteria 1596
299 Ga0207690_10002166 3300025932 Bacteria 12002
300 Ga0207690_10100332 3300025932 Bacteria 2066
301 Ga0207690_10104894 3300025932 Bacteria 2026
302 Ga0207706_10000831 3300025933 Bacteria 32015
303 Ga0207686_10004856 3300025934 Bacteria 7226
304 Ga0207709_10098640 3300025935 Bacteria 1927
305 Ga0207709_10150707 3300025935 Bacteria 1610
306 Ga0207709_10189739 3300025935 Bacteria 1459
307 Ga0207704_10008196 3300025938 Bacteria 4979
308 Ga0207704_10176442 3300025938 Bacteria 1539
309 Ga0207665_10000565 3300025939 Bacteria 24973
310 Ga0207691_10000623 3300025940 Bacteria 35146
311 Ga0207691_10019021 3300025940 Bacteria 6505
312 Ga0207691_10175841 3300025940 Bacteria 1872
313 Ga0207711_10007904 3300025941 Bacteria 8898
314 Ga0207661_10011376 3300025944 Bacteria 6445
315 Ga0207661_10087609 3300025944 Bacteria 2586
316 Ga0207679_10009793 3300025945 Bacteria 6149
317 Ga0207667_10007538 3300025949 Bacteria 13058
318 Ga0207667_10083775 3300025949 Bacteria 3302
319 Ga0207651_10018895 3300025960 Bacteria 4115
320 Ga0207712_10055902 3300025961 Bacteria 2779
321 Ga0207712_10103501 3300025961 Bacteria 2121
322 Ga0207668_10067997 3300025972 Bacteria 2531
323 Ga0207640_10004101 3300025981 Bacteria 7874
324 Ga0207658_10039058 3300025986 Bacteria 3423
325 Ga0207677_10072886 3300026023 Bacteria 2430
326 Ga0207703_10015420 3300026035 Bacteria 5959
327 Ga0207703_10232955 3300026035 Bacteria 1652
328 Ga0207639_10009638 3300026041 Bacteria 6672
329 Ga0207678_10000086 3300026067 Bacteria 76696
330 Ga0207678_10000635 3300026067 Bacteria 32236
331 Ga0207678_10039941 3300026067 Bacteria 4070
332 Ga0207708_10000858 3300026075 Bacteria 22914
333 Ga0207708_10006325 3300026075 Bacteria 8777
334 Ga0207708_10043439 3300026075 Bacteria 3425
335 Ga0207708_10060504 3300026075 Bacteria 2891
336 Ga0207708_10090745 3300026075 Bacteria 2355
337 Ga0207641_10043891 3300026088 Bacteria 3757
338 Ga0207648_10065450 3300026089 Bacteria 3169
339 Ga0207648_10171095 3300026089 Bacteria 1920
340 Ga0207648_10211581 3300026089 Bacteria 1721
341 Ga0207676_10009929 3300026095 Bacteria 6770
342 Ga0207676_10034688 3300026095 Bacteria 3821
343 Ga0207674_10002969 3300026116 Bacteria 21059
344 Ga0207674_10003298 3300026116 Bacteria 19855
345 Ga0207674_10031482 3300026116 Bacteria 5573
346 Ga0207675_100000111 3300026118 Bacteria 66086
347 Ga0207675_100021202 3300026118 Bacteria 6053
348 Ga0207675_100038220 3300026118 Bacteria 4478
349 Ga0207675_100130678 3300026118 Bacteria 2381
350 Ga0207675_100218573 3300026118 Bacteria 1835
351 Ga0207683_10000120 3300026121 Bacteria 64461
352 Ga0207683_10042740 3300026121 Bacteria 3959
353 Ga0207698_10007677 3300026142 Bacteria 6765
354 Ga0207698_10081343 3300026142 Bacteria 2614
355 Ga0207698_10172274 3300026142 Bacteria 1907
356 Ga0209998_10014548 3300027717 Bacteria 1643
357 Ga0209813_10002124 3300027866 Bacteria 4520
358 Ga0209974_10044999 3300027876 Bacteria 1473
359 Ga0207428_10003753 3300027907 Bacteria 14583
360 Ga0207428_10042572 3300027907 Bacteria 3672
361 Ga0207428_10164272 3300027907 Bacteria 1684
362 Ga0268266_10033432 3300028379 Bacteria 4372
363 Ga0268265_10007628 3300028380 Bacteria 7299
364 Ga0268265_10100982 3300028380 Bacteria 2330
365 Ga0268265_10242537 3300028380 Bacteria 1591
366 Ga0268264_10003915 3300028381 Bacteria 12752
367 Ga0268264_10048635 3300028381 Bacteria 3528
368 Ga0268264_10050991 3300028381 Bacteria 3447
369 Ga0268264_10051331 3300028381 Bacteria 3436
370 Ga0268264_10427995 3300028381 Bacteria 1278
371 Ga0265327_10045148 3300031251 Bacteria 2344
372 Ga0307513_10009994 3300031456 Bacteria 11971
373 Ga0316575_10069424 3300031665 Bacteria 1414
374 Ga0316579_10017334 3300031691 Bacteria 3156
375 Ga0316578_10072659 3300031728 Bacteria 2037
376 Ga0316577_10005671 3300031733 Bacteria 6549
377 Ga0307413_10152447 3300031824 Bacteria 1613
378 Ga0307406_10086022 3300031901 Bacteria 2104
379 Ga0316583_10002017 3300032133 Bacteria 6956
380 Ga0316585_10000782 3300032137 Bacteria 8033
381 Ga0316580_10063379 3300032139 Bacteria 1134
382 Ga0307510_10004348 3300033180 Bacteria 16677
383 Ga0307510_10176364 3300033180 Bacteria 1708
384 Ga0373959_0007799 3300034820 Bacteria 1807
385 Ga0373928_0015017 3300035084 Bacteria 1572
386 Ga0373949_0009978 3300035090 Bacteria 2078
387 Ga0373951_0003799 3300035091 Bacteria 3637
388 Ga0373932_0026249 3300035112 Bacteria 1583
389 Ga0373936_0059575 3300035113 Bacteria 1556
390 Ga0373939_0000816 3300035114 Bacteria 7695
391 Ga0373941_0004480 3300035115 Bacteria 3232
392 Ga0373953_0007878 3300035117 Bacteria 3591
393 Ga0373943_0006580 3300035170 Bacteria 5212
394 Ga0373946_0001327 3300035171 Bacteria 8542
395 Ga0373962_0022926 3300035242 Bacteria 1659
396 Ga0316574_0016545 3300035398 Bacteria 4300
397 Ga0373931_0010450 3300035691 Bacteria 4461
398 Ga0373935_0000259 3300035692 Bacteria 26229
399 Ga0373935_0096150 3300035692 Bacteria 1946
400 Ga0373927_0000339 3300035695 Bacteria 36731
401 Ga0373927_0016655 3300035695 Bacteria 4849
402 Ga0373927_0106323 3300035695 Bacteria 1827
403 Ga0373947_0000217 3300035725 Bacteria 32254
404 Ga0373947_0003875 3300035725 Bacteria 8805
405 Ga0373937_0373348 3300036401 Bacteria 1352
406 Ga0316584_0035110 3300036712 Bacteria 3719
407 Ga0373925_0004411 3300037068 Bacteria 10630
408 Ga0373925_0004501 3300037068 Bacteria 10530
409 Ga0373925_0248511 3300037068 Bacteria 1426
410 Ga0395900_0038434 3300037418 Bacteria 4932
411 Ga0395900_0445417 3300037418 Bacteria 1252
412 Ga0395898_0027692 3300037466 Bacteria 5684
413 Ga0395898_0160374 3300037466 Bacteria 2151
414 Ga0395905_0002147 3300037471 Bacteria 22373
415 Ga0316581_0000762 3300037588 Bacteria 6636
416 Ga0400488_29404 3300038741 Bacteria 1332
417 Ga0436365_0023590 3300039437 Bacteria 4181
418 Ga0436361_1121961 3300039447 Bacteria 4323
419 Ga0436363_0713686 3300039450 Bacteria 2317
420 Ga0466968_0003374 3300044735 Bacteria 5902
421 Ga0466967_0499703 3300045976 Bacteria 1193
422 Ga0495592_0045306 3300046454 Bacteria 3283
423 Ga0495603_0000352 3300046455 Bacteria 24722
424 Ga0495603_0000690 3300046455 Bacteria 19141
425 Ga0495629_0003719 3300046459 Bacteria 11498
426 Ga0495641_0019556 3300046461 Bacteria 3461
427 Ga0495651_0183959 3300046462 Bacteria 1477
428 Ga0495580_0036111 3300046472 Bacteria 3549
429 Ga0495580_0062999 3300046472 Bacteria 2601
430 Ga0495582_0000245 3300046473 Bacteria 30263
431 Ga0495582_0002379 3300046473 Bacteria 10529
432 Ga0495605_0099169 3300046474 Bacteria 1341
433 Ga0495639_0001973 3300046475 Bacteria 9084
434 Ga0495639_0009977 3300046475 Bacteria 4080
435 Ga0495662_0000872 3300046476 Bacteria 14723
436 Ga0495662_0173474 3300046476 Bacteria 1062
437 Ga0495664_0004666 3300046477 Bacteria 7494
438 Ga0495584_0035251 3300046491 Bacteria 2530
439 Ga0495594_0001257 3300046499 Bacteria 13294
440 Ga0495594_0004267 3300046499 Bacteria 7344
441 Ga0495630_0100139 3300046517 Bacteria 2192
442 Ga0495666_0005612 3300046526 Bacteria 6319
443 Ga0495666_0041105 3300046526 Bacteria 2240
444 Ga0495665_0000361 3300046531 Bacteria 22971
445 Ga0495640_0003002 3300046533 Bacteria 13580
446 Ga0495586_0055550 3300046535 Bacteria 2146
447 Ga0495622_0005361 3300046557 Bacteria 5956
448 Ga0495622_0006317 3300046557 Bacteria 5501
449 Ga0495634_0000249 3300046642 Bacteria 50835
450 Ga0495634_0027901 3300046642 Bacteria 3924
451 Ga0495635_0000239 3300046663 Bacteria 34889
452 Ga0495635_0035103 3300046663 Bacteria 3477
453 Ga0495588_0000969 3300046674 Bacteria 12540
454 Ga0495588_0003787 3300046674 Bacteria 6628
455 Ga0495657_0212667 3300046675 Bacteria 1175
456 Ga0495599_0081034 3300046678 Bacteria 2027
457 Ga0495646_0005453 3300046680 Bacteria 8043
458 Ga0495647_0001674 3300046681 Bacteria 6865
459 Ga0495647_0006037 3300046681 Bacteria 3994
460 Ga0495658_0000894 3300046683 Bacteria 16029
461 Ga0495658_0001058 3300046683 Bacteria 14532
462 Ga0495613_0000929 3300046689 Bacteria 22466
463 Ga0495624_0029524 3300046690 Bacteria 3577
464 Ga0495581_0001238 3300047315 Bacteria 14050
465 Ga0495581_0009037 3300047315 Bacteria 5765
466 Ga0495674_0001854 3300047319 Bacteria 20818
467 Ga0495672_0086060 3300047320 Bacteria 1739
468 Ga0495676_0006581 3300047321 Bacteria 10709
469 Ga0495593_0000034 3300047673 Bacteria 57993
470 Ga0495593_0003109 3300047673 Bacteria 9989
471 Ga0495614_0033292 3300048089 Bacteria 2217
472 Ga0496100_0014301 3300048903 Bacteria 4605
473 Ga0496100_0036866 3300048903 Bacteria 3087
474 Ga0496100_0077437 3300048903 Bacteria 2236
475 Ga0496100_0097700 3300048903 Bacteria 2017
476 Ga0496100_0334359 3300048903 Bacteria 1141
477 Ga0496101_0004744 3300048904 Bacteria 8619
478 Ga0496101_0008012 3300048904 Bacteria 6887
479 Ga0496101_0016183 3300048904 Bacteria 5034
480 Ga0496101_0027240 3300048904 Bacteria 3979
481 Ga0496101_0050383 3300048904 Bacteria 2997
482 Ga0496102_0019579 3300048905 Bacteria 5962
483 Ga0496102_0041385 3300048905 Bacteria 4172
484 Ga0496102_0041393 3300048905 Bacteria 4171
485 Ga0496102_0043014 3300048905 Bacteria 4094
486 Ga0496102_0097661 3300048905 Bacteria 2724
487 Ga0496102_0136802 3300048905 Bacteria 2296
488 Ga0496102_0160435 3300048905 Bacteria 2115
489 Ga0496103_0021847 3300048906 Bacteria 3851
490 Ga0496103_0140629 3300048906 Bacteria 1543
491 Ga0496104_0000896 3300048907 Bacteria 25644
492 Ga0496104_0003861 3300048907 Bacteria 12964
493 Ga0496104_0012253 3300048907 Bacteria 7706
494 Ga0496104_0047777 3300048907 Bacteria 4034
495 Ga0496104_0067013 3300048907 Bacteria 3409
496 Ga0496104_0103233 3300048907 Bacteria 2731
497 Ga0496104_0110524 3300048907 Bacteria 2635
498 Ga0496104_0156641 3300048907 Bacteria 2186
499 Ga0496104_0473218 3300048907 Bacteria 1164
500 Ga0496105_0003076 3300048908 Bacteria 12259
501 Ga0496105_0010634 3300048908 Bacteria 7240
502 Ga0496105_0060224 3300048908 Bacteria 3132
503 Ga0496105_0267914 3300048908 Bacteria 1380
504 Ga0496106_0001165 3300048909 Bacteria 19535
505 Ga0496106_0003602 3300048909 Bacteria 11547
506 Ga0496106_0018675 3300048909 Bacteria 5133
507 Ga0496106_0056783 3300048909 Bacteria 2959
508 Ga0496106_0074183 3300048909 Bacteria 2604
509 Ga0496107_0000864 3300048910 Bacteria 17818
510 Ga0496107_0002347 3300048910 Bacteria 12226
511 Ga0496107_0007804 3300048910 Bacteria 7387
512 Ga0496107_0014980 3300048910 Bacteria 5430
513 Ga0496107_0042076 3300048910 Bacteria 3281
514 Ga0496108_0001756 3300048911 Bacteria 17236
515 Ga0496108_0003943 3300048911 Bacteria 11912
516 Ga0496108_0022494 3300048911 Bacteria 5184
517 Ga0496108_0027953 3300048911 Bacteria 4664
518 Ga0496108_0052743 3300048911 Bacteria 3409
519 Ga0496108_0080436 3300048911 Bacteria 2760
520 Ga0496109_0001766 3300048912 Bacteria 17962
521 Ga0496109_0007783 3300048912 Bacteria 9072
522 Ga0496109_0022983 3300048912 Bacteria 5529
523 Ga0496109_0089084 3300048912 Bacteria 2852
524 Ga0496109_0104497 3300048912 Bacteria 2630
525 Ga0496110_0006306 3300048913 Bacteria 9366
526 Ga0496110_0006833 3300048913 Bacteria 9070
527 Ga0496111_0039983 3300048914 Bacteria 3364
528 Ga0496111_0047425 3300048914 Bacteria 3094
529 Ga0496111_0085829 3300048914 Bacteria 2302
530 Ga0496112_0004975 3300048915 Bacteria 11392
531 Ga0496112_0015968 3300048915 Bacteria 7020
532 Ga0496112_0033821 3300048915 Bacteria 4972
533 Ga0496113_0006365 3300048916 Bacteria 7473
534 Ga0496113_0010550 3300048916 Bacteria 6112
535 Ga0496114_0006801 3300048917 Bacteria 9007
536 Ga0496114_0021328 3300048917 Bacteria 5270
537 Ga0496114_0146345 3300048917 Bacteria 2048
538 Ga0496115_0004097 3300048918 Bacteria 10520
539 Ga0496115_0006428 3300048918 Bacteria 8611
540 Ga0496115_0008945 3300048918 Bacteria 7428
541 Ga0496115_0080950 3300048918 Bacteria 2644
542 Ga0496119_0006190 3300048922 Bacteria 11190
543 Ga0496122_0004307 3300048925 Bacteria 17825
544 Ga0496123_0001264 3300048926 Bacteria 36241
545 Ga0496124_0021627 3300048927 Bacteria 5925
546 Ga0501032_0005003 3300049569 Bacteria 9911
547 Ga0501032_0148701 3300049569 Bacteria 1541
548 Ga0501033_0000951 3300049570 Bacteria 26299
549 Ga0501034_0000068 3300049571 Bacteria 182904
550 Ga0501034_0122200 3300049571 Bacteria 2590
551 Ga0501036_0073052 3300049572 Bacteria 2900
552 Ga0501036_0198103 3300049572 Bacteria 1689
553 Ga0501036_0215419 3300049572 Bacteria 1613
554 Ga0501037_0004019 3300049573 Bacteria 10664
555 Ga0501037_0014308 3300049573 Bacteria 5846
556 Ga0501037_0055452 3300049573 Bacteria 2897
557 Ga0501037_0184260 3300049573 Bacteria 1480
558 Ga0501038_0002206 3300049574 Bacteria 18110
559 Ga0501038_0018478 3300049574 Bacteria 6294
560 Ga0501038_0068898 3300049574 Bacteria 3006
561 Ga0501038_0101530 3300049574 Bacteria 2394
562 Ga0501038_0121078 3300049574 Bacteria 2158
563 Ga0501039_0000138 3300049575 Bacteria 49539
564 Ga0501039_0049318 3300049575 Bacteria 3254
565 Ga0501039_0071747 3300049575 Bacteria 2691
566 Ga0501040_0018623 3300049576 Bacteria 4611
567 Ga0501040_0118882 3300049576 Bacteria 1853
568 Ga0501040_0245199 3300049576 Bacteria 1277
569 Ga0501041_0138617 3300049577 Bacteria 1516
570 Ga0501042_0054738 3300049578 Bacteria 2846
571 Ga0501042_0113757 3300049578 Bacteria 1949
572 Ga0501043_0008635 3300049579 Bacteria 8029
573 Ga0501043_0016672 3300049579 Bacteria 5756
574 Ga0501043_0045168 3300049579 Bacteria 3464
575 Ga0501046_0000246 3300049580 Bacteria 55453
576 Ga0501046_0001138 3300049580 Bacteria 25939
577 Ga0501046_0009035 3300049580 Bacteria 8640
578 Ga0501046_0029168 3300049580 Bacteria 4487
579 Ga0501046_0033104 3300049580 Bacteria 4180
580 Ga0501046_0099067 3300049580 Bacteria 2238
581 Ga0501047_0000873 3300049581 Bacteria 30764
582 Ga0501047_0045210 3300049581 Bacteria 4257
583 Ga0501047_0047475 3300049581 Bacteria 4148
584 Ga0501047_0222274 3300049581 Bacteria 1744
585 Ga0501047_0241804 3300049581 Bacteria 1656
586 Ga0501048_0003772 3300049582 Bacteria 11565
587 Ga0501048_0025718 3300049582 Bacteria 4288
588 Ga0501048_0096937 3300049582 Bacteria 2080
589 Ga0501048_0111950 3300049582 Bacteria 1928
590 Ga0501067_0000720 3300049583 Bacteria 17832
591 Ga0501067_0002784 3300049583 Bacteria 9618
592 Ga0501068_0093350 3300049584 Bacteria 1859
593 Ga0501069_0095720 3300049585 Bacteria 1682
594 Ga0501069_0120888 3300049585 Bacteria 1496
595 Ga0501070_0018079 3300049586 Bacteria 5915
596 Ga0501070_0128627 3300049586 Bacteria 2093
597 Ga0501071_0135895 3300049587 Bacteria 1829
598 Ga0501072_0047056 3300049588 Bacteria 3397
599 Ga0501072_0078433 3300049588 Bacteria 2615
600 Ga0501072_0082658 3300049588 Bacteria 2546
601 Ga0501072_0149359 3300049588 Bacteria 1863
602 Ga0501073_0035793 3300049589 Bacteria 3527
603 Ga0501073_0052011 3300049589 Bacteria 2869
604 Ga0501074_0008973 3300049590 Bacteria 7254
605 Ga0501074_0090284 3300049590 Bacteria 2194
606 Ga0501074_0179244 3300049590 Bacteria 1512
607 Ga0501075_0023749 3300049591 Bacteria 4490
608 Ga0501075_0085786 3300049591 Bacteria 2385
609 Ga0501076_0017141 3300049592 Bacteria 5502
610 Ga0501076_0201687 3300049592 Bacteria 1624
611 Ga0501077_0006521 3300049593 Bacteria 7162
612 Ga0501077_0013027 3300049593 Bacteria 5210
613 Ga0501077_0018697 3300049593 Bacteria 4383
614 Ga0501077_0024533 3300049593 Bacteria 3829
615 Ga0501077_0072055 3300049593 Bacteria 2189
616 Ga0501077_0097586 3300049593 Bacteria 1862
617 Ga0501077_0102564 3300049593 Bacteria 1812
618 Ga0501079_0100692 3300049741 Bacteria 2240
619 Ga0501079_0124167 3300049741 Bacteria 2008
620 Ga0501079_0496256 3300049741 Bacteria 960
621 Ga0501080_0000001 3300049742 Bacteria 241365
622 Ga0501080_0218400 3300049742 Bacteria 1745
623 Ga0501080_0277943 3300049742 Bacteria 1523
624 Ga0501081_0009205 3300049743 Bacteria 6432
625 Ga0501081_0025931 3300049743 Bacteria 3948
626 Ga0501081_0064699 3300049743 Bacteria 2540
627 Ga0501081_0077345 3300049743 Bacteria 2325
628 Ga0501083_0067024 3300049744 Bacteria 2390
629 Ga0501083_0093525 3300049744 Bacteria 1985
630 Ga0501035_0000015 3300049822 Bacteria 246493
631 Ga0501035_0123163 3300049822 Bacteria 2265
632 Ga0501035_0140810 3300049822 Bacteria 2097
633 Ga0501035_0223043 3300049822 Bacteria 1609
634 Ga0501044_0000026 3300049823 Bacteria 183624
635 Ga0501044_0024381 3300049823 Bacteria 6423
636 Ga0501044_0071079 3300049823 Bacteria 3539
637 Ga0501044_0088879 3300049823 Bacteria 3119
638 Ga0501044_0137160 3300049823 Bacteria 2437
639 Ga0501045_0057189 3300049824 Bacteria 2854
640 Ga0501045_0081341 3300049824 Bacteria 2388
641 Ga0501045_0113765 3300049824 Bacteria 2007
642 Ga0501045_0154905 3300049824 Bacteria 1705
643 Ga0501045_0215720 3300049824 Bacteria 1429
644 nmdc:mga03n38_4892_c1 3300050490 Bacteria 4492
645 nmdc:mga0yw44_6754_c1 3300050492 Bacteria 5573
646 nmdc:mga0yw44_82060_c1 3300050492 Bacteria 2022
647 nmdc:mga06z11_10108_c1 3300050494 Bacteria 4006
648 nmdc:mga06z11_2473_c1 3300050494 Bacteria 7065
649 nmdc:mga06z11_5316_c1 3300050494 Bacteria 5158
650 nmdc:mga05p37_104104_c1 3300050507 Bacteria 3492
651 nmdc:mga05p37_272375_c1 3300050507 Bacteria 2022
652 nmdc:mga05p37_662089_c1 3300050507 Bacteria 1167
653 nmdc:mga09592_140460_c1 3300050508 Bacteria 2082
654 nmdc:mga09592_86312_c1 3300050508 Bacteria 2678
655 nmdc:mga0qj67_101136_c1 3300050509 Bacteria 2324
656 nmdc:mga0qj67_139930_c1 3300050509 Bacteria 1962
657 nmdc:mga0qj67_2593_c1 3300050509 Bacteria 12934
658 nmdc:mga0qj67_5024_c1 3300050509 Bacteria 9611
659 nmdc:mga06r32_121694_c1 3300050510 Bacteria 2575
660 nmdc:mga06r32_122065_c1 3300050510 Bacteria 2571
661 nmdc:mga06r32_158391_c1 3300050510 Bacteria 2246
662 nmdc:mga06r32_171466_c1 3300050510 Bacteria 2154
663 nmdc:mga06r32_171925_c1 3300050510 Bacteria 2151
664 nmdc:mga06r32_194225_c1 3300050510 Bacteria 2017
665 nmdc:mga06r32_207291_c1 3300050510 Bacteria 1948
666 nmdc:mga08y16_29966_c1 3300050511 Bacteria 5730
667 nmdc:mga08y16_344153_c1 3300050511 Bacteria 1532
668 nmdc:mga08y16_38717_c1 3300050511 Bacteria 5004
669 nmdc:mga08y16_4688_c1 3300050511 Bacteria 14246
670 nmdc:mga08y16_75735_c1 3300050511 Bacteria 3507
671 nmdc:mga0n895_4339_c1 3300050512 Bacteria 11624
672 nmdc:mga0rr50_206727_c1 3300050513 Bacteria 1616
673 nmdc:mga08x19_122731_c1 3300050514 Bacteria 1743
674 nmdc:mga0a205_15593_c1 3300050515 Bacteria 7102
675 nmdc:mga0a205_172290_c1 3300050515 Bacteria 2060
676 Ga0495601_0003880 3300053077 Bacteria 8610
677 Ga0495619_0000737 3300053085 Bacteria 21356
678 Ga0500651_0121984 3300053093 Bacteria 1582
679 Ga0500641_0102935 3300053096 Bacteria 1225
680 Ga0500556_0000880 3300053104 Bacteria 16880
681 Ga0500556_0005856 3300053104 Bacteria 3479
682 Ga0500556_0028955 3300053104 Bacteria 1863
683 Ga0500595_003935 3300053119 Bacteria 6804
684 Ga0500595_030317 3300053119 Bacteria 1824
685 Ga0500603_000277 3300053150 Bacteria 13486
686 Ga0500616_0087068 3300053153 Bacteria 1556
687 Ga0500645_001299 3300053730 Bacteria 12970
688 Ga0500645_048969 3300053730 Bacteria 1237
689 Ga0501084_0048092 3300054114 Bacteria 3571
690 Ga0501084_0074180 3300054114 Bacteria 2849
691 Ga0501084_0105553 3300054114 Bacteria 2366
692 Ga0501084_0138192 3300054114 Bacteria 2051
693 Ga0501084_0182300 3300054114 Bacteria 1773
694 Ga0501082_0011098 3300060353 Bacteria 7745
695 Ga0501082_0021150 3300060353 Bacteria 5611
696 Ga0501082_0069173 3300060353 Bacteria 3039
697 Ga0501082_0106698 3300060353 Bacteria 2423
698 Ga0501082_0180095 3300060353 Bacteria 1838
699 Ga0466962_0161495 3300061719 Bacteria 1089
700 Ga0530510_0007129 3300061734 Bacteria 7781
701 Ga0530510_0013419 3300061734 Bacteria 5760
702 Ga0530510_0039774 3300061734 Bacteria 3394
703 Ga0530510_0072416 3300061734 Bacteria 2501
704 Ga0530510_0080532 3300061734 Bacteria 2370
705 Ga0530510_0089578 3300061734 Bacteria 2243

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10009994 Ga0307513_100099946 287
2 3300053093 Ga0500651_0121984 Ga0500651_0121984_594_1547 287
3 3300031901 Ga0307406_10086022 Ga0307406_100860222 290
4 3300049591 Ga0501075_0085786 Ga0501075_0085786_566_1534 291
5 3300049593 Ga0501077_0006521 Ga0501077_0006521_1998_3017 291
6 3300049741 Ga0501079_0100692 Ga0501079_0100692_362_1330 291
7 3300049743 Ga0501081_0025931 Ga0501081_0025931_2807_3826 291
8 3300054114 Ga0501084_0105553 Ga0501084_0105553_862_1881 291
9 3300060353 Ga0501082_0021150 Ga0501082_0021150_2576_3595 291
10 3300061734 Ga0530510_0089578 Ga0530510_0089578_963_2003 291
11 3300009147 Ga0114129_10039389 Ga0114129_100393892 293
12 3300026118 Ga0207675_100218573 Ga0207675_1002185732 293
13 3300035084 Ga0373928_0015017 Ga0373928_0015017_605_1531 293
14 3300035090 Ga0373949_0009978 Ga0373949_0009978_823_1749 293
15 3300046491 Ga0495584_0035251 Ga0495584_0035251_1575_2501 293
16 3300050507 nmdc:mga05p37_662089_c1 nmdc:mga05p37_662089_c1_182_1108 293
17 3300050511 nmdc:mga08y16_344153_c1 nmdc:mga08y16_344153_c1_85_1011 293
18 3300050511 nmdc:mga08y16_75735_c1 nmdc:mga08y16_75735_c1_1950_2876 293
19 3300053153 Ga0500616_0087068 Ga0500616_0087068_600_1523 293
20 3300049824 Ga0501045_0113765 Ga0501045_0113765_210_1178 294
21 3300006847 Ga0075431_100001669 Ga0075431_10000166914 297
22 3300025935 Ga0207709_10150707 Ga0207709_101507072 297
23 3300049743 Ga0501081_0009205 Ga0501081_0009205_5136_6164 297
24 3300054114 Ga0501084_0074180 Ga0501084_0074180_325_1356 297
25 3300005843 Ga0068860_100313817 Ga0068860_1003138172 300
26 3300031251 Ga0265327_10045148 Ga0265327_100451482 300
27 3300048907 Ga0496104_0103233 Ga0496104_0103233_434_1351 300
28 3300048909 Ga0496106_0001165 Ga0496106_0001165_12352_13269 300
29 3300048911 Ga0496108_0003943 Ga0496108_0003943_1742_2659 300
30 3300048912 Ga0496109_0001766 Ga0496109_0001766_6065_6982 300
31 3300048913 Ga0496110_0006833 Ga0496110_0006833_3895_4812 300
32 3300048915 Ga0496112_0015968 Ga0496112_0015968_3998_4915 300
33 3300049573 Ga0501037_0055452 Ga0501037_0055452_1605_2522 300
34 3300049574 Ga0501038_0002206 Ga0501038_0002206_4723_5640 300
35 3300049574 Ga0501038_0068898 Ga0501038_0068898_1638_2555 300
36 3300049576 Ga0501040_0118882 Ga0501040_0118882_23_940 300
37 3300049579 Ga0501043_0008635 Ga0501043_0008635_3976_4893 300
38 3300049579 Ga0501043_0045168 Ga0501043_0045168_933_1850 300
39 3300049581 Ga0501047_0222274 Ga0501047_0222274_504_1421 300
40 3300049741 Ga0501079_0124167 Ga0501079_0124167_356_1273 300
41 3300049744 Ga0501083_0067024 Ga0501083_0067024_1338_2255 300
42 3300049823 Ga0501044_0024381 Ga0501044_0024381_3153_4070 300
43 3300049824 Ga0501045_0081341 Ga0501045_0081341_258_1175 300
44 iso_pu_bacteria 2595698237 2596374190 300
45 iso_pu_bacteria 2889306138 2889307148 300
46 iso_pu_bacteria 2902330777 2902333018 300
47 iso_pu_bacteria 2902405164 2902411939 300
48 iso_pu_bacteria 2928125067 2928129776 300
49 3300005336 Ga0070680_100141690 Ga0070680_1001416902 301
50 3300005339 Ga0070660_100002003 Ga0070660_1000020038 301
51 3300005341 Ga0070691_10043067 Ga0070691_100430672 301
52 3300005344 Ga0070661_100092817 Ga0070661_1000928172 301
53 3300005353 Ga0070669_100037889 Ga0070669_1000378892 301
54 3300005354 Ga0070675_100457065 Ga0070675_1004570651 301
55 3300005366 Ga0070659_100174085 Ga0070659_1001740852 301
56 3300005435 Ga0070714_100291835 Ga0070714_1002918352 301
57 3300005436 Ga0070713_100040503 Ga0070713_1000405033 301
58 3300005439 Ga0070711_100084248 Ga0070711_1000842482 301
59 3300005445 Ga0070708_100041592 Ga0070708_1000415924 301
60 3300005455 Ga0070663_100031501 Ga0070663_1000315012 301
61 3300005456 Ga0070678_100044929 Ga0070678_1000449292 301
62 3300005459 Ga0068867_100036668 Ga0068867_1000366683 301
63 3300005468 Ga0070707_100166870 Ga0070707_1001668702 301
64 3300005535 Ga0070684_100014119 Ga0070684_1000141195 301
65 3300005539 Ga0068853_100008362 Ga0068853_1000083623 301
66 3300005548 Ga0070665_100021991 Ga0070665_1000219914 301
67 3300005549 Ga0070704_100308289 Ga0070704_1003082891 301
68 3300005563 Ga0068855_100030914 Ga0068855_1000309145 301
69 3300005563 Ga0068855_100042928 Ga0068855_1000429284 301
70 3300005577 Ga0068857_100021812 Ga0068857_1000218124 301
71 3300005616 Ga0068852_100161808 Ga0068852_1001618082 301
72 3300005617 Ga0068859_100768927 Ga0068859_1007689271 301
73 3300005718 Ga0068866_10057930 Ga0068866_100579302 301
74 3300005844 Ga0068862_100214141 Ga0068862_1002141412 301
75 3300005937 Ga0081455_10006756 Ga0081455_100067569 301
76 3300006048 Ga0075363_100147974 Ga0075363_1001479742 301
77 3300006163 Ga0070715_10058258 Ga0070715_100582582 301
78 3300006173 Ga0070716_100009188 Ga0070716_1000091883 301
79 3300006175 Ga0070712_100263942 Ga0070712_1002639422 301
80 3300006846 Ga0075430_100006827 Ga0075430_1000068275 301
81 3300006846 Ga0075430_100057057 Ga0075430_1000570572 301
82 3300006847 Ga0075431_100015632 Ga0075431_1000156325 301
83 3300006881 Ga0068865_100159867 Ga0068865_1001598672 301
84 3300006931 Ga0097620_100768888 Ga0097620_1007688881 301
85 3300009093 Ga0105240_10017201 Ga0105240_100172015 301
86 3300009094 Ga0111539_10013581 Ga0111539_100135816 301
87 3300009098 Ga0105245_10052351 Ga0105245_100523512 301
88 3300009147 Ga0114129_10286667 Ga0114129_102866672 301
89 3300009148 Ga0105243_10077781 Ga0105243_100777813 301
90 3300009545 Ga0105237_10013047 Ga0105237_100130476 301
91 3300009551 Ga0105238_10074495 Ga0105238_100744952 301
92 3300009553 Ga0105249_10020835 Ga0105249_100208353 301
93 3300010375 Ga0105239_10202847 Ga0105239_102028472 301
94 3300013297 Ga0157378_10164863 Ga0157378_101648633 301
95 3300013306 Ga0163162_10344829 Ga0163162_103448292 301
96 3300013308 Ga0157375_10297543 Ga0157375_102975432 301
97 3300014326 Ga0157380_10039991 Ga0157380_100399913 301
98 3300014968 Ga0157379_10266007 Ga0157379_102660072 301
99 3300014969 Ga0157376_10205715 Ga0157376_102057152 301
100 3300021377 Ga0213874_10031407 Ga0213874_100314072 301
101 3300025295 Ga0209564_1000485 Ga0209564_100048524 301
102 3300025898 Ga0207692_10083908 Ga0207692_100839082 301
103 3300025901 Ga0207688_10082994 Ga0207688_100829942 301
104 3300025912 Ga0207707_10118204 Ga0207707_101182042 301
105 3300025914 Ga0207671_10013744 Ga0207671_100137445 301
106 3300025915 Ga0207693_10027789 Ga0207693_100277892 301
107 3300025916 Ga0207663_10028091 Ga0207663_100280912 301
108 3300025917 Ga0207660_10065983 Ga0207660_100659832 301
109 3300025918 Ga0207662_10039597 Ga0207662_100395975 301
110 3300025919 Ga0207657_10002910 Ga0207657_100029108 301
111 3300025920 Ga0207649_10295662 Ga0207649_102956621 301
112 3300025921 Ga0207652_10065819 Ga0207652_100658192 301
113 3300025921 Ga0207652_10118830 Ga0207652_101188302 301
114 3300025922 Ga0207646_10056330 Ga0207646_100563303 301
115 3300025924 Ga0207694_10090191 Ga0207694_100901912 301
116 3300025926 Ga0207659_10226482 Ga0207659_102264822 301
117 3300025927 Ga0207687_10067076 Ga0207687_100670762 301
118 3300025929 Ga0207664_10234462 Ga0207664_102344622 301
119 3300025932 Ga0207690_10100332 Ga0207690_101003322 301
120 3300025932 Ga0207690_10104894 Ga0207690_101048942 301
121 3300025935 Ga0207709_10098640 Ga0207709_100986402 301
122 3300025938 Ga0207704_10176442 Ga0207704_101764422 301
123 3300025940 Ga0207691_10019021 Ga0207691_100190215 301
124 3300025944 Ga0207661_10011376 Ga0207661_100113765 301
125 3300025949 Ga0207667_10007538 Ga0207667_100075386 301
126 3300025961 Ga0207712_10055902 Ga0207712_100559023 301
127 3300026041 Ga0207639_10009638 Ga0207639_100096384 301
128 3300026067 Ga0207678_10039941 Ga0207678_100399413 301
129 3300026075 Ga0207708_10060504 Ga0207708_100605042 301
130 3300026116 Ga0207674_10031482 Ga0207674_100314823 301
131 3300026118 Ga0207675_100038220 Ga0207675_1000382204 301
132 3300026121 Ga0207683_10042740 Ga0207683_100427402 301
133 3300026142 Ga0207698_10081343 Ga0207698_100813432 301
134 3300026142 Ga0207698_10172274 Ga0207698_101722742 301
135 3300027907 Ga0207428_10164272 Ga0207428_101642722 301
136 3300033180 Ga0307510_10004348 Ga0307510_100043486 301
137 3300035113 Ga0373936_0059575 Ga0373936_0059575_537_1457 301
138 3300035170 Ga0373943_0006580 Ga0373943_0006580_1468_2388 301
139 3300035692 Ga0373935_0000259 Ga0373935_0000259_16376_17296 301
140 3300035695 Ga0373927_0000339 Ga0373927_0000339_35491_36411 301
141 3300035725 Ga0373947_0000217 Ga0373947_0000217_14342_15262 301
142 3300036401 Ga0373937_0373348 Ga0373937_0373348_134_1054 301
143 3300037068 Ga0373925_0004501 Ga0373925_0004501_6397_7317 301
144 3300037418 Ga0395900_0445417 Ga0395900_0445417_216_1142 301
145 3300037466 Ga0395898_0160374 Ga0395898_0160374_987_1913 301
146 3300039437 Ga0436365_0023590 Ga0436365_0023590_272_1189 301
147 3300039447 Ga0436361_1121961 Ga0436361_1121961_2825_3751 301
148 3300039450 Ga0436363_0713686 Ga0436363_0713686_530_1462 301
149 3300044735 Ga0466968_0003374 Ga0466968_0003374_2575_3501 301
150 3300045976 Ga0466967_0499703 Ga0466967_0499703_229_1155 301
151 3300046454 Ga0495592_0045306 Ga0495592_0045306_398_1318 301
152 3300046455 Ga0495603_0000352 Ga0495603_0000352_7687_8607 301
153 3300046459 Ga0495629_0003719 Ga0495629_0003719_6519_7439 301
154 3300046472 Ga0495580_0062999 Ga0495580_0062999_362_1282 301
155 3300046473 Ga0495582_0000245 Ga0495582_0000245_28484_29404 301
156 3300046474 Ga0495605_0099169 Ga0495605_0099169_33_953 301
157 3300046475 Ga0495639_0001973 Ga0495639_0001973_515_1435 301
158 3300046476 Ga0495662_0000872 Ga0495662_0000872_7396_8316 301
159 3300046477 Ga0495664_0004666 Ga0495664_0004666_5814_6734 301
160 3300046499 Ga0495594_0001257 Ga0495594_0001257_11921_12841 301
161 3300046517 Ga0495630_0100139 Ga0495630_0100139_536_1456 301
162 3300046526 Ga0495666_0041105 Ga0495666_0041105_1188_2108 301
163 3300046531 Ga0495665_0000361 Ga0495665_0000361_5481_6401 301
164 3300046533 Ga0495640_0003002 Ga0495640_0003002_5480_6400 301
165 3300046535 Ga0495586_0055550 Ga0495586_0055550_247_1170 301
166 3300046557 Ga0495622_0006317 Ga0495622_0006317_927_1847 301
167 3300046642 Ga0495634_0000249 Ga0495634_0000249_6991_7911 301
168 3300046663 Ga0495635_0000239 Ga0495635_0000239_4650_5570 301
169 3300046674 Ga0495588_0003787 Ga0495588_0003787_850_1770 301
170 3300046675 Ga0495657_0212667 Ga0495657_0212667_147_1067 301
171 3300046678 Ga0495599_0081034 Ga0495599_0081034_998_1918 301
172 3300046680 Ga0495646_0005453 Ga0495646_0005453_2188_3108 301
173 3300046681 Ga0495647_0001674 Ga0495647_0001674_5520_6440 301
174 3300046683 Ga0495658_0001058 Ga0495658_0001058_5648_6568 301
175 3300046689 Ga0495613_0000929 Ga0495613_0000929_15838_16758 301
176 3300047315 Ga0495581_0001238 Ga0495581_0001238_12480_13400 301
177 3300047319 Ga0495674_0001854 Ga0495674_0001854_12452_13372 301
178 3300047320 Ga0495672_0086060 Ga0495672_0086060_532_1452 301
179 3300047673 Ga0495593_0000034 Ga0495593_0000034_50935_51855 301
180 3300048089 Ga0495614_0033292 Ga0495614_0033292_384_1304 301
181 3300048903 Ga0496100_0097700 Ga0496100_0097700_491_1414 301
182 3300048917 Ga0496114_0146345 Ga0496114_0146345_567_1487 301
183 3300049570 Ga0501033_0000951 Ga0501033_0000951_19826_20746 301
184 3300049572 Ga0501036_0198103 Ga0501036_0198103_103_1023 301
185 3300049573 Ga0501037_0004019 Ga0501037_0004019_7956_8876 301
186 3300049573 Ga0501037_0184260 Ga0501037_0184260_265_1185 301
187 3300049574 Ga0501038_0018478 Ga0501038_0018478_641_1561 301
188 3300049574 Ga0501038_0101530 Ga0501038_0101530_1067_1987 301
189 3300049575 Ga0501039_0049318 Ga0501039_0049318_1049_1969 301
190 3300049579 Ga0501043_0016672 Ga0501043_0016672_1065_1985 301
191 3300049580 Ga0501046_0029168 Ga0501046_0029168_534_1454 301
192 3300049822 Ga0501035_0140810 Ga0501035_0140810_704_1624 301
193 3300049823 Ga0501044_0071079 Ga0501044_0071079_1274_2194 301
194 3300050507 nmdc:mga05p37_272375_c1 nmdc:mga05p37_272375_c1_277_1209 301
195 3300050509 nmdc:mga0qj67_139930_c1 nmdc:mga0qj67_139930_c1_464_1486 301
196 3300050509 nmdc:mga0qj67_2593_c1 nmdc:mga0qj67_2593_c1_561_1493 301
197 3300050510 nmdc:mga06r32_121694_c1 nmdc:mga06r32_121694_c1_1582_2514 301
198 3300050511 nmdc:mga08y16_38717_c1 nmdc:mga08y16_38717_c1_2320_3252 301
199 3300053096 Ga0500641_0102935 Ga0500641_0102935_143_1069 301
200 3300053104 Ga0500556_0028955 Ga0500556_0028955_232_1155 301
201 3300053119 Ga0500595_003935 Ga0500595_003935_3820_4743 301
202 3300061719 Ga0466962_0161495 Ga0466962_0161495_56_976 301
203 iso_pu_bacteria 2721755755 2723843078 301
204 iso_pu_bacteria 2791355199 2793079515 301
205 iso_pu_bacteria 2829745981 2829749747 301
206 iso_pu_bacteria 2842698319 2842702397 301
207 iso_pu_bacteria 2861691609 2861693456 301
208 iso_pu_bacteria 2876761206 2876762404 301
209 iso_pu_bacteria 643348564 643604994 301
210 iso_pu_bacteria 8006984368 8006989353 301
211 iso_pu_bacteria 8056673599 8056674869 301
212 3300005330 Ga0070690_100240637 Ga0070690_1002406372 302
213 3300005334 Ga0068869_100055145 Ga0068869_1000551451 302
214 3300005336 Ga0070680_100003071 Ga0070680_1000030718 302
215 3300005336 Ga0070680_100063518 Ga0070680_1000635182 302
216 3300005337 Ga0070682_100005762 Ga0070682_1000057622 302
217 3300005345 Ga0070692_10118036 Ga0070692_101180361 302
218 3300005406 Ga0070703_10000738 Ga0070703_100007383 302
219 3300005438 Ga0070701_10003932 Ga0070701_100039325 302
220 3300005438 Ga0070701_10129740 Ga0070701_101297401 302
221 3300005440 Ga0070705_100001479 Ga0070705_1000014793 302
222 3300005440 Ga0070705_100050475 Ga0070705_1000504752 302
223 3300005441 Ga0070700_100012951 Ga0070700_1000129514 302
224 3300005444 Ga0070694_100126384 Ga0070694_1001263842 302
225 3300005445 Ga0070708_100061419 Ga0070708_1000614193 302
226 3300005455 Ga0070663_100003445 Ga0070663_1000034457 302
227 3300005455 Ga0070663_100090695 Ga0070663_1000906952 302
228 3300005458 Ga0070681_10000939 Ga0070681_100009395 302
229 3300005458 Ga0070681_10014733 Ga0070681_100147335 302
230 3300005459 Ga0068867_100156317 Ga0068867_1001563171 302
231 3300005468 Ga0070707_100034678 Ga0070707_1000346785 302
232 3300005518 Ga0070699_100001258 Ga0070699_10000125811 302
233 3300005544 Ga0070686_100040502 Ga0070686_1000405022 302
234 3300005546 Ga0070696_100000199 Ga0070696_10000019926 302
235 3300005546 Ga0070696_100044315 Ga0070696_1000443152 302
236 3300005547 Ga0070693_100002723 Ga0070693_1000027237 302
237 3300005549 Ga0070704_100001140 Ga0070704_1000011407 302
238 3300005549 Ga0070704_100081177 Ga0070704_1000811771 302
239 3300005577 Ga0068857_100010845 Ga0068857_1000108452 302
240 3300005577 Ga0068857_100085275 Ga0068857_1000852753 302
241 3300005617 Ga0068859_100195348 Ga0068859_1001953482 302
242 3300005618 Ga0068864_100013353 Ga0068864_1000133535 302
243 3300005618 Ga0068864_100326283 Ga0068864_1003262831 302
244 3300005718 Ga0068866_10011117 Ga0068866_100111174 302
245 3300005719 Ga0068861_100221076 Ga0068861_1002210762 302
246 3300005840 Ga0068870_10064936 Ga0068870_100649362 302
247 3300005841 Ga0068863_100139933 Ga0068863_1001399332 302
248 3300005841 Ga0068863_100386187 Ga0068863_1003861872 302
249 3300005842 Ga0068858_100118767 Ga0068858_1001187672 302
250 3300005842 Ga0068858_100209204 Ga0068858_1002092042 302
251 3300005843 Ga0068860_100012706 Ga0068860_1000127065 302
252 3300005844 Ga0068862_100004157 Ga0068862_1000041578 302
253 3300005981 Ga0081538_10114849 Ga0081538_101148492 302
254 3300005983 Ga0081540_1008498 Ga0081540_10084983 302
255 3300005985 Ga0081539_10043185 Ga0081539_100431853 302
256 3300006038 Ga0075365_10167966 Ga0075365_101679661 302
257 3300006042 Ga0075368_10002354 Ga0075368_100023543 302
258 3300006048 Ga0075363_100013015 Ga0075363_1000130153 302
259 3300006163 Ga0070715_10099577 Ga0070715_100995772 302
260 3300006178 Ga0075367_10027267 Ga0075367_100272672 302
261 3300006358 Ga0068871_100186662 Ga0068871_1001866622 302
262 3300006844 Ga0075428_100138493 Ga0075428_1001384932 302
263 3300006846 Ga0075430_100008098 Ga0075430_1000080983 302
264 3300006847 Ga0075431_100016133 Ga0075431_1000161334 302
265 3300006871 Ga0075434_100006094 Ga0075434_1000060943 302
266 3300006880 Ga0075429_100378431 Ga0075429_1003784312 302
267 3300006881 Ga0068865_100323847 Ga0068865_1003238472 302
268 3300006931 Ga0097620_100195348 Ga0097620_1001953482 302
269 3300009094 Ga0111539_10002984 Ga0111539_1000298413 302
270 3300009094 Ga0111539_10029331 Ga0111539_100293312 302
271 3300009094 Ga0111539_10472320 Ga0111539_104723201 302
272 3300009101 Ga0105247_10172977 Ga0105247_101729772 302
273 3300009147 Ga0114129_10006490 Ga0114129_100064908 302
274 3300009147 Ga0114129_10405923 Ga0114129_104059232 302
275 3300009148 Ga0105243_10059120 Ga0105243_100591202 302
276 3300009174 Ga0105241_10124317 Ga0105241_101243172 302
277 3300009177 Ga0105248_10344234 Ga0105248_103442341 302
278 3300009545 Ga0105237_10006667 Ga0105237_100066675 302
279 3300009551 Ga0105238_10056851 Ga0105238_100568513 302
280 3300009553 Ga0105249_10048959 Ga0105249_100489592 302
281 3300011119 Ga0105246_10012955 Ga0105246_100129554 302
282 3300011119 Ga0105246_10137577 Ga0105246_101375772 302
283 3300013306 Ga0163162_10329713 Ga0163162_103297132 302
284 3300014326 Ga0157380_10100365 Ga0157380_101003653 302
285 3300014968 Ga0157379_10034256 Ga0157379_100342562 302
286 3300014968 Ga0157379_10188887 Ga0157379_101888872 302
287 3300014969 Ga0157376_10125052 Ga0157376_101250522 302
288 3300014969 Ga0157376_10382186 Ga0157376_103821862 302
289 3300017792 Ga0163161_10006062 Ga0163161_100060622 302
290 3300017792 Ga0163161_10210100 Ga0163161_102101001 302
291 3300025885 Ga0207653_10001221 Ga0207653_100012216 302
292 3300025908 Ga0207643_10053536 Ga0207643_100535362 302
293 3300025910 Ga0207684_10063894 Ga0207684_100638942 302
294 3300025911 Ga0207654_10057474 Ga0207654_100574742 302
295 3300025912 Ga0207707_10021729 Ga0207707_100217294 302
296 3300025912 Ga0207707_10055109 Ga0207707_100551093 302
297 3300025917 Ga0207660_10044863 Ga0207660_100448633 302
298 3300025917 Ga0207660_10046845 Ga0207660_100468453 302
299 3300025921 Ga0207652_10019094 Ga0207652_100190942 302
300 3300025922 Ga0207646_10050170 Ga0207646_100501702 302
301 3300025935 Ga0207709_10189739 Ga0207709_101897392 302
302 3300025940 Ga0207691_10175841 Ga0207691_101758412 302
303 3300025961 Ga0207712_10103501 Ga0207712_101035012 302
304 3300025972 Ga0207668_10067997 Ga0207668_100679972 302
305 3300026035 Ga0207703_10232955 Ga0207703_102329552 302
306 3300026067 Ga0207678_10000635 Ga0207678_1000063521 302
307 3300026075 Ga0207708_10006325 Ga0207708_100063254 302
308 3300026075 Ga0207708_10043439 Ga0207708_100434394 302
309 3300026075 Ga0207708_10090745 Ga0207708_100907452 302
310 3300026089 Ga0207648_10171095 Ga0207648_101710952 302
311 3300026089 Ga0207648_10211581 Ga0207648_102115812 302
312 3300026095 Ga0207676_10009929 Ga0207676_100099295 302
313 3300026116 Ga0207674_10002969 Ga0207674_1000296915 302
314 3300026118 Ga0207675_100021202 Ga0207675_1000212023 302
315 3300026118 Ga0207675_100130678 Ga0207675_1001306782 302
316 3300027866 Ga0209813_10002124 Ga0209813_100021242 302
317 3300027907 Ga0207428_10003753 Ga0207428_100037537 302
318 3300028380 Ga0268265_10007628 Ga0268265_100076286 302
319 3300028380 Ga0268265_10100982 Ga0268265_101009821 302
320 3300028380 Ga0268265_10242537 Ga0268265_102425371 302
321 3300028381 Ga0268264_10003915 Ga0268264_100039158 302
322 3300028381 Ga0268264_10048635 Ga0268264_100486352 302
323 3300028381 Ga0268264_10427995 Ga0268264_104279952 302
324 3300031824 Ga0307413_10152447 Ga0307413_101524471 302
325 3300033180 Ga0307510_10176364 Ga0307510_101763642 302
326 3300035115 Ga0373941_0004480 Ga0373941_0004480_1916_2881 302
327 3300035117 Ga0373953_0007878 Ga0373953_0007878_538_1503 302
328 3300035695 Ga0373927_0106323 Ga0373927_0106323_234_1202 302
329 3300037068 Ga0373925_0248511 Ga0373925_0248511_445_1413 302
330 3300038741 Ga0400488_29404 Ga0400488_29404_110_1057 302
331 3300046462 Ga0495651_0183959 Ga0495651_0183959_77_1042 302
332 3300048904 Ga0496101_0008012 Ga0496101_0008012_5181_6110 302
333 3300048904 Ga0496101_0027240 Ga0496101_0027240_2284_3267 302
334 3300048904 Ga0496101_0050383 Ga0496101_0050383_327_1313 302
335 3300048905 Ga0496102_0019579 Ga0496102_0019579_3919_4905 302
336 3300048905 Ga0496102_0041385 Ga0496102_0041385_1422_2351 302
337 3300048905 Ga0496102_0043014 Ga0496102_0043014_413_1435 302
338 3300048905 Ga0496102_0136802 Ga0496102_0136802_259_1224 302
339 3300048906 Ga0496103_0140629 Ga0496103_0140629_211_1194 302
340 3300048907 Ga0496104_0000896 Ga0496104_0000896_17747_18733 302
341 3300048907 Ga0496104_0003861 Ga0496104_0003861_2375_3328 302
342 3300048907 Ga0496104_0012253 Ga0496104_0012253_2508_3437 302
343 3300048907 Ga0496104_0156641 Ga0496104_0156641_887_1852 302
344 3300048908 Ga0496105_0010634 Ga0496105_0010634_5492_6445 302
345 3300048909 Ga0496106_0018675 Ga0496106_0018675_3814_4797 302
346 3300048909 Ga0496106_0074183 Ga0496106_0074183_1602_2534 302
347 3300048910 Ga0496107_0007804 Ga0496107_0007804_4589_5518 302
348 3300048910 Ga0496107_0014980 Ga0496107_0014980_460_1482 302
349 3300048911 Ga0496108_0001756 Ga0496108_0001756_5602_6555 302
350 3300048911 Ga0496108_0022494 Ga0496108_0022494_3375_4361 302
351 3300048911 Ga0496108_0027953 Ga0496108_0027953_2726_3691 302
352 3300048912 Ga0496109_0007783 Ga0496109_0007783_3719_4672 302
353 3300048912 Ga0496109_0022983 Ga0496109_0022983_525_1454 302
354 3300048913 Ga0496110_0006306 Ga0496110_0006306_3445_4398 302
355 3300048914 Ga0496111_0039983 Ga0496111_0039983_1429_2394 302
356 3300048914 Ga0496111_0047425 Ga0496111_0047425_514_1467 302
357 3300048914 Ga0496111_0085829 Ga0496111_0085829_250_1236 302
358 3300048915 Ga0496112_0004975 Ga0496112_0004975_9579_10544 302
359 3300048916 Ga0496113_0006365 Ga0496113_0006365_3760_4725 302
360 3300048916 Ga0496113_0010550 Ga0496113_0010550_1919_2872 302
361 3300048917 Ga0496114_0021328 Ga0496114_0021328_412_1341 302
362 3300048918 Ga0496115_0004097 Ga0496115_0004097_8514_9500 302
363 3300048918 Ga0496115_0006428 Ga0496115_0006428_4303_5286 302
364 3300048922 Ga0496119_0006190 Ga0496119_0006190_9871_10794 302
365 3300048925 Ga0496122_0004307 Ga0496122_0004307_15483_16406 302
366 3300048926 Ga0496123_0001264 Ga0496123_0001264_100_1023 302
367 3300048927 Ga0496124_0021627 Ga0496124_0021627_4289_5254 302
368 3300049569 Ga0501032_0005003 Ga0501032_0005003_4359_5336 302
369 3300049569 Ga0501032_0148701 Ga0501032_0148701_550_1530 302
370 3300049571 Ga0501034_0000068 Ga0501034_0000068_128776_129753 302
371 3300049571 Ga0501034_0122200 Ga0501034_0122200_42_1022 302
372 3300049572 Ga0501036_0073052 Ga0501036_0073052_583_1560 302
373 3300049573 Ga0501037_0014308 Ga0501037_0014308_3450_4427 302
374 3300049575 Ga0501039_0000138 Ga0501039_0000138_11531_12508 302
375 3300049577 Ga0501041_0138617 Ga0501041_0138617_154_1116 302
376 3300049578 Ga0501042_0113757 Ga0501042_0113757_145_1110 302
377 3300049580 Ga0501046_0000246 Ga0501046_0000246_5351_6322 302
378 3300049580 Ga0501046_0001138 Ga0501046_0001138_20102_21079 302
379 3300049580 Ga0501046_0009035 Ga0501046_0009035_2609_3589 302
380 3300049580 Ga0501046_0099067 Ga0501046_0099067_1248_2222 302
381 3300049581 Ga0501047_0000873 Ga0501047_0000873_20678_21655 302
382 3300049581 Ga0501047_0045210 Ga0501047_0045210_292_1272 302
383 3300049581 Ga0501047_0047475 Ga0501047_0047475_525_1505 302
384 3300049581 Ga0501047_0241804 Ga0501047_0241804_259_1236 302
385 3300049582 Ga0501048_0003772 Ga0501048_0003772_1566_2534 302
386 3300049583 Ga0501067_0000720 Ga0501067_0000720_16001_16978 302
387 3300049583 Ga0501067_0002784 Ga0501067_0002784_4738_5715 302
388 3300049585 Ga0501069_0095720 Ga0501069_0095720_320_1282 302
389 3300049586 Ga0501070_0018079 Ga0501070_0018079_3997_4974 302
390 3300049586 Ga0501070_0128627 Ga0501070_0128627_131_1108 302
391 3300049587 Ga0501071_0135895 Ga0501071_0135895_400_1362 302
392 3300049589 Ga0501073_0035793 Ga0501073_0035793_1707_2684 302
393 3300049589 Ga0501073_0052011 Ga0501073_0052011_1160_2125 302
394 3300049590 Ga0501074_0008973 Ga0501074_0008973_2496_3458 302
395 3300049593 Ga0501077_0072055 Ga0501077_0072055_1097_2062 302
396 3300049593 Ga0501077_0097586 Ga0501077_0097586_173_1135 302
397 3300049742 Ga0501080_0000001 Ga0501080_0000001_227546_228523 302
398 3300049822 Ga0501035_0000015 Ga0501035_0000015_63419_64396 302
399 3300049822 Ga0501035_0223043 Ga0501035_0223043_285_1262 302
400 3300049823 Ga0501044_0000026 Ga0501044_0000026_96823_97800 302
401 3300049823 Ga0501044_0088879 Ga0501044_0088879_2001_2960 302
402 3300049823 Ga0501044_0137160 Ga0501044_0137160_1325_2305 302
403 3300049824 Ga0501045_0057189 Ga0501045_0057189_14_982 302
404 3300049824 Ga0501045_0154905 Ga0501045_0154905_375_1352 302
405 3300050492 nmdc:mga0yw44_82060_c1 nmdc:mga0yw44_82060_c1_769_1722 302
406 3300050494 nmdc:mga06z11_10108_c1 nmdc:mga06z11_10108_c1_1060_2049 302
407 3300050507 nmdc:mga05p37_104104_c1 nmdc:mga05p37_104104_c1_2166_3131 302
408 3300050508 nmdc:mga09592_140460_c1 nmdc:mga09592_140460_c1_430_1386 302
409 3300050509 nmdc:mga0qj67_101136_c1 nmdc:mga0qj67_101136_c1_753_1709 302
410 3300050510 nmdc:mga06r32_122065_c1 nmdc:mga06r32_122065_c1_1157_2113 302
411 3300050510 nmdc:mga06r32_171466_c1 nmdc:mga06r32_171466_c1_823_1779 302
412 3300050510 nmdc:mga06r32_207291_c1 nmdc:mga06r32_207291_c1_97_1065 302
413 3300050511 nmdc:mga08y16_29966_c1 nmdc:mga08y16_29966_c1_4557_5522 302
414 3300050511 nmdc:mga08y16_4688_c1 nmdc:mga08y16_4688_c1_5957_6925 302
415 3300050512 nmdc:mga0n895_4339_c1 nmdc:mga0n895_4339_c1_2204_3172 302
416 3300050513 nmdc:mga0rr50_206727_c1 nmdc:mga0rr50_206727_c1_87_1055 302
417 3300053104 Ga0500556_0000880 Ga0500556_0000880_11900_12865 302
418 3300053104 Ga0500556_0005856 Ga0500556_0005856_1048_1971 302
419 3300053119 Ga0500595_030317 Ga0500595_030317_603_1583 302
420 3300053730 Ga0500645_001299 Ga0500645_001299_11578_12501 302
421 3300053730 Ga0500645_048969 Ga0500645_048969_189_1154 302
422 3300061734 Ga0530510_0013419 Ga0530510_0013419_4328_5296 302
423 3300061734 Ga0530510_0080532 Ga0530510_0080532_55_1017 302
424 3300035695 Ga0373927_0016655 Ga0373927_0016655_1475_2413 304
425 3300053150 Ga0500603_000277 Ga0500603_000277_5002_5970 305
426 3300005327 Ga0070658_10134984 Ga0070658_101349842 306
427 3300005328 Ga0070676_10001181 Ga0070676_100011819 306
428 3300005329 Ga0070683_100067788 Ga0070683_1000677882 306
429 3300005330 Ga0070690_100000545 Ga0070690_1000005455 306
430 3300005331 Ga0070670_100005981 Ga0070670_1000059818 306
431 3300005334 Ga0068869_100091465 Ga0068869_1000914651 306
432 3300005335 Ga0070666_10004683 Ga0070666_100046836 306
433 3300005337 Ga0070682_100010119 Ga0070682_1000101194 306
434 3300005338 Ga0068868_100072838 Ga0068868_1000728382 306
435 3300005339 Ga0070660_100004348 Ga0070660_1000043485 306
436 3300005340 Ga0070689_100001025 Ga0070689_1000010257 306
437 3300005341 Ga0070691_10000109 Ga0070691_1000010914 306
438 3300005343 Ga0070687_100001058 Ga0070687_1000010585 306
439 3300005344 Ga0070661_100010613 Ga0070661_1000106135 306
440 3300005347 Ga0070668_100000323 Ga0070668_1000003238 306
441 3300005353 Ga0070669_100015233 Ga0070669_1000152332 306
442 3300005354 Ga0070675_100001821 Ga0070675_1000018219 306
443 3300005355 Ga0070671_100001054 Ga0070671_10000105418 306
444 3300005356 Ga0070674_100000932 Ga0070674_1000009322 306
445 3300005364 Ga0070673_100001383 Ga0070673_1000013835 306
446 3300005365 Ga0070688_100000138 Ga0070688_10000013819 306
447 3300005366 Ga0070659_100000915 Ga0070659_1000009158 306
448 3300005367 Ga0070667_100002638 Ga0070667_1000026385 306
449 3300005367 Ga0070667_100312877 Ga0070667_1003128771 306
450 3300005406 Ga0070703_10015964 Ga0070703_100159642 306
451 3300005434 Ga0070709_10000884 Ga0070709_100008844 306
452 3300005435 Ga0070714_100110855 Ga0070714_1001108552 306
453 3300005438 Ga0070701_10001670 Ga0070701_100016705 306
454 3300005441 Ga0070700_100000877 Ga0070700_1000008774 306
455 3300005441 Ga0070700_100161296 Ga0070700_1001612962 306
456 3300005444 Ga0070694_100000159 Ga0070694_10000015914 306
457 3300005455 Ga0070663_100001241 Ga0070663_1000012415 306
458 3300005456 Ga0070678_100001723 Ga0070678_1000017239 306
459 3300005456 Ga0070678_100237942 Ga0070678_1002379422 306
460 3300005457 Ga0070662_100002638 Ga0070662_1000026384 306
461 3300005457 Ga0070662_100293407 Ga0070662_1002934072 306
462 3300005458 Ga0070681_10015319 Ga0070681_100153193 306
463 3300005459 Ga0068867_100090121 Ga0068867_1000901212 306
464 3300005466 Ga0070685_10002967 Ga0070685_100029673 306
465 3300005518 Ga0070699_100455596 Ga0070699_1004555962 306
466 3300005530 Ga0070679_100047103 Ga0070679_1000471031 306
467 3300005535 Ga0070684_100011323 Ga0070684_1000113234 306
468 3300005536 Ga0070697_100017448 Ga0070697_1000174483 306
469 3300005539 Ga0068853_100000477 Ga0068853_10000047713 306
470 3300005543 Ga0070672_100003489 Ga0070672_1000034898 306
471 3300005544 Ga0070686_100005159 Ga0070686_1000051592 306
472 3300005545 Ga0070695_100001605 Ga0070695_1000016054 306
473 3300005546 Ga0070696_100001417 Ga0070696_1000014179 306
474 3300005547 Ga0070693_100000188 Ga0070693_10000018811 306
475 3300005548 Ga0070665_100006048 Ga0070665_1000060487 306
476 3300005549 Ga0070704_100000534 Ga0070704_1000005346 306
477 3300005563 Ga0068855_100002324 Ga0068855_10000232423 306
478 3300005564 Ga0070664_100030975 Ga0070664_1000309754 306
479 3300005578 Ga0068854_100060234 Ga0068854_1000602342 306
480 3300005614 Ga0068856_100001302 Ga0068856_10000130212 306
481 3300005615 Ga0070702_100000205 Ga0070702_10000020515 306
482 3300005617 Ga0068859_100002806 Ga0068859_10000280612 306
483 3300005618 Ga0068864_100004194 Ga0068864_1000041945 306
484 3300005718 Ga0068866_10030357 Ga0068866_100303572 306
485 3300005719 Ga0068861_100000196 Ga0068861_10000019616 306
486 3300005841 Ga0068863_100022888 Ga0068863_1000228884 306
487 3300005842 Ga0068858_100001779 Ga0068858_10000177916 306
488 3300005842 Ga0068858_100024420 Ga0068858_1000244202 306
489 3300005843 Ga0068860_100000872 Ga0068860_1000008728 306
490 3300005844 Ga0068862_100002619 Ga0068862_1000026192 306
491 3300005937 Ga0081455_10002009 Ga0081455_100020099 306
492 3300006038 Ga0075365_10022286 Ga0075365_100222862 306
493 3300006048 Ga0075363_100061813 Ga0075363_1000618132 306
494 3300006051 Ga0075364_10001857 Ga0075364_1000185711 306
495 3300006163 Ga0070715_10000410 Ga0070715_100004105 306
496 3300006173 Ga0070716_100002026 Ga0070716_1000020266 306
497 3300006175 Ga0070712_100010253 Ga0070712_1000102533 306
498 3300006178 Ga0075367_10007598 Ga0075367_100075985 306
499 3300006237 Ga0097621_100021184 Ga0097621_1000211844 306
500 3300006358 Ga0068871_100065695 Ga0068871_1000656953 306
501 3300006358 Ga0068871_100093790 Ga0068871_1000937902 306
502 3300006844 Ga0075428_100006002 Ga0075428_1000060024 306
503 3300006844 Ga0075428_100235198 Ga0075428_1002351982 306
504 3300006847 Ga0075431_100098618 Ga0075431_1000986183 306
505 3300006880 Ga0075429_100013543 Ga0075429_1000135432 306
506 3300006881 Ga0068865_100001326 Ga0068865_1000013267 306
507 3300006914 Ga0075436_100037850 Ga0075436_1000378502 306
508 3300006931 Ga0097620_100002806 Ga0097620_10000280612 306
509 3300007076 Ga0075435_100045719 Ga0075435_1000457193 306
510 3300009036 Ga0105244_10032109 Ga0105244_100321093 306
511 3300009092 Ga0105250_10005666 Ga0105250_100056662 306
512 3300009093 Ga0105240_10020968 Ga0105240_100209682 306
513 3300009098 Ga0105245_10001489 Ga0105245_1000148914 306
514 3300009101 Ga0105247_10002044 Ga0105247_100020448 306
515 3300009101 Ga0105247_10084000 Ga0105247_100840002 306
516 3300009147 Ga0114129_10115511 Ga0114129_101155113 306
517 3300009147 Ga0114129_10342191 Ga0114129_103421912 306
518 3300009148 Ga0105243_10002388 Ga0105243_1000238811 306
519 3300009148 Ga0105243_10058138 Ga0105243_100581383 306
520 3300009174 Ga0105241_10006466 Ga0105241_100064662 306
521 3300009177 Ga0105248_10001500 Ga0105248_1000150018 306
522 3300009177 Ga0105248_10036884 Ga0105248_100368844 306
523 3300009545 Ga0105237_10002959 Ga0105237_1000295914 306
524 3300009553 Ga0105249_10000775 Ga0105249_100007754 306
525 3300009553 Ga0105249_10005964 Ga0105249_100059648 306
526 3300010375 Ga0105239_10056224 Ga0105239_100562242 306
527 3300011119 Ga0105246_10001892 Ga0105246_100018925 306
528 3300013102 Ga0157371_10006736 Ga0157371_100067367 306
529 3300013105 Ga0157369_10006271 Ga0157369_100062713 306
530 3300013297 Ga0157378_10002206 Ga0157378_1000220614 306
531 3300013297 Ga0157378_10069630 Ga0157378_100696301 306
532 3300013306 Ga0163162_10002752 Ga0163162_100027521 306
533 3300013308 Ga0157375_10003722 Ga0157375_100037228 306
534 3300013308 Ga0157375_10004209 Ga0157375_100042095 306
535 3300013308 Ga0157375_10308030 Ga0157375_103080302 306
536 3300014326 Ga0157380_10141486 Ga0157380_101414862 306
537 3300014326 Ga0157380_10476500 Ga0157380_104765001 306
538 3300014968 Ga0157379_10092823 Ga0157379_100928233 306
539 3300014969 Ga0157376_10000823 Ga0157376_1000082318 306
540 3300014969 Ga0157376_10011387 Ga0157376_100113875 306
541 3300025899 Ga0207642_10002770 Ga0207642_100027702 306
542 3300025900 Ga0207710_10001172 Ga0207710_100011725 306
543 3300025900 Ga0207710_10062342 Ga0207710_100623422 306
544 3300025901 Ga0207688_10005595 Ga0207688_100055955 306
545 3300025903 Ga0207680_10004778 Ga0207680_100047782 306
546 3300025905 Ga0207685_10000332 Ga0207685_100003324 306
547 3300025906 Ga0207699_10001135 Ga0207699_100011359 306
548 3300025907 Ga0207645_10005698 Ga0207645_100056983 306
549 3300025909 Ga0207705_10279722 Ga0207705_102797222 306
550 3300025911 Ga0207654_10032096 Ga0207654_100320962 306
551 3300025912 Ga0207707_10020800 Ga0207707_100208003 306
552 3300025913 Ga0207695_10060681 Ga0207695_100606813 306
553 3300025914 Ga0207671_10015825 Ga0207671_100158253 306
554 3300025915 Ga0207693_10000313 Ga0207693_1000031311 306
555 3300025915 Ga0207693_10031514 Ga0207693_100315142 306
556 3300025915 Ga0207693_10099806 Ga0207693_100998062 306
557 3300025918 Ga0207662_10013266 Ga0207662_100132664 306
558 3300025919 Ga0207657_10000112 Ga0207657_1000011218 306
559 3300025926 Ga0207659_10010412 Ga0207659_100104124 306
560 3300025927 Ga0207687_10004391 Ga0207687_100043915 306
561 3300025929 Ga0207664_10106423 Ga0207664_101064232 306
562 3300025932 Ga0207690_10002166 Ga0207690_100021669 306
563 3300025933 Ga0207706_10000831 Ga0207706_100008319 306
564 3300025934 Ga0207686_10004856 Ga0207686_100048565 306
565 3300025938 Ga0207704_10008196 Ga0207704_100081962 306
566 3300025939 Ga0207665_10000565 Ga0207665_1000056515 306
567 3300025940 Ga0207691_10000623 Ga0207691_1000062319 306
568 3300025941 Ga0207711_10007904 Ga0207711_100079042 306
569 3300025944 Ga0207661_10087609 Ga0207661_100876092 306
570 3300025945 Ga0207679_10009793 Ga0207679_100097934 306
571 3300025949 Ga0207667_10083775 Ga0207667_100837753 306
572 3300025960 Ga0207651_10018895 Ga0207651_100188953 306
573 3300025981 Ga0207640_10004101 Ga0207640_100041013 306
574 3300025986 Ga0207658_10039058 Ga0207658_100390583 306
575 3300026023 Ga0207677_10072886 Ga0207677_100728862 306
576 3300026035 Ga0207703_10015420 Ga0207703_100154202 306
577 3300026067 Ga0207678_10000086 Ga0207678_1000008613 306
578 3300026075 Ga0207708_10000858 Ga0207708_1000085818 306
579 3300026088 Ga0207641_10043891 Ga0207641_100438912 306
580 3300026089 Ga0207648_10065450 Ga0207648_100654502 306
581 3300026095 Ga0207676_10034688 Ga0207676_100346882 306
582 3300026116 Ga0207674_10003298 Ga0207674_1000329818 306
583 3300026118 Ga0207675_100000111 Ga0207675_10000011142 306
584 3300026121 Ga0207683_10000120 Ga0207683_1000012035 306
585 3300026142 Ga0207698_10007677 Ga0207698_100076772 306
586 3300027717 Ga0209998_10014548 Ga0209998_100145482 306
587 3300027876 Ga0209974_10044999 Ga0209974_100449992 306
588 3300027907 Ga0207428_10042572 Ga0207428_100425722 306
589 3300028379 Ga0268266_10033432 Ga0268266_100334324 306
590 3300028381 Ga0268264_10050991 Ga0268264_100509913 306
591 3300028381 Ga0268264_10051331 Ga0268264_100513311 306
592 3300031665 Ga0316575_10069424 Ga0316575_100694241 306
593 3300031691 Ga0316579_10017334 Ga0316579_100173342 306
594 3300031728 Ga0316578_10072659 Ga0316578_100726592 306
595 3300031733 Ga0316577_10005671 Ga0316577_100056714 306
596 3300032133 Ga0316583_10002017 Ga0316583_100020174 306
597 3300032137 Ga0316585_10000782 Ga0316585_100007822 306
598 3300032139 Ga0316580_10063379 Ga0316580_100633792 306
599 3300034820 Ga0373959_0007799 Ga0373959_0007799_353_1273 306
600 3300035091 Ga0373951_0003799 Ga0373951_0003799_1903_2823 306
601 3300035112 Ga0373932_0026249 Ga0373932_0026249_55_975 306
602 3300035114 Ga0373939_0000816 Ga0373939_0000816_108_1028 306
603 3300035171 Ga0373946_0001327 Ga0373946_0001327_7065_7985 306
604 3300035242 Ga0373962_0022926 Ga0373962_0022926_99_1019 306
605 3300035398 Ga0316574_0016545 Ga0316574_0016545_3107_4027 306
606 3300035691 Ga0373931_0010450 Ga0373931_0010450_1208_2128 306
607 3300035692 Ga0373935_0096150 Ga0373935_0096150_79_999 306
608 3300035725 Ga0373947_0003875 Ga0373947_0003875_3093_4013 306
609 3300036712 Ga0316584_0035110 Ga0316584_0035110_168_1088 306
610 3300037068 Ga0373925_0004411 Ga0373925_0004411_8378_9298 306
611 3300037418 Ga0395900_0038434 Ga0395900_0038434_3294_4214 306
612 3300037466 Ga0395898_0027692 Ga0395898_0027692_1582_2502 306
613 3300037471 Ga0395905_0002147 Ga0395905_0002147_5385_6305 306
614 3300037588 Ga0316581_0000762 Ga0316581_0000762_206_1126 306
615 3300046455 Ga0495603_0000690 Ga0495603_0000690_8024_8944 306
616 3300046461 Ga0495641_0019556 Ga0495641_0019556_989_1909 306
617 3300046472 Ga0495580_0036111 Ga0495580_0036111_861_1781 306
618 3300046473 Ga0495582_0002379 Ga0495582_0002379_1678_2598 306
619 3300046475 Ga0495639_0009977 Ga0495639_0009977_1786_2706 306
620 3300046476 Ga0495662_0173474 Ga0495662_0173474_76_996 306
621 3300046499 Ga0495594_0004267 Ga0495594_0004267_1737_2657 306
622 3300046526 Ga0495666_0005612 Ga0495666_0005612_4191_5111 306
623 3300046557 Ga0495622_0005361 Ga0495622_0005361_1773_2693 306
624 3300046642 Ga0495634_0027901 Ga0495634_0027901_1785_2705 306
625 3300046663 Ga0495635_0035103 Ga0495635_0035103_1314_2234 306
626 3300046674 Ga0495588_0000969 Ga0495588_0000969_7696_8616 306
627 3300046681 Ga0495647_0006037 Ga0495647_0006037_1380_2300 306
628 3300046683 Ga0495658_0000894 Ga0495658_0000894_9552_10472 306
629 3300046690 Ga0495624_0029524 Ga0495624_0029524_719_1639 306
630 3300047315 Ga0495581_0009037 Ga0495581_0009037_3923_4843 306
631 3300047321 Ga0495676_0006581 Ga0495676_0006581_9647_10567 306
632 3300047673 Ga0495593_0003109 Ga0495593_0003109_2540_3460 306
633 3300048903 Ga0496100_0014301 Ga0496100_0014301_3432_4352 306
634 3300048903 Ga0496100_0036866 Ga0496100_0036866_1347_2267 306
635 3300048903 Ga0496100_0077437 Ga0496100_0077437_480_1496 306
636 3300048903 Ga0496100_0334359 Ga0496100_0334359_140_1060 306
637 3300048904 Ga0496101_0004744 Ga0496101_0004744_6222_7142 306
638 3300048904 Ga0496101_0016183 Ga0496101_0016183_3422_4342 306
639 3300048905 Ga0496102_0041393 Ga0496102_0041393_992_1912 306
640 3300048905 Ga0496102_0097661 Ga0496102_0097661_821_1741 306
641 3300048905 Ga0496102_0160435 Ga0496102_0160435_808_1728 306
642 3300048906 Ga0496103_0021847 Ga0496103_0021847_11_931 306
643 3300048907 Ga0496104_0047777 Ga0496104_0047777_256_1176 306
644 3300048907 Ga0496104_0067013 Ga0496104_0067013_1669_2589 306
645 3300048907 Ga0496104_0110524 Ga0496104_0110524_905_1921 306
646 3300048907 Ga0496104_0473218 Ga0496104_0473218_149_1069 306
647 3300048908 Ga0496105_0003076 Ga0496105_0003076_6782_7702 306
648 3300048908 Ga0496105_0060224 Ga0496105_0060224_1877_2797 306
649 3300048908 Ga0496105_0267914 Ga0496105_0267914_394_1314 306
650 3300048909 Ga0496106_0003602 Ga0496106_0003602_5350_6270 306
651 3300048909 Ga0496106_0056783 Ga0496106_0056783_693_1613 306
652 3300048910 Ga0496107_0000864 Ga0496107_0000864_11624_12544 306
653 3300048910 Ga0496107_0002347 Ga0496107_0002347_7315_8331 306
654 3300048910 Ga0496107_0042076 Ga0496107_0042076_693_1613 306
655 3300048911 Ga0496108_0052743 Ga0496108_0052743_1669_2589 306
656 3300048911 Ga0496108_0080436 Ga0496108_0080436_455_1375 306
657 3300048912 Ga0496109_0089084 Ga0496109_0089084_1112_2032 306
658 3300048912 Ga0496109_0104497 Ga0496109_0104497_949_1869 306
659 3300048915 Ga0496112_0033821 Ga0496112_0033821_2817_3737 306
660 3300048917 Ga0496114_0006801 Ga0496114_0006801_1576_2496 306
661 3300048918 Ga0496115_0008945 Ga0496115_0008945_5031_5951 306
662 3300048918 Ga0496115_0080950 Ga0496115_0080950_693_1613 306
663 3300049572 Ga0501036_0215419 Ga0501036_0215419_374_1294 306
664 3300049574 Ga0501038_0121078 Ga0501038_0121078_349_1269 306
665 3300049575 Ga0501039_0071747 Ga0501039_0071747_1460_2380 306
666 3300049576 Ga0501040_0018623 Ga0501040_0018623_358_1278 306
667 3300049576 Ga0501040_0245199 Ga0501040_0245199_204_1124 306
668 3300049578 Ga0501042_0054738 Ga0501042_0054738_1173_2093 306
669 3300049580 Ga0501046_0033104 Ga0501046_0033104_2359_3279 306
670 3300049582 Ga0501048_0025718 Ga0501048_0025718_3116_4036 306
671 3300049582 Ga0501048_0096937 Ga0501048_0096937_894_1814 306
672 3300049582 Ga0501048_0111950 Ga0501048_0111950_490_1518 306
673 3300049584 Ga0501068_0093350 Ga0501068_0093350_22_942 306
674 3300049585 Ga0501069_0120888 Ga0501069_0120888_501_1421 306
675 3300049588 Ga0501072_0047056 Ga0501072_0047056_1083_2030 306
676 3300049588 Ga0501072_0078433 Ga0501072_0078433_857_1777 306
677 3300049588 Ga0501072_0082658 Ga0501072_0082658_1391_2311 306
678 3300049588 Ga0501072_0149359 Ga0501072_0149359_82_1002 306
679 3300049590 Ga0501074_0090284 Ga0501074_0090284_481_1401 306
680 3300049590 Ga0501074_0179244 Ga0501074_0179244_75_995 306
681 3300049591 Ga0501075_0023749 Ga0501075_0023749_1349_2269 306
682 3300049592 Ga0501076_0017141 Ga0501076_0017141_2119_3039 306
683 3300049592 Ga0501076_0201687 Ga0501076_0201687_255_1175 306
684 3300049593 Ga0501077_0013027 Ga0501077_0013027_373_1293 306
685 3300049593 Ga0501077_0018697 Ga0501077_0018697_1847_2767 306
686 3300049593 Ga0501077_0024533 Ga0501077_0024533_895_1827 306
687 3300049593 Ga0501077_0102564 Ga0501077_0102564_157_1089 306
688 3300049741 Ga0501079_0496256 Ga0501079_0496256_28_948 306
689 3300049742 Ga0501080_0218400 Ga0501080_0218400_565_1485 306
690 3300049742 Ga0501080_0277943 Ga0501080_0277943_202_1122 306
691 3300049743 Ga0501081_0064699 Ga0501081_0064699_1215_2135 306
692 3300049743 Ga0501081_0077345 Ga0501081_0077345_388_1320 306
693 3300049744 Ga0501083_0093525 Ga0501083_0093525_127_1047 306
694 3300049822 Ga0501035_0123163 Ga0501035_0123163_318_1238 306
695 3300049824 Ga0501045_0215720 Ga0501045_0215720_19_939 306
696 3300050490 nmdc:mga03n38_4892_c1 nmdc:mga03n38_4892_c1_200_1306 306
697 3300050492 nmdc:mga0yw44_6754_c1 nmdc:mga0yw44_6754_c1_3115_4236 306
698 3300050494 nmdc:mga06z11_2473_c1 nmdc:mga06z11_2473_c1_5434_6540 306
699 3300050494 nmdc:mga06z11_5316_c1 nmdc:mga06z11_5316_c1_1718_2839 306
700 3300050508 nmdc:mga09592_86312_c1 nmdc:mga09592_86312_c1_1151_2071 306
701 3300050509 nmdc:mga0qj67_5024_c1 nmdc:mga0qj67_5024_c1_5781_6785 306
702 3300050510 nmdc:mga06r32_158391_c1 nmdc:mga06r32_158391_c1_1010_1930 306
703 3300050510 nmdc:mga06r32_171925_c1 nmdc:mga06r32_171925_c1_643_1563 306
704 3300050510 nmdc:mga06r32_194225_c1 nmdc:mga06r32_194225_c1_594_1598 306
705 3300050514 nmdc:mga08x19_122731_c1 nmdc:mga08x19_122731_c1_580_1500 306
706 3300050515 nmdc:mga0a205_15593_c1 nmdc:mga0a205_15593_c1_1925_2845 306
707 3300050515 nmdc:mga0a205_172290_c1 nmdc:mga0a205_172290_c1_895_1842 306
708 3300053077 Ga0495601_0003880 Ga0495601_0003880_1794_2747 306
709 3300053085 Ga0495619_0000737 Ga0495619_0000737_9393_10313 306
710 3300054114 Ga0501084_0048092 Ga0501084_0048092_555_1475 306
711 3300054114 Ga0501084_0138192 Ga0501084_0138192_846_1766 306
712 3300054114 Ga0501084_0182300 Ga0501084_0182300_400_1347 306
713 3300060353 Ga0501082_0011098 Ga0501082_0011098_838_1770 306
714 3300060353 Ga0501082_0069173 Ga0501082_0069173_1657_2577 306
715 3300060353 Ga0501082_0106698 Ga0501082_0106698_266_1186 306
716 3300060353 Ga0501082_0180095 Ga0501082_0180095_833_1753 306
717 3300061734 Ga0530510_0007129 Ga0530510_0007129_2673_3641 306
718 3300061734 Ga0530510_0039774 Ga0530510_0039774_1246_2193 306
719 3300061734 Ga0530510_0072416 Ga0530510_0072416_190_1110 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

205

304

0.98

PF01565

FAD_binding_4

FAD binding domain

39

172

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.935 4 306
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9309 10 306
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.9291 4 306
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9272 8 304
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9249 10 306
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9838 227 306 3.90.78.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9409 93 219 3.30.465.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9268 93 219 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9261 93 219 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.919 93 219 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A3B9YWJ8-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9938 227 304 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A442AS35-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate dehydrogenase) 0.9937 103 202 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A3N5RV35-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9846 227 304 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A845ZPU9-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein 0.9784 227 300 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
AF-A0A0M9GQ79-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9711 2 306 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map