F477250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 350 | 705 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300033180|Ga0307510_10176364|Ga0307510_101763642 |
| Length | 317 |
| Sequence | MSFPDLTTELRAALPDLRGRLDANQPMRDITWFRVGGPAQVLFTPADETDLAYVLKTIGADLPVTVVGVGSNLLVRDGGIPGLVVRLGGRGFGGFAVTEGGERMAVGAAMPDMRAAQSAAKAGLAGLAFYRGIPGTIGGALRMNAGAHGTETKDIFVSARAVDGHGIIHVLTHADMHFTYRHCGLPEDFIFTEATFQGTPGDPAEIERQMDEVTAYREANQPTKSRTGGSTFKNPPGHSAWKLVDAAGCRGFRVGGAHVSEMHANFLINDGEASAEDIERLGETVRARVQAAAGVTLEWEIKRIGVTGAGQGAVVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 2 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 3 | 2791355199 | |||
| 4 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 5 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 6 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 7 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 8 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 9 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 10 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 11 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 204 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 230 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 348 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 349 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 350 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0 |
| Isolates | 1.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.89 |
| Nodule | 0.56 |
| Rhizoplane | 9.74 |
| Rhizosphere | 83.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10134984 | 3300005327 | Bacteria | 2058 |
| 2 | Ga0070676_10001181 | 3300005328 | Bacteria | 13083 |
| 3 | Ga0070683_100067788 | 3300005329 | Bacteria | 3324 |
| 4 | Ga0070690_100000545 | 3300005330 | Bacteria | 18860 |
| 5 | Ga0070690_100240637 | 3300005330 | Bacteria | 1276 |
| 6 | Ga0070670_100005981 | 3300005331 | Bacteria | 10296 |
| 7 | Ga0068869_100055145 | 3300005334 | Bacteria | 2896 |
| 8 | Ga0068869_100091465 | 3300005334 | Bacteria | 2289 |
| 9 | Ga0070666_10004683 | 3300005335 | Bacteria | 8357 |
| 10 | Ga0070680_100003071 | 3300005336 | Bacteria | 12390 |
| 11 | Ga0070680_100063518 | 3300005336 | Bacteria | 3024 |
| 12 | Ga0070680_100141690 | 3300005336 | Bacteria | 2016 |
| 13 | Ga0070682_100005762 | 3300005337 | Bacteria | 6911 |
| 14 | Ga0070682_100010119 | 3300005337 | Bacteria | 5347 |
| 15 | Ga0068868_100072838 | 3300005338 | Bacteria | 2741 |
| 16 | Ga0070660_100002003 | 3300005339 | Bacteria | 14053 |
| 17 | Ga0070660_100004348 | 3300005339 | Bacteria | 9786 |
| 18 | Ga0070689_100001025 | 3300005340 | Bacteria | 17546 |
| 19 | Ga0070691_10000109 | 3300005341 | Bacteria | 24574 |
| 20 | Ga0070691_10043067 | 3300005341 | Bacteria | 2138 |
| 21 | Ga0070687_100001058 | 3300005343 | Bacteria | 9417 |
| 22 | Ga0070661_100010613 | 3300005344 | Bacteria | 6408 |
| 23 | Ga0070661_100092817 | 3300005344 | Bacteria | 2237 |
| 24 | Ga0070692_10118036 | 3300005345 | Bacteria | 1476 |
| 25 | Ga0070668_100000323 | 3300005347 | Bacteria | 31536 |
| 26 | Ga0070669_100015233 | 3300005353 | Bacteria | 5477 |
| 27 | Ga0070669_100037889 | 3300005353 | Bacteria | 3498 |
| 28 | Ga0070675_100001821 | 3300005354 | Bacteria | 15775 |
| 29 | Ga0070675_100457065 | 3300005354 | Bacteria | 1146 |
| 30 | Ga0070671_100001054 | 3300005355 | Bacteria | 20321 |
| 31 | Ga0070674_100000932 | 3300005356 | Bacteria | 15259 |
| 32 | Ga0070673_100001383 | 3300005364 | Bacteria | 14186 |
| 33 | Ga0070688_100000138 | 3300005365 | Bacteria | 39542 |
| 34 | Ga0070659_100000915 | 3300005366 | Bacteria | 21598 |
| 35 | Ga0070659_100174085 | 3300005366 | Bacteria | 1764 |
| 36 | Ga0070667_100002638 | 3300005367 | Bacteria | 15527 |
| 37 | Ga0070667_100312877 | 3300005367 | Bacteria | 1416 |
| 38 | Ga0070703_10000738 | 3300005406 | Bacteria | 10919 |
| 39 | Ga0070703_10015964 | 3300005406 | Bacteria | 2152 |
| 40 | Ga0070709_10000884 | 3300005434 | Bacteria | 16793 |
| 41 | Ga0070714_100110855 | 3300005435 | Bacteria | 2430 |
| 42 | Ga0070714_100291835 | 3300005435 | Bacteria | 1518 |
| 43 | Ga0070713_100040503 | 3300005436 | Bacteria | 3787 |
| 44 | Ga0070701_10001670 | 3300005438 | Bacteria | 8318 |
| 45 | Ga0070701_10003932 | 3300005438 | Bacteria | 5942 |
| 46 | Ga0070701_10129740 | 3300005438 | Bacteria | 1431 |
| 47 | Ga0070711_100084248 | 3300005439 | Bacteria | 2274 |
| 48 | Ga0070705_100001479 | 3300005440 | Bacteria | 12426 |
| 49 | Ga0070705_100050475 | 3300005440 | Bacteria | 2420 |
| 50 | Ga0070700_100000877 | 3300005441 | Bacteria | 14822 |
| 51 | Ga0070700_100012951 | 3300005441 | Bacteria | 4675 |
| 52 | Ga0070700_100161296 | 3300005441 | Bacteria | 1544 |
| 53 | Ga0070694_100000159 | 3300005444 | Bacteria | 34656 |
| 54 | Ga0070694_100126384 | 3300005444 | Bacteria | 1841 |
| 55 | Ga0070708_100041592 | 3300005445 | Bacteria | 4030 |
| 56 | Ga0070708_100061419 | 3300005445 | Bacteria | 3357 |
| 57 | Ga0070663_100001241 | 3300005455 | Bacteria | 14017 |
| 58 | Ga0070663_100003445 | 3300005455 | Bacteria | 9119 |
| 59 | Ga0070663_100031501 | 3300005455 | Bacteria | 3644 |
| 60 | Ga0070663_100090695 | 3300005455 | Bacteria | 2264 |
| 61 | Ga0070678_100001723 | 3300005456 | Bacteria | 11744 |
| 62 | Ga0070678_100044929 | 3300005456 | Bacteria | 3157 |
| 63 | Ga0070678_100237942 | 3300005456 | Bacteria | 1521 |
| 64 | Ga0070662_100002638 | 3300005457 | Bacteria | 11058 |
| 65 | Ga0070662_100293407 | 3300005457 | Bacteria | 1319 |
| 66 | Ga0070681_10000939 | 3300005458 | Bacteria | 24555 |
| 67 | Ga0070681_10014733 | 3300005458 | Bacteria | 7774 |
| 68 | Ga0070681_10015319 | 3300005458 | Bacteria | 7628 |
| 69 | Ga0068867_100036668 | 3300005459 | Bacteria | 3561 |
| 70 | Ga0068867_100090121 | 3300005459 | Bacteria | 2326 |
| 71 | Ga0068867_100156317 | 3300005459 | Bacteria | 1795 |
| 72 | Ga0070685_10002967 | 3300005466 | Bacteria | 8661 |
| 73 | Ga0070707_100034678 | 3300005468 | Bacteria | 4815 |
| 74 | Ga0070707_100166870 | 3300005468 | Bacteria | 2146 |
| 75 | Ga0070699_100001258 | 3300005518 | Bacteria | 23358 |
| 76 | Ga0070699_100455596 | 3300005518 | Bacteria | 1160 |
| 77 | Ga0070679_100047103 | 3300005530 | Bacteria | 4299 |
| 78 | Ga0070684_100011323 | 3300005535 | Bacteria | 7102 |
| 79 | Ga0070684_100014119 | 3300005535 | Bacteria | 6458 |
| 80 | Ga0070697_100017448 | 3300005536 | Bacteria | 5648 |
| 81 | Ga0068853_100000477 | 3300005539 | Bacteria | 27292 |
| 82 | Ga0068853_100008362 | 3300005539 | Bacteria | 8309 |
| 83 | Ga0070672_100003489 | 3300005543 | Bacteria | 10191 |
| 84 | Ga0070686_100005159 | 3300005544 | Bacteria | 7208 |
| 85 | Ga0070686_100040502 | 3300005544 | Bacteria | 2907 |
| 86 | Ga0070695_100001605 | 3300005545 | Bacteria | 12655 |
| 87 | Ga0070696_100000199 | 3300005546 | Bacteria | 35525 |
| 88 | Ga0070696_100001417 | 3300005546 | Bacteria | 15660 |
| 89 | Ga0070696_100044315 | 3300005546 | Bacteria | 3080 |
| 90 | Ga0070693_100000188 | 3300005547 | Bacteria | 28560 |
| 91 | Ga0070693_100002723 | 3300005547 | Bacteria | 8130 |
| 92 | Ga0070665_100006048 | 3300005548 | Bacteria | 12368 |
| 93 | Ga0070665_100021991 | 3300005548 | Bacteria | 6415 |
| 94 | Ga0070704_100000534 | 3300005549 | Bacteria | 18226 |
| 95 | Ga0070704_100001140 | 3300005549 | Bacteria | 13866 |
| 96 | Ga0070704_100081177 | 3300005549 | Bacteria | 2388 |
| 97 | Ga0070704_100308289 | 3300005549 | Bacteria | 1322 |
| 98 | Ga0068855_100002324 | 3300005563 | Bacteria | 23491 |
| 99 | Ga0068855_100030914 | 3300005563 | Bacteria | 6399 |
| 100 | Ga0068855_100042928 | 3300005563 | Bacteria | 5358 |
| 101 | Ga0070664_100030975 | 3300005564 | Bacteria | 4466 |
| 102 | Ga0068857_100010845 | 3300005577 | Bacteria | 7933 |
| 103 | Ga0068857_100021812 | 3300005577 | Bacteria | 5637 |
| 104 | Ga0068857_100085275 | 3300005577 | Bacteria | 2823 |
| 105 | Ga0068854_100060234 | 3300005578 | Bacteria | 2745 |
| 106 | Ga0068856_100001302 | 3300005614 | Bacteria | 26252 |
| 107 | Ga0070702_100000205 | 3300005615 | Bacteria | 19426 |
| 108 | Ga0068852_100161808 | 3300005616 | Bacteria | 2090 |
| 109 | Ga0068859_100002806 | 3300005617 | Bacteria | 17654 |
| 110 | Ga0068859_100195348 | 3300005617 | Bacteria | 2108 |
| 111 | Ga0068859_100768927 | 3300005617 | Bacteria | 1052 |
| 112 | Ga0068864_100004194 | 3300005618 | Bacteria | 11850 |
| 113 | Ga0068864_100013353 | 3300005618 | Bacteria | 6805 |
| 114 | Ga0068864_100326283 | 3300005618 | Bacteria | 1443 |
| 115 | Ga0068866_10011117 | 3300005718 | Bacteria | 3882 |
| 116 | Ga0068866_10030357 | 3300005718 | Bacteria | 2594 |
| 117 | Ga0068866_10057930 | 3300005718 | Bacteria | 1998 |
| 118 | Ga0068861_100000196 | 3300005719 | Bacteria | 32472 |
| 119 | Ga0068861_100221076 | 3300005719 | Bacteria | 1601 |
| 120 | Ga0068870_10064936 | 3300005840 | Bacteria | 1973 |
| 121 | Ga0068863_100022888 | 3300005841 | Bacteria | 5971 |
| 122 | Ga0068863_100139933 | 3300005841 | Bacteria | 2313 |
| 123 | Ga0068863_100386187 | 3300005841 | Bacteria | 1368 |
| 124 | Ga0068858_100001779 | 3300005842 | Bacteria | 21986 |
| 125 | Ga0068858_100024420 | 3300005842 | Bacteria | 5632 |
| 126 | Ga0068858_100118767 | 3300005842 | Bacteria | 2472 |
| 127 | Ga0068858_100209204 | 3300005842 | Bacteria | 1846 |
| 128 | Ga0068860_100000872 | 3300005843 | Bacteria | 33488 |
| 129 | Ga0068860_100012706 | 3300005843 | Bacteria | 8284 |
| 130 | Ga0068860_100313817 | 3300005843 | Bacteria | 1538 |
| 131 | Ga0068862_100002619 | 3300005844 | Bacteria | 15837 |
| 132 | Ga0068862_100004157 | 3300005844 | Bacteria | 12265 |
| 133 | Ga0068862_100214141 | 3300005844 | Bacteria | 1741 |
| 134 | Ga0081455_10002009 | 3300005937 | Bacteria | 24312 |
| 135 | Ga0081455_10006756 | 3300005937 | Bacteria | 12243 |
| 136 | Ga0081538_10114849 | 3300005981 | Bacteria | 1310 |
| 137 | Ga0081540_1008498 | 3300005983 | Bacteria | 7165 |
| 138 | Ga0081539_10043185 | 3300005985 | Bacteria | 2616 |
| 139 | Ga0075365_10022286 | 3300006038 | Bacteria | 3967 |
| 140 | Ga0075365_10167966 | 3300006038 | Bacteria | 1531 |
| 141 | Ga0075368_10002354 | 3300006042 | Bacteria | 6145 |
| 142 | Ga0075363_100013015 | 3300006048 | Bacteria | 4020 |
| 143 | Ga0075363_100061813 | 3300006048 | Bacteria | 2019 |
| 144 | Ga0075363_100147974 | 3300006048 | Bacteria | 1325 |
| 145 | Ga0075364_10001857 | 3300006051 | Bacteria | 11717 |
| 146 | Ga0070715_10000410 | 3300006163 | Bacteria | 10909 |
| 147 | Ga0070715_10058258 | 3300006163 | Bacteria | 1686 |
| 148 | Ga0070715_10099577 | 3300006163 | Bacteria | 1353 |
| 149 | Ga0070716_100002026 | 3300006173 | Bacteria | 9254 |
| 150 | Ga0070716_100009188 | 3300006173 | Bacteria | 4922 |
| 151 | Ga0070712_100010253 | 3300006175 | Bacteria | 5908 |
| 152 | Ga0070712_100263942 | 3300006175 | Bacteria | 1381 |
| 153 | Ga0075367_10007598 | 3300006178 | Bacteria | 5565 |
| 154 | Ga0075367_10027267 | 3300006178 | Bacteria | 3248 |
| 155 | Ga0097621_100021184 | 3300006237 | Bacteria | 5023 |
| 156 | Ga0068871_100065695 | 3300006358 | Bacteria | 2972 |
| 157 | Ga0068871_100093790 | 3300006358 | Bacteria | 2505 |
| 158 | Ga0068871_100186662 | 3300006358 | Bacteria | 1784 |
| 159 | Ga0075428_100006002 | 3300006844 | Bacteria | 13494 |
| 160 | Ga0075428_100138493 | 3300006844 | Bacteria | 2646 |
| 161 | Ga0075428_100235198 | 3300006844 | Bacteria | 1977 |
| 162 | Ga0075430_100006827 | 3300006846 | Bacteria | 9621 |
| 163 | Ga0075430_100008098 | 3300006846 | Bacteria | 8883 |
| 164 | Ga0075430_100057057 | 3300006846 | Bacteria | 3285 |
| 165 | Ga0075431_100001669 | 3300006847 | Bacteria | 20817 |
| 166 | Ga0075431_100015632 | 3300006847 | Bacteria | 7693 |
| 167 | Ga0075431_100016133 | 3300006847 | Bacteria | 7580 |
| 168 | Ga0075431_100098618 | 3300006847 | Bacteria | 3017 |
| 169 | Ga0075434_100006094 | 3300006871 | Bacteria | 11036 |
| 170 | Ga0075429_100013543 | 3300006880 | Bacteria | 7076 |
| 171 | Ga0075429_100378431 | 3300006880 | Bacteria | 1239 |
| 172 | Ga0068865_100001326 | 3300006881 | Bacteria | 14415 |
| 173 | Ga0068865_100159867 | 3300006881 | Bacteria | 1717 |
| 174 | Ga0068865_100323847 | 3300006881 | Bacteria | 1241 |
| 175 | Ga0075436_100037850 | 3300006914 | Bacteria | 3330 |
| 176 | Ga0097620_100002806 | 3300006931 | Bacteria | 17654 |
| 177 | Ga0097620_100195348 | 3300006931 | Bacteria | 2108 |
| 178 | Ga0097620_100768888 | 3300006931 | Bacteria | 1052 |
| 179 | Ga0075435_100045719 | 3300007076 | Bacteria | 3511 |
| 180 | Ga0105244_10032109 | 3300009036 | Bacteria | 2783 |
| 181 | Ga0105250_10005666 | 3300009092 | Bacteria | 5575 |
| 182 | Ga0105240_10017201 | 3300009093 | Bacteria | 9755 |
| 183 | Ga0105240_10020968 | 3300009093 | Bacteria | 8699 |
| 184 | Ga0111539_10002984 | 3300009094 | Bacteria | 22446 |
| 185 | Ga0111539_10013581 | 3300009094 | Bacteria | 10181 |
| 186 | Ga0111539_10029331 | 3300009094 | Bacteria | 6703 |
| 187 | Ga0111539_10472320 | 3300009094 | Bacteria | 1460 |
| 188 | Ga0105245_10001489 | 3300009098 | Bacteria | 21183 |
| 189 | Ga0105245_10052351 | 3300009098 | Bacteria | 3662 |
| 190 | Ga0105247_10002044 | 3300009101 | Bacteria | 13970 |
| 191 | Ga0105247_10084000 | 3300009101 | Bacteria | 2012 |
| 192 | Ga0105247_10172977 | 3300009101 | Bacteria | 1437 |
| 193 | Ga0114129_10006490 | 3300009147 | Bacteria | 16591 |
| 194 | Ga0114129_10039389 | 3300009147 | Bacteria | 6662 |
| 195 | Ga0114129_10115511 | 3300009147 | Bacteria | 3699 |
| 196 | Ga0114129_10286667 | 3300009147 | Bacteria | 2199 |
| 197 | Ga0114129_10342191 | 3300009147 | Bacteria | 1983 |
| 198 | Ga0114129_10405923 | 3300009147 | Bacteria | 1795 |
| 199 | Ga0105243_10002388 | 3300009148 | Bacteria | 15736 |
| 200 | Ga0105243_10058138 | 3300009148 | Bacteria | 3081 |
| 201 | Ga0105243_10059120 | 3300009148 | Bacteria | 3058 |
| 202 | Ga0105243_10077781 | 3300009148 | Bacteria | 2699 |
| 203 | Ga0105241_10006466 | 3300009174 | Bacteria | 8638 |
| 204 | Ga0105241_10124317 | 3300009174 | Bacteria | 2081 |
| 205 | Ga0105248_10001500 | 3300009177 | Bacteria | 25954 |
| 206 | Ga0105248_10036884 | 3300009177 | Bacteria | 5467 |
| 207 | Ga0105248_10344234 | 3300009177 | Bacteria | 1678 |
| 208 | Ga0105237_10002959 | 3300009545 | Bacteria | 20556 |
| 209 | Ga0105237_10006667 | 3300009545 | Bacteria | 12761 |
| 210 | Ga0105237_10013047 | 3300009545 | Bacteria | 8725 |
| 211 | Ga0105238_10056851 | 3300009551 | Bacteria | 3924 |
| 212 | Ga0105238_10074495 | 3300009551 | Bacteria | 3387 |
| 213 | Ga0105249_10000775 | 3300009553 | Bacteria | 28627 |
| 214 | Ga0105249_10005964 | 3300009553 | Bacteria | 10558 |
| 215 | Ga0105249_10020835 | 3300009553 | Bacteria | 5863 |
| 216 | Ga0105249_10048959 | 3300009553 | Bacteria | 3854 |
| 217 | Ga0105239_10056224 | 3300010375 | Bacteria | 4316 |
| 218 | Ga0105239_10202847 | 3300010375 | Bacteria | 2222 |
| 219 | Ga0105246_10001892 | 3300011119 | Bacteria | 12602 |
| 220 | Ga0105246_10012955 | 3300011119 | Bacteria | 5218 |
| 221 | Ga0105246_10137577 | 3300011119 | Bacteria | 1832 |
| 222 | Ga0157371_10006736 | 3300013102 | Bacteria | 9393 |
| 223 | Ga0157369_10006271 | 3300013105 | Bacteria | 13803 |
| 224 | Ga0157378_10002206 | 3300013297 | Bacteria | 17281 |
| 225 | Ga0157378_10069630 | 3300013297 | Bacteria | 3156 |
| 226 | Ga0157378_10164863 | 3300013297 | Bacteria | 2075 |
| 227 | Ga0163162_10002752 | 3300013306 | Bacteria | 16697 |
| 228 | Ga0163162_10329713 | 3300013306 | Bacteria | 1659 |
| 229 | Ga0163162_10344829 | 3300013306 | Bacteria | 1622 |
| 230 | Ga0157375_10003722 | 3300013308 | Bacteria | 13234 |
| 231 | Ga0157375_10004209 | 3300013308 | Bacteria | 12481 |
| 232 | Ga0157375_10297543 | 3300013308 | Bacteria | 1777 |
| 233 | Ga0157375_10308030 | 3300013308 | Bacteria | 1748 |
| 234 | Ga0157380_10039991 | 3300014326 | Bacteria | 3650 |
| 235 | Ga0157380_10100365 | 3300014326 | Bacteria | 2409 |
| 236 | Ga0157380_10141486 | 3300014326 | Bacteria | 2068 |
| 237 | Ga0157380_10476500 | 3300014326 | Bacteria | 1206 |
| 238 | Ga0157379_10034256 | 3300014968 | Bacteria | 4526 |
| 239 | Ga0157379_10092823 | 3300014968 | Bacteria | 2708 |
| 240 | Ga0157379_10188887 | 3300014968 | Bacteria | 1862 |
| 241 | Ga0157379_10266007 | 3300014968 | Bacteria | 1559 |
| 242 | Ga0157376_10000823 | 3300014969 | Bacteria | 20317 |
| 243 | Ga0157376_10011387 | 3300014969 | Bacteria | 6554 |
| 244 | Ga0157376_10125052 | 3300014969 | Bacteria | 2286 |
| 245 | Ga0157376_10205715 | 3300014969 | Bacteria | 1814 |
| 246 | Ga0157376_10382186 | 3300014969 | Bacteria | 1357 |
| 247 | Ga0163161_10006062 | 3300017792 | Bacteria | 8380 |
| 248 | Ga0163161_10210100 | 3300017792 | Bacteria | 1503 |
| 249 | Ga0213874_10031407 | 3300021377 | Bacteria | 1537 |
| 250 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 251 | Ga0207653_10001221 | 3300025885 | Bacteria | 8404 |
| 252 | Ga0207692_10083908 | 3300025898 | Bacteria | 1711 |
| 253 | Ga0207642_10002770 | 3300025899 | Bacteria | 5471 |
| 254 | Ga0207710_10001172 | 3300025900 | Bacteria | 13328 |
| 255 | Ga0207710_10062342 | 3300025900 | Bacteria | 1694 |
| 256 | Ga0207688_10005595 | 3300025901 | Bacteria | 6834 |
| 257 | Ga0207688_10082994 | 3300025901 | Bacteria | 1832 |
| 258 | Ga0207680_10004778 | 3300025903 | Bacteria | 6450 |
| 259 | Ga0207685_10000332 | 3300025905 | Bacteria | 7623 |
| 260 | Ga0207699_10001135 | 3300025906 | Bacteria | 12602 |
| 261 | Ga0207645_10005698 | 3300025907 | Bacteria | 8999 |
| 262 | Ga0207643_10053536 | 3300025908 | Bacteria | 2293 |
| 263 | Ga0207705_10279722 | 3300025909 | Bacteria | 1277 |
| 264 | Ga0207684_10063894 | 3300025910 | Bacteria | 3125 |
| 265 | Ga0207654_10032096 | 3300025911 | Bacteria | 2898 |
| 266 | Ga0207654_10057474 | 3300025911 | Bacteria | 2261 |
| 267 | Ga0207707_10020800 | 3300025912 | Bacteria | 5732 |
| 268 | Ga0207707_10021729 | 3300025912 | Bacteria | 5609 |
| 269 | Ga0207707_10055109 | 3300025912 | Bacteria | 3459 |
| 270 | Ga0207707_10118204 | 3300025912 | Bacteria | 2317 |
| 271 | Ga0207695_10060681 | 3300025913 | Bacteria | 3913 |
| 272 | Ga0207671_10013744 | 3300025914 | Bacteria | 6427 |
| 273 | Ga0207671_10015825 | 3300025914 | Bacteria | 5885 |
| 274 | Ga0207693_10000313 | 3300025915 | Bacteria | 45228 |
| 275 | Ga0207693_10027789 | 3300025915 | Bacteria | 4471 |
| 276 | Ga0207693_10031514 | 3300025915 | Bacteria | 4189 |
| 277 | Ga0207693_10099806 | 3300025915 | Bacteria | 2276 |
| 278 | Ga0207663_10028091 | 3300025916 | Bacteria | 3288 |
| 279 | Ga0207660_10044863 | 3300025917 | Bacteria | 3111 |
| 280 | Ga0207660_10046845 | 3300025917 | Bacteria | 3054 |
| 281 | Ga0207660_10065983 | 3300025917 | Bacteria | 2617 |
| 282 | Ga0207662_10013266 | 3300025918 | Bacteria | 4606 |
| 283 | Ga0207662_10039597 | 3300025918 | Bacteria | 2766 |
| 284 | Ga0207657_10000112 | 3300025919 | Bacteria | 79849 |
| 285 | Ga0207657_10002910 | 3300025919 | Bacteria | 18383 |
| 286 | Ga0207649_10295662 | 3300025920 | Bacteria | 1182 |
| 287 | Ga0207652_10019094 | 3300025921 | Bacteria | 5632 |
| 288 | Ga0207652_10065819 | 3300025921 | Bacteria | 3139 |
| 289 | Ga0207652_10118830 | 3300025921 | Bacteria | 2350 |
| 290 | Ga0207646_10050170 | 3300025922 | Bacteria | 3735 |
| 291 | Ga0207646_10056330 | 3300025922 | Bacteria | 3514 |
| 292 | Ga0207694_10090191 | 3300025924 | Bacteria | 2418 |
| 293 | Ga0207659_10010412 | 3300025926 | Bacteria | 5845 |
| 294 | Ga0207659_10226482 | 3300025926 | Bacteria | 1506 |
| 295 | Ga0207687_10004391 | 3300025927 | Bacteria | 9411 |
| 296 | Ga0207687_10067076 | 3300025927 | Bacteria | 2552 |
| 297 | Ga0207664_10106423 | 3300025929 | Bacteria | 2325 |
| 298 | Ga0207664_10234462 | 3300025929 | Bacteria | 1596 |
| 299 | Ga0207690_10002166 | 3300025932 | Bacteria | 12002 |
| 300 | Ga0207690_10100332 | 3300025932 | Bacteria | 2066 |
| 301 | Ga0207690_10104894 | 3300025932 | Bacteria | 2026 |
| 302 | Ga0207706_10000831 | 3300025933 | Bacteria | 32015 |
| 303 | Ga0207686_10004856 | 3300025934 | Bacteria | 7226 |
| 304 | Ga0207709_10098640 | 3300025935 | Bacteria | 1927 |
| 305 | Ga0207709_10150707 | 3300025935 | Bacteria | 1610 |
| 306 | Ga0207709_10189739 | 3300025935 | Bacteria | 1459 |
| 307 | Ga0207704_10008196 | 3300025938 | Bacteria | 4979 |
| 308 | Ga0207704_10176442 | 3300025938 | Bacteria | 1539 |
| 309 | Ga0207665_10000565 | 3300025939 | Bacteria | 24973 |
| 310 | Ga0207691_10000623 | 3300025940 | Bacteria | 35146 |
| 311 | Ga0207691_10019021 | 3300025940 | Bacteria | 6505 |
| 312 | Ga0207691_10175841 | 3300025940 | Bacteria | 1872 |
| 313 | Ga0207711_10007904 | 3300025941 | Bacteria | 8898 |
| 314 | Ga0207661_10011376 | 3300025944 | Bacteria | 6445 |
| 315 | Ga0207661_10087609 | 3300025944 | Bacteria | 2586 |
| 316 | Ga0207679_10009793 | 3300025945 | Bacteria | 6149 |
| 317 | Ga0207667_10007538 | 3300025949 | Bacteria | 13058 |
| 318 | Ga0207667_10083775 | 3300025949 | Bacteria | 3302 |
| 319 | Ga0207651_10018895 | 3300025960 | Bacteria | 4115 |
| 320 | Ga0207712_10055902 | 3300025961 | Bacteria | 2779 |
| 321 | Ga0207712_10103501 | 3300025961 | Bacteria | 2121 |
| 322 | Ga0207668_10067997 | 3300025972 | Bacteria | 2531 |
| 323 | Ga0207640_10004101 | 3300025981 | Bacteria | 7874 |
| 324 | Ga0207658_10039058 | 3300025986 | Bacteria | 3423 |
| 325 | Ga0207677_10072886 | 3300026023 | Bacteria | 2430 |
| 326 | Ga0207703_10015420 | 3300026035 | Bacteria | 5959 |
| 327 | Ga0207703_10232955 | 3300026035 | Bacteria | 1652 |
| 328 | Ga0207639_10009638 | 3300026041 | Bacteria | 6672 |
| 329 | Ga0207678_10000086 | 3300026067 | Bacteria | 76696 |
| 330 | Ga0207678_10000635 | 3300026067 | Bacteria | 32236 |
| 331 | Ga0207678_10039941 | 3300026067 | Bacteria | 4070 |
| 332 | Ga0207708_10000858 | 3300026075 | Bacteria | 22914 |
| 333 | Ga0207708_10006325 | 3300026075 | Bacteria | 8777 |
| 334 | Ga0207708_10043439 | 3300026075 | Bacteria | 3425 |
| 335 | Ga0207708_10060504 | 3300026075 | Bacteria | 2891 |
| 336 | Ga0207708_10090745 | 3300026075 | Bacteria | 2355 |
| 337 | Ga0207641_10043891 | 3300026088 | Bacteria | 3757 |
| 338 | Ga0207648_10065450 | 3300026089 | Bacteria | 3169 |
| 339 | Ga0207648_10171095 | 3300026089 | Bacteria | 1920 |
| 340 | Ga0207648_10211581 | 3300026089 | Bacteria | 1721 |
| 341 | Ga0207676_10009929 | 3300026095 | Bacteria | 6770 |
| 342 | Ga0207676_10034688 | 3300026095 | Bacteria | 3821 |
| 343 | Ga0207674_10002969 | 3300026116 | Bacteria | 21059 |
| 344 | Ga0207674_10003298 | 3300026116 | Bacteria | 19855 |
| 345 | Ga0207674_10031482 | 3300026116 | Bacteria | 5573 |
| 346 | Ga0207675_100000111 | 3300026118 | Bacteria | 66086 |
| 347 | Ga0207675_100021202 | 3300026118 | Bacteria | 6053 |
| 348 | Ga0207675_100038220 | 3300026118 | Bacteria | 4478 |
| 349 | Ga0207675_100130678 | 3300026118 | Bacteria | 2381 |
| 350 | Ga0207675_100218573 | 3300026118 | Bacteria | 1835 |
| 351 | Ga0207683_10000120 | 3300026121 | Bacteria | 64461 |
| 352 | Ga0207683_10042740 | 3300026121 | Bacteria | 3959 |
| 353 | Ga0207698_10007677 | 3300026142 | Bacteria | 6765 |
| 354 | Ga0207698_10081343 | 3300026142 | Bacteria | 2614 |
| 355 | Ga0207698_10172274 | 3300026142 | Bacteria | 1907 |
| 356 | Ga0209998_10014548 | 3300027717 | Bacteria | 1643 |
| 357 | Ga0209813_10002124 | 3300027866 | Bacteria | 4520 |
| 358 | Ga0209974_10044999 | 3300027876 | Bacteria | 1473 |
| 359 | Ga0207428_10003753 | 3300027907 | Bacteria | 14583 |
| 360 | Ga0207428_10042572 | 3300027907 | Bacteria | 3672 |
| 361 | Ga0207428_10164272 | 3300027907 | Bacteria | 1684 |
| 362 | Ga0268266_10033432 | 3300028379 | Bacteria | 4372 |
| 363 | Ga0268265_10007628 | 3300028380 | Bacteria | 7299 |
| 364 | Ga0268265_10100982 | 3300028380 | Bacteria | 2330 |
| 365 | Ga0268265_10242537 | 3300028380 | Bacteria | 1591 |
| 366 | Ga0268264_10003915 | 3300028381 | Bacteria | 12752 |
| 367 | Ga0268264_10048635 | 3300028381 | Bacteria | 3528 |
| 368 | Ga0268264_10050991 | 3300028381 | Bacteria | 3447 |
| 369 | Ga0268264_10051331 | 3300028381 | Bacteria | 3436 |
| 370 | Ga0268264_10427995 | 3300028381 | Bacteria | 1278 |
| 371 | Ga0265327_10045148 | 3300031251 | Bacteria | 2344 |
| 372 | Ga0307513_10009994 | 3300031456 | Bacteria | 11971 |
| 373 | Ga0316575_10069424 | 3300031665 | Bacteria | 1414 |
| 374 | Ga0316579_10017334 | 3300031691 | Bacteria | 3156 |
| 375 | Ga0316578_10072659 | 3300031728 | Bacteria | 2037 |
| 376 | Ga0316577_10005671 | 3300031733 | Bacteria | 6549 |
| 377 | Ga0307413_10152447 | 3300031824 | Bacteria | 1613 |
| 378 | Ga0307406_10086022 | 3300031901 | Bacteria | 2104 |
| 379 | Ga0316583_10002017 | 3300032133 | Bacteria | 6956 |
| 380 | Ga0316585_10000782 | 3300032137 | Bacteria | 8033 |
| 381 | Ga0316580_10063379 | 3300032139 | Bacteria | 1134 |
| 382 | Ga0307510_10004348 | 3300033180 | Bacteria | 16677 |
| 383 | Ga0307510_10176364 | 3300033180 | Bacteria | 1708 |
| 384 | Ga0373959_0007799 | 3300034820 | Bacteria | 1807 |
| 385 | Ga0373928_0015017 | 3300035084 | Bacteria | 1572 |
| 386 | Ga0373949_0009978 | 3300035090 | Bacteria | 2078 |
| 387 | Ga0373951_0003799 | 3300035091 | Bacteria | 3637 |
| 388 | Ga0373932_0026249 | 3300035112 | Bacteria | 1583 |
| 389 | Ga0373936_0059575 | 3300035113 | Bacteria | 1556 |
| 390 | Ga0373939_0000816 | 3300035114 | Bacteria | 7695 |
| 391 | Ga0373941_0004480 | 3300035115 | Bacteria | 3232 |
| 392 | Ga0373953_0007878 | 3300035117 | Bacteria | 3591 |
| 393 | Ga0373943_0006580 | 3300035170 | Bacteria | 5212 |
| 394 | Ga0373946_0001327 | 3300035171 | Bacteria | 8542 |
| 395 | Ga0373962_0022926 | 3300035242 | Bacteria | 1659 |
| 396 | Ga0316574_0016545 | 3300035398 | Bacteria | 4300 |
| 397 | Ga0373931_0010450 | 3300035691 | Bacteria | 4461 |
| 398 | Ga0373935_0000259 | 3300035692 | Bacteria | 26229 |
| 399 | Ga0373935_0096150 | 3300035692 | Bacteria | 1946 |
| 400 | Ga0373927_0000339 | 3300035695 | Bacteria | 36731 |
| 401 | Ga0373927_0016655 | 3300035695 | Bacteria | 4849 |
| 402 | Ga0373927_0106323 | 3300035695 | Bacteria | 1827 |
| 403 | Ga0373947_0000217 | 3300035725 | Bacteria | 32254 |
| 404 | Ga0373947_0003875 | 3300035725 | Bacteria | 8805 |
| 405 | Ga0373937_0373348 | 3300036401 | Bacteria | 1352 |
| 406 | Ga0316584_0035110 | 3300036712 | Bacteria | 3719 |
| 407 | Ga0373925_0004411 | 3300037068 | Bacteria | 10630 |
| 408 | Ga0373925_0004501 | 3300037068 | Bacteria | 10530 |
| 409 | Ga0373925_0248511 | 3300037068 | Bacteria | 1426 |
| 410 | Ga0395900_0038434 | 3300037418 | Bacteria | 4932 |
| 411 | Ga0395900_0445417 | 3300037418 | Bacteria | 1252 |
| 412 | Ga0395898_0027692 | 3300037466 | Bacteria | 5684 |
| 413 | Ga0395898_0160374 | 3300037466 | Bacteria | 2151 |
| 414 | Ga0395905_0002147 | 3300037471 | Bacteria | 22373 |
| 415 | Ga0316581_0000762 | 3300037588 | Bacteria | 6636 |
| 416 | Ga0400488_29404 | 3300038741 | Bacteria | 1332 |
| 417 | Ga0436365_0023590 | 3300039437 | Bacteria | 4181 |
| 418 | Ga0436361_1121961 | 3300039447 | Bacteria | 4323 |
| 419 | Ga0436363_0713686 | 3300039450 | Bacteria | 2317 |
| 420 | Ga0466968_0003374 | 3300044735 | Bacteria | 5902 |
| 421 | Ga0466967_0499703 | 3300045976 | Bacteria | 1193 |
| 422 | Ga0495592_0045306 | 3300046454 | Bacteria | 3283 |
| 423 | Ga0495603_0000352 | 3300046455 | Bacteria | 24722 |
| 424 | Ga0495603_0000690 | 3300046455 | Bacteria | 19141 |
| 425 | Ga0495629_0003719 | 3300046459 | Bacteria | 11498 |
| 426 | Ga0495641_0019556 | 3300046461 | Bacteria | 3461 |
| 427 | Ga0495651_0183959 | 3300046462 | Bacteria | 1477 |
| 428 | Ga0495580_0036111 | 3300046472 | Bacteria | 3549 |
| 429 | Ga0495580_0062999 | 3300046472 | Bacteria | 2601 |
| 430 | Ga0495582_0000245 | 3300046473 | Bacteria | 30263 |
| 431 | Ga0495582_0002379 | 3300046473 | Bacteria | 10529 |
| 432 | Ga0495605_0099169 | 3300046474 | Bacteria | 1341 |
| 433 | Ga0495639_0001973 | 3300046475 | Bacteria | 9084 |
| 434 | Ga0495639_0009977 | 3300046475 | Bacteria | 4080 |
| 435 | Ga0495662_0000872 | 3300046476 | Bacteria | 14723 |
| 436 | Ga0495662_0173474 | 3300046476 | Bacteria | 1062 |
| 437 | Ga0495664_0004666 | 3300046477 | Bacteria | 7494 |
| 438 | Ga0495584_0035251 | 3300046491 | Bacteria | 2530 |
| 439 | Ga0495594_0001257 | 3300046499 | Bacteria | 13294 |
| 440 | Ga0495594_0004267 | 3300046499 | Bacteria | 7344 |
| 441 | Ga0495630_0100139 | 3300046517 | Bacteria | 2192 |
| 442 | Ga0495666_0005612 | 3300046526 | Bacteria | 6319 |
| 443 | Ga0495666_0041105 | 3300046526 | Bacteria | 2240 |
| 444 | Ga0495665_0000361 | 3300046531 | Bacteria | 22971 |
| 445 | Ga0495640_0003002 | 3300046533 | Bacteria | 13580 |
| 446 | Ga0495586_0055550 | 3300046535 | Bacteria | 2146 |
| 447 | Ga0495622_0005361 | 3300046557 | Bacteria | 5956 |
| 448 | Ga0495622_0006317 | 3300046557 | Bacteria | 5501 |
| 449 | Ga0495634_0000249 | 3300046642 | Bacteria | 50835 |
| 450 | Ga0495634_0027901 | 3300046642 | Bacteria | 3924 |
| 451 | Ga0495635_0000239 | 3300046663 | Bacteria | 34889 |
| 452 | Ga0495635_0035103 | 3300046663 | Bacteria | 3477 |
| 453 | Ga0495588_0000969 | 3300046674 | Bacteria | 12540 |
| 454 | Ga0495588_0003787 | 3300046674 | Bacteria | 6628 |
| 455 | Ga0495657_0212667 | 3300046675 | Bacteria | 1175 |
| 456 | Ga0495599_0081034 | 3300046678 | Bacteria | 2027 |
| 457 | Ga0495646_0005453 | 3300046680 | Bacteria | 8043 |
| 458 | Ga0495647_0001674 | 3300046681 | Bacteria | 6865 |
| 459 | Ga0495647_0006037 | 3300046681 | Bacteria | 3994 |
| 460 | Ga0495658_0000894 | 3300046683 | Bacteria | 16029 |
| 461 | Ga0495658_0001058 | 3300046683 | Bacteria | 14532 |
| 462 | Ga0495613_0000929 | 3300046689 | Bacteria | 22466 |
| 463 | Ga0495624_0029524 | 3300046690 | Bacteria | 3577 |
| 464 | Ga0495581_0001238 | 3300047315 | Bacteria | 14050 |
| 465 | Ga0495581_0009037 | 3300047315 | Bacteria | 5765 |
| 466 | Ga0495674_0001854 | 3300047319 | Bacteria | 20818 |
| 467 | Ga0495672_0086060 | 3300047320 | Bacteria | 1739 |
| 468 | Ga0495676_0006581 | 3300047321 | Bacteria | 10709 |
| 469 | Ga0495593_0000034 | 3300047673 | Bacteria | 57993 |
| 470 | Ga0495593_0003109 | 3300047673 | Bacteria | 9989 |
| 471 | Ga0495614_0033292 | 3300048089 | Bacteria | 2217 |
| 472 | Ga0496100_0014301 | 3300048903 | Bacteria | 4605 |
| 473 | Ga0496100_0036866 | 3300048903 | Bacteria | 3087 |
| 474 | Ga0496100_0077437 | 3300048903 | Bacteria | 2236 |
| 475 | Ga0496100_0097700 | 3300048903 | Bacteria | 2017 |
| 476 | Ga0496100_0334359 | 3300048903 | Bacteria | 1141 |
| 477 | Ga0496101_0004744 | 3300048904 | Bacteria | 8619 |
| 478 | Ga0496101_0008012 | 3300048904 | Bacteria | 6887 |
| 479 | Ga0496101_0016183 | 3300048904 | Bacteria | 5034 |
| 480 | Ga0496101_0027240 | 3300048904 | Bacteria | 3979 |
| 481 | Ga0496101_0050383 | 3300048904 | Bacteria | 2997 |
| 482 | Ga0496102_0019579 | 3300048905 | Bacteria | 5962 |
| 483 | Ga0496102_0041385 | 3300048905 | Bacteria | 4172 |
| 484 | Ga0496102_0041393 | 3300048905 | Bacteria | 4171 |
| 485 | Ga0496102_0043014 | 3300048905 | Bacteria | 4094 |
| 486 | Ga0496102_0097661 | 3300048905 | Bacteria | 2724 |
| 487 | Ga0496102_0136802 | 3300048905 | Bacteria | 2296 |
| 488 | Ga0496102_0160435 | 3300048905 | Bacteria | 2115 |
| 489 | Ga0496103_0021847 | 3300048906 | Bacteria | 3851 |
| 490 | Ga0496103_0140629 | 3300048906 | Bacteria | 1543 |
| 491 | Ga0496104_0000896 | 3300048907 | Bacteria | 25644 |
| 492 | Ga0496104_0003861 | 3300048907 | Bacteria | 12964 |
| 493 | Ga0496104_0012253 | 3300048907 | Bacteria | 7706 |
| 494 | Ga0496104_0047777 | 3300048907 | Bacteria | 4034 |
| 495 | Ga0496104_0067013 | 3300048907 | Bacteria | 3409 |
| 496 | Ga0496104_0103233 | 3300048907 | Bacteria | 2731 |
| 497 | Ga0496104_0110524 | 3300048907 | Bacteria | 2635 |
| 498 | Ga0496104_0156641 | 3300048907 | Bacteria | 2186 |
| 499 | Ga0496104_0473218 | 3300048907 | Bacteria | 1164 |
| 500 | Ga0496105_0003076 | 3300048908 | Bacteria | 12259 |
| 501 | Ga0496105_0010634 | 3300048908 | Bacteria | 7240 |
| 502 | Ga0496105_0060224 | 3300048908 | Bacteria | 3132 |
| 503 | Ga0496105_0267914 | 3300048908 | Bacteria | 1380 |
| 504 | Ga0496106_0001165 | 3300048909 | Bacteria | 19535 |
| 505 | Ga0496106_0003602 | 3300048909 | Bacteria | 11547 |
| 506 | Ga0496106_0018675 | 3300048909 | Bacteria | 5133 |
| 507 | Ga0496106_0056783 | 3300048909 | Bacteria | 2959 |
| 508 | Ga0496106_0074183 | 3300048909 | Bacteria | 2604 |
| 509 | Ga0496107_0000864 | 3300048910 | Bacteria | 17818 |
| 510 | Ga0496107_0002347 | 3300048910 | Bacteria | 12226 |
| 511 | Ga0496107_0007804 | 3300048910 | Bacteria | 7387 |
| 512 | Ga0496107_0014980 | 3300048910 | Bacteria | 5430 |
| 513 | Ga0496107_0042076 | 3300048910 | Bacteria | 3281 |
| 514 | Ga0496108_0001756 | 3300048911 | Bacteria | 17236 |
| 515 | Ga0496108_0003943 | 3300048911 | Bacteria | 11912 |
| 516 | Ga0496108_0022494 | 3300048911 | Bacteria | 5184 |
| 517 | Ga0496108_0027953 | 3300048911 | Bacteria | 4664 |
| 518 | Ga0496108_0052743 | 3300048911 | Bacteria | 3409 |
| 519 | Ga0496108_0080436 | 3300048911 | Bacteria | 2760 |
| 520 | Ga0496109_0001766 | 3300048912 | Bacteria | 17962 |
| 521 | Ga0496109_0007783 | 3300048912 | Bacteria | 9072 |
| 522 | Ga0496109_0022983 | 3300048912 | Bacteria | 5529 |
| 523 | Ga0496109_0089084 | 3300048912 | Bacteria | 2852 |
| 524 | Ga0496109_0104497 | 3300048912 | Bacteria | 2630 |
| 525 | Ga0496110_0006306 | 3300048913 | Bacteria | 9366 |
| 526 | Ga0496110_0006833 | 3300048913 | Bacteria | 9070 |
| 527 | Ga0496111_0039983 | 3300048914 | Bacteria | 3364 |
| 528 | Ga0496111_0047425 | 3300048914 | Bacteria | 3094 |
| 529 | Ga0496111_0085829 | 3300048914 | Bacteria | 2302 |
| 530 | Ga0496112_0004975 | 3300048915 | Bacteria | 11392 |
| 531 | Ga0496112_0015968 | 3300048915 | Bacteria | 7020 |
| 532 | Ga0496112_0033821 | 3300048915 | Bacteria | 4972 |
| 533 | Ga0496113_0006365 | 3300048916 | Bacteria | 7473 |
| 534 | Ga0496113_0010550 | 3300048916 | Bacteria | 6112 |
| 535 | Ga0496114_0006801 | 3300048917 | Bacteria | 9007 |
| 536 | Ga0496114_0021328 | 3300048917 | Bacteria | 5270 |
| 537 | Ga0496114_0146345 | 3300048917 | Bacteria | 2048 |
| 538 | Ga0496115_0004097 | 3300048918 | Bacteria | 10520 |
| 539 | Ga0496115_0006428 | 3300048918 | Bacteria | 8611 |
| 540 | Ga0496115_0008945 | 3300048918 | Bacteria | 7428 |
| 541 | Ga0496115_0080950 | 3300048918 | Bacteria | 2644 |
| 542 | Ga0496119_0006190 | 3300048922 | Bacteria | 11190 |
| 543 | Ga0496122_0004307 | 3300048925 | Bacteria | 17825 |
| 544 | Ga0496123_0001264 | 3300048926 | Bacteria | 36241 |
| 545 | Ga0496124_0021627 | 3300048927 | Bacteria | 5925 |
| 546 | Ga0501032_0005003 | 3300049569 | Bacteria | 9911 |
| 547 | Ga0501032_0148701 | 3300049569 | Bacteria | 1541 |
| 548 | Ga0501033_0000951 | 3300049570 | Bacteria | 26299 |
| 549 | Ga0501034_0000068 | 3300049571 | Bacteria | 182904 |
| 550 | Ga0501034_0122200 | 3300049571 | Bacteria | 2590 |
| 551 | Ga0501036_0073052 | 3300049572 | Bacteria | 2900 |
| 552 | Ga0501036_0198103 | 3300049572 | Bacteria | 1689 |
| 553 | Ga0501036_0215419 | 3300049572 | Bacteria | 1613 |
| 554 | Ga0501037_0004019 | 3300049573 | Bacteria | 10664 |
| 555 | Ga0501037_0014308 | 3300049573 | Bacteria | 5846 |
| 556 | Ga0501037_0055452 | 3300049573 | Bacteria | 2897 |
| 557 | Ga0501037_0184260 | 3300049573 | Bacteria | 1480 |
| 558 | Ga0501038_0002206 | 3300049574 | Bacteria | 18110 |
| 559 | Ga0501038_0018478 | 3300049574 | Bacteria | 6294 |
| 560 | Ga0501038_0068898 | 3300049574 | Bacteria | 3006 |
| 561 | Ga0501038_0101530 | 3300049574 | Bacteria | 2394 |
| 562 | Ga0501038_0121078 | 3300049574 | Bacteria | 2158 |
| 563 | Ga0501039_0000138 | 3300049575 | Bacteria | 49539 |
| 564 | Ga0501039_0049318 | 3300049575 | Bacteria | 3254 |
| 565 | Ga0501039_0071747 | 3300049575 | Bacteria | 2691 |
| 566 | Ga0501040_0018623 | 3300049576 | Bacteria | 4611 |
| 567 | Ga0501040_0118882 | 3300049576 | Bacteria | 1853 |
| 568 | Ga0501040_0245199 | 3300049576 | Bacteria | 1277 |
| 569 | Ga0501041_0138617 | 3300049577 | Bacteria | 1516 |
| 570 | Ga0501042_0054738 | 3300049578 | Bacteria | 2846 |
| 571 | Ga0501042_0113757 | 3300049578 | Bacteria | 1949 |
| 572 | Ga0501043_0008635 | 3300049579 | Bacteria | 8029 |
| 573 | Ga0501043_0016672 | 3300049579 | Bacteria | 5756 |
| 574 | Ga0501043_0045168 | 3300049579 | Bacteria | 3464 |
| 575 | Ga0501046_0000246 | 3300049580 | Bacteria | 55453 |
| 576 | Ga0501046_0001138 | 3300049580 | Bacteria | 25939 |
| 577 | Ga0501046_0009035 | 3300049580 | Bacteria | 8640 |
| 578 | Ga0501046_0029168 | 3300049580 | Bacteria | 4487 |
| 579 | Ga0501046_0033104 | 3300049580 | Bacteria | 4180 |
| 580 | Ga0501046_0099067 | 3300049580 | Bacteria | 2238 |
| 581 | Ga0501047_0000873 | 3300049581 | Bacteria | 30764 |
| 582 | Ga0501047_0045210 | 3300049581 | Bacteria | 4257 |
| 583 | Ga0501047_0047475 | 3300049581 | Bacteria | 4148 |
| 584 | Ga0501047_0222274 | 3300049581 | Bacteria | 1744 |
| 585 | Ga0501047_0241804 | 3300049581 | Bacteria | 1656 |
| 586 | Ga0501048_0003772 | 3300049582 | Bacteria | 11565 |
| 587 | Ga0501048_0025718 | 3300049582 | Bacteria | 4288 |
| 588 | Ga0501048_0096937 | 3300049582 | Bacteria | 2080 |
| 589 | Ga0501048_0111950 | 3300049582 | Bacteria | 1928 |
| 590 | Ga0501067_0000720 | 3300049583 | Bacteria | 17832 |
| 591 | Ga0501067_0002784 | 3300049583 | Bacteria | 9618 |
| 592 | Ga0501068_0093350 | 3300049584 | Bacteria | 1859 |
| 593 | Ga0501069_0095720 | 3300049585 | Bacteria | 1682 |
| 594 | Ga0501069_0120888 | 3300049585 | Bacteria | 1496 |
| 595 | Ga0501070_0018079 | 3300049586 | Bacteria | 5915 |
| 596 | Ga0501070_0128627 | 3300049586 | Bacteria | 2093 |
| 597 | Ga0501071_0135895 | 3300049587 | Bacteria | 1829 |
| 598 | Ga0501072_0047056 | 3300049588 | Bacteria | 3397 |
| 599 | Ga0501072_0078433 | 3300049588 | Bacteria | 2615 |
| 600 | Ga0501072_0082658 | 3300049588 | Bacteria | 2546 |
| 601 | Ga0501072_0149359 | 3300049588 | Bacteria | 1863 |
| 602 | Ga0501073_0035793 | 3300049589 | Bacteria | 3527 |
| 603 | Ga0501073_0052011 | 3300049589 | Bacteria | 2869 |
| 604 | Ga0501074_0008973 | 3300049590 | Bacteria | 7254 |
| 605 | Ga0501074_0090284 | 3300049590 | Bacteria | 2194 |
| 606 | Ga0501074_0179244 | 3300049590 | Bacteria | 1512 |
| 607 | Ga0501075_0023749 | 3300049591 | Bacteria | 4490 |
| 608 | Ga0501075_0085786 | 3300049591 | Bacteria | 2385 |
| 609 | Ga0501076_0017141 | 3300049592 | Bacteria | 5502 |
| 610 | Ga0501076_0201687 | 3300049592 | Bacteria | 1624 |
| 611 | Ga0501077_0006521 | 3300049593 | Bacteria | 7162 |
| 612 | Ga0501077_0013027 | 3300049593 | Bacteria | 5210 |
| 613 | Ga0501077_0018697 | 3300049593 | Bacteria | 4383 |
| 614 | Ga0501077_0024533 | 3300049593 | Bacteria | 3829 |
| 615 | Ga0501077_0072055 | 3300049593 | Bacteria | 2189 |
| 616 | Ga0501077_0097586 | 3300049593 | Bacteria | 1862 |
| 617 | Ga0501077_0102564 | 3300049593 | Bacteria | 1812 |
| 618 | Ga0501079_0100692 | 3300049741 | Bacteria | 2240 |
| 619 | Ga0501079_0124167 | 3300049741 | Bacteria | 2008 |
| 620 | Ga0501079_0496256 | 3300049741 | Bacteria | 960 |
| 621 | Ga0501080_0000001 | 3300049742 | Bacteria | 241365 |
| 622 | Ga0501080_0218400 | 3300049742 | Bacteria | 1745 |
| 623 | Ga0501080_0277943 | 3300049742 | Bacteria | 1523 |
| 624 | Ga0501081_0009205 | 3300049743 | Bacteria | 6432 |
| 625 | Ga0501081_0025931 | 3300049743 | Bacteria | 3948 |
| 626 | Ga0501081_0064699 | 3300049743 | Bacteria | 2540 |
| 627 | Ga0501081_0077345 | 3300049743 | Bacteria | 2325 |
| 628 | Ga0501083_0067024 | 3300049744 | Bacteria | 2390 |
| 629 | Ga0501083_0093525 | 3300049744 | Bacteria | 1985 |
| 630 | Ga0501035_0000015 | 3300049822 | Bacteria | 246493 |
| 631 | Ga0501035_0123163 | 3300049822 | Bacteria | 2265 |
| 632 | Ga0501035_0140810 | 3300049822 | Bacteria | 2097 |
| 633 | Ga0501035_0223043 | 3300049822 | Bacteria | 1609 |
| 634 | Ga0501044_0000026 | 3300049823 | Bacteria | 183624 |
| 635 | Ga0501044_0024381 | 3300049823 | Bacteria | 6423 |
| 636 | Ga0501044_0071079 | 3300049823 | Bacteria | 3539 |
| 637 | Ga0501044_0088879 | 3300049823 | Bacteria | 3119 |
| 638 | Ga0501044_0137160 | 3300049823 | Bacteria | 2437 |
| 639 | Ga0501045_0057189 | 3300049824 | Bacteria | 2854 |
| 640 | Ga0501045_0081341 | 3300049824 | Bacteria | 2388 |
| 641 | Ga0501045_0113765 | 3300049824 | Bacteria | 2007 |
| 642 | Ga0501045_0154905 | 3300049824 | Bacteria | 1705 |
| 643 | Ga0501045_0215720 | 3300049824 | Bacteria | 1429 |
| 644 | nmdc:mga03n38_4892_c1 | 3300050490 | Bacteria | 4492 |
| 645 | nmdc:mga0yw44_6754_c1 | 3300050492 | Bacteria | 5573 |
| 646 | nmdc:mga0yw44_82060_c1 | 3300050492 | Bacteria | 2022 |
| 647 | nmdc:mga06z11_10108_c1 | 3300050494 | Bacteria | 4006 |
| 648 | nmdc:mga06z11_2473_c1 | 3300050494 | Bacteria | 7065 |
| 649 | nmdc:mga06z11_5316_c1 | 3300050494 | Bacteria | 5158 |
| 650 | nmdc:mga05p37_104104_c1 | 3300050507 | Bacteria | 3492 |
| 651 | nmdc:mga05p37_272375_c1 | 3300050507 | Bacteria | 2022 |
| 652 | nmdc:mga05p37_662089_c1 | 3300050507 | Bacteria | 1167 |
| 653 | nmdc:mga09592_140460_c1 | 3300050508 | Bacteria | 2082 |
| 654 | nmdc:mga09592_86312_c1 | 3300050508 | Bacteria | 2678 |
| 655 | nmdc:mga0qj67_101136_c1 | 3300050509 | Bacteria | 2324 |
| 656 | nmdc:mga0qj67_139930_c1 | 3300050509 | Bacteria | 1962 |
| 657 | nmdc:mga0qj67_2593_c1 | 3300050509 | Bacteria | 12934 |
| 658 | nmdc:mga0qj67_5024_c1 | 3300050509 | Bacteria | 9611 |
| 659 | nmdc:mga06r32_121694_c1 | 3300050510 | Bacteria | 2575 |
| 660 | nmdc:mga06r32_122065_c1 | 3300050510 | Bacteria | 2571 |
| 661 | nmdc:mga06r32_158391_c1 | 3300050510 | Bacteria | 2246 |
| 662 | nmdc:mga06r32_171466_c1 | 3300050510 | Bacteria | 2154 |
| 663 | nmdc:mga06r32_171925_c1 | 3300050510 | Bacteria | 2151 |
| 664 | nmdc:mga06r32_194225_c1 | 3300050510 | Bacteria | 2017 |
| 665 | nmdc:mga06r32_207291_c1 | 3300050510 | Bacteria | 1948 |
| 666 | nmdc:mga08y16_29966_c1 | 3300050511 | Bacteria | 5730 |
| 667 | nmdc:mga08y16_344153_c1 | 3300050511 | Bacteria | 1532 |
| 668 | nmdc:mga08y16_38717_c1 | 3300050511 | Bacteria | 5004 |
| 669 | nmdc:mga08y16_4688_c1 | 3300050511 | Bacteria | 14246 |
| 670 | nmdc:mga08y16_75735_c1 | 3300050511 | Bacteria | 3507 |
| 671 | nmdc:mga0n895_4339_c1 | 3300050512 | Bacteria | 11624 |
| 672 | nmdc:mga0rr50_206727_c1 | 3300050513 | Bacteria | 1616 |
| 673 | nmdc:mga08x19_122731_c1 | 3300050514 | Bacteria | 1743 |
| 674 | nmdc:mga0a205_15593_c1 | 3300050515 | Bacteria | 7102 |
| 675 | nmdc:mga0a205_172290_c1 | 3300050515 | Bacteria | 2060 |
| 676 | Ga0495601_0003880 | 3300053077 | Bacteria | 8610 |
| 677 | Ga0495619_0000737 | 3300053085 | Bacteria | 21356 |
| 678 | Ga0500651_0121984 | 3300053093 | Bacteria | 1582 |
| 679 | Ga0500641_0102935 | 3300053096 | Bacteria | 1225 |
| 680 | Ga0500556_0000880 | 3300053104 | Bacteria | 16880 |
| 681 | Ga0500556_0005856 | 3300053104 | Bacteria | 3479 |
| 682 | Ga0500556_0028955 | 3300053104 | Bacteria | 1863 |
| 683 | Ga0500595_003935 | 3300053119 | Bacteria | 6804 |
| 684 | Ga0500595_030317 | 3300053119 | Bacteria | 1824 |
| 685 | Ga0500603_000277 | 3300053150 | Bacteria | 13486 |
| 686 | Ga0500616_0087068 | 3300053153 | Bacteria | 1556 |
| 687 | Ga0500645_001299 | 3300053730 | Bacteria | 12970 |
| 688 | Ga0500645_048969 | 3300053730 | Bacteria | 1237 |
| 689 | Ga0501084_0048092 | 3300054114 | Bacteria | 3571 |
| 690 | Ga0501084_0074180 | 3300054114 | Bacteria | 2849 |
| 691 | Ga0501084_0105553 | 3300054114 | Bacteria | 2366 |
| 692 | Ga0501084_0138192 | 3300054114 | Bacteria | 2051 |
| 693 | Ga0501084_0182300 | 3300054114 | Bacteria | 1773 |
| 694 | Ga0501082_0011098 | 3300060353 | Bacteria | 7745 |
| 695 | Ga0501082_0021150 | 3300060353 | Bacteria | 5611 |
| 696 | Ga0501082_0069173 | 3300060353 | Bacteria | 3039 |
| 697 | Ga0501082_0106698 | 3300060353 | Bacteria | 2423 |
| 698 | Ga0501082_0180095 | 3300060353 | Bacteria | 1838 |
| 699 | Ga0466962_0161495 | 3300061719 | Bacteria | 1089 |
| 700 | Ga0530510_0007129 | 3300061734 | Bacteria | 7781 |
| 701 | Ga0530510_0013419 | 3300061734 | Bacteria | 5760 |
| 702 | Ga0530510_0039774 | 3300061734 | Bacteria | 3394 |
| 703 | Ga0530510_0072416 | 3300061734 | Bacteria | 2501 |
| 704 | Ga0530510_0080532 | 3300061734 | Bacteria | 2370 |
| 705 | Ga0530510_0089578 | 3300061734 | Bacteria | 2243 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031456 | Ga0307513_10009994 | Ga0307513_100099946 | 287 |
| 2 | 3300053093 | Ga0500651_0121984 | Ga0500651_0121984_594_1547 | 287 |
| 3 | 3300031901 | Ga0307406_10086022 | Ga0307406_100860222 | 290 |
| 4 | 3300049591 | Ga0501075_0085786 | Ga0501075_0085786_566_1534 | 291 |
| 5 | 3300049593 | Ga0501077_0006521 | Ga0501077_0006521_1998_3017 | 291 |
| 6 | 3300049741 | Ga0501079_0100692 | Ga0501079_0100692_362_1330 | 291 |
| 7 | 3300049743 | Ga0501081_0025931 | Ga0501081_0025931_2807_3826 | 291 |
| 8 | 3300054114 | Ga0501084_0105553 | Ga0501084_0105553_862_1881 | 291 |
| 9 | 3300060353 | Ga0501082_0021150 | Ga0501082_0021150_2576_3595 | 291 |
| 10 | 3300061734 | Ga0530510_0089578 | Ga0530510_0089578_963_2003 | 291 |
| 11 | 3300009147 | Ga0114129_10039389 | Ga0114129_100393892 | 293 |
| 12 | 3300026118 | Ga0207675_100218573 | Ga0207675_1002185732 | 293 |
| 13 | 3300035084 | Ga0373928_0015017 | Ga0373928_0015017_605_1531 | 293 |
| 14 | 3300035090 | Ga0373949_0009978 | Ga0373949_0009978_823_1749 | 293 |
| 15 | 3300046491 | Ga0495584_0035251 | Ga0495584_0035251_1575_2501 | 293 |
| 16 | 3300050507 | nmdc:mga05p37_662089_c1 | nmdc:mga05p37_662089_c1_182_1108 | 293 |
| 17 | 3300050511 | nmdc:mga08y16_344153_c1 | nmdc:mga08y16_344153_c1_85_1011 | 293 |
| 18 | 3300050511 | nmdc:mga08y16_75735_c1 | nmdc:mga08y16_75735_c1_1950_2876 | 293 |
| 19 | 3300053153 | Ga0500616_0087068 | Ga0500616_0087068_600_1523 | 293 |
| 20 | 3300049824 | Ga0501045_0113765 | Ga0501045_0113765_210_1178 | 294 |
| 21 | 3300006847 | Ga0075431_100001669 | Ga0075431_10000166914 | 297 |
| 22 | 3300025935 | Ga0207709_10150707 | Ga0207709_101507072 | 297 |
| 23 | 3300049743 | Ga0501081_0009205 | Ga0501081_0009205_5136_6164 | 297 |
| 24 | 3300054114 | Ga0501084_0074180 | Ga0501084_0074180_325_1356 | 297 |
| 25 | 3300005843 | Ga0068860_100313817 | Ga0068860_1003138172 | 300 |
| 26 | 3300031251 | Ga0265327_10045148 | Ga0265327_100451482 | 300 |
| 27 | 3300048907 | Ga0496104_0103233 | Ga0496104_0103233_434_1351 | 300 |
| 28 | 3300048909 | Ga0496106_0001165 | Ga0496106_0001165_12352_13269 | 300 |
| 29 | 3300048911 | Ga0496108_0003943 | Ga0496108_0003943_1742_2659 | 300 |
| 30 | 3300048912 | Ga0496109_0001766 | Ga0496109_0001766_6065_6982 | 300 |
| 31 | 3300048913 | Ga0496110_0006833 | Ga0496110_0006833_3895_4812 | 300 |
| 32 | 3300048915 | Ga0496112_0015968 | Ga0496112_0015968_3998_4915 | 300 |
| 33 | 3300049573 | Ga0501037_0055452 | Ga0501037_0055452_1605_2522 | 300 |
| 34 | 3300049574 | Ga0501038_0002206 | Ga0501038_0002206_4723_5640 | 300 |
| 35 | 3300049574 | Ga0501038_0068898 | Ga0501038_0068898_1638_2555 | 300 |
| 36 | 3300049576 | Ga0501040_0118882 | Ga0501040_0118882_23_940 | 300 |
| 37 | 3300049579 | Ga0501043_0008635 | Ga0501043_0008635_3976_4893 | 300 |
| 38 | 3300049579 | Ga0501043_0045168 | Ga0501043_0045168_933_1850 | 300 |
| 39 | 3300049581 | Ga0501047_0222274 | Ga0501047_0222274_504_1421 | 300 |
| 40 | 3300049741 | Ga0501079_0124167 | Ga0501079_0124167_356_1273 | 300 |
| 41 | 3300049744 | Ga0501083_0067024 | Ga0501083_0067024_1338_2255 | 300 |
| 42 | 3300049823 | Ga0501044_0024381 | Ga0501044_0024381_3153_4070 | 300 |
| 43 | 3300049824 | Ga0501045_0081341 | Ga0501045_0081341_258_1175 | 300 |
| 44 | iso_pu_bacteria | 2595698237 | 2596374190 | 300 |
| 45 | iso_pu_bacteria | 2889306138 | 2889307148 | 300 |
| 46 | iso_pu_bacteria | 2902330777 | 2902333018 | 300 |
| 47 | iso_pu_bacteria | 2902405164 | 2902411939 | 300 |
| 48 | iso_pu_bacteria | 2928125067 | 2928129776 | 300 |
| 49 | 3300005336 | Ga0070680_100141690 | Ga0070680_1001416902 | 301 |
| 50 | 3300005339 | Ga0070660_100002003 | Ga0070660_1000020038 | 301 |
| 51 | 3300005341 | Ga0070691_10043067 | Ga0070691_100430672 | 301 |
| 52 | 3300005344 | Ga0070661_100092817 | Ga0070661_1000928172 | 301 |
| 53 | 3300005353 | Ga0070669_100037889 | Ga0070669_1000378892 | 301 |
| 54 | 3300005354 | Ga0070675_100457065 | Ga0070675_1004570651 | 301 |
| 55 | 3300005366 | Ga0070659_100174085 | Ga0070659_1001740852 | 301 |
| 56 | 3300005435 | Ga0070714_100291835 | Ga0070714_1002918352 | 301 |
| 57 | 3300005436 | Ga0070713_100040503 | Ga0070713_1000405033 | 301 |
| 58 | 3300005439 | Ga0070711_100084248 | Ga0070711_1000842482 | 301 |
| 59 | 3300005445 | Ga0070708_100041592 | Ga0070708_1000415924 | 301 |
| 60 | 3300005455 | Ga0070663_100031501 | Ga0070663_1000315012 | 301 |
| 61 | 3300005456 | Ga0070678_100044929 | Ga0070678_1000449292 | 301 |
| 62 | 3300005459 | Ga0068867_100036668 | Ga0068867_1000366683 | 301 |
| 63 | 3300005468 | Ga0070707_100166870 | Ga0070707_1001668702 | 301 |
| 64 | 3300005535 | Ga0070684_100014119 | Ga0070684_1000141195 | 301 |
| 65 | 3300005539 | Ga0068853_100008362 | Ga0068853_1000083623 | 301 |
| 66 | 3300005548 | Ga0070665_100021991 | Ga0070665_1000219914 | 301 |
| 67 | 3300005549 | Ga0070704_100308289 | Ga0070704_1003082891 | 301 |
| 68 | 3300005563 | Ga0068855_100030914 | Ga0068855_1000309145 | 301 |
| 69 | 3300005563 | Ga0068855_100042928 | Ga0068855_1000429284 | 301 |
| 70 | 3300005577 | Ga0068857_100021812 | Ga0068857_1000218124 | 301 |
| 71 | 3300005616 | Ga0068852_100161808 | Ga0068852_1001618082 | 301 |
| 72 | 3300005617 | Ga0068859_100768927 | Ga0068859_1007689271 | 301 |
| 73 | 3300005718 | Ga0068866_10057930 | Ga0068866_100579302 | 301 |
| 74 | 3300005844 | Ga0068862_100214141 | Ga0068862_1002141412 | 301 |
| 75 | 3300005937 | Ga0081455_10006756 | Ga0081455_100067569 | 301 |
| 76 | 3300006048 | Ga0075363_100147974 | Ga0075363_1001479742 | 301 |
| 77 | 3300006163 | Ga0070715_10058258 | Ga0070715_100582582 | 301 |
| 78 | 3300006173 | Ga0070716_100009188 | Ga0070716_1000091883 | 301 |
| 79 | 3300006175 | Ga0070712_100263942 | Ga0070712_1002639422 | 301 |
| 80 | 3300006846 | Ga0075430_100006827 | Ga0075430_1000068275 | 301 |
| 81 | 3300006846 | Ga0075430_100057057 | Ga0075430_1000570572 | 301 |
| 82 | 3300006847 | Ga0075431_100015632 | Ga0075431_1000156325 | 301 |
| 83 | 3300006881 | Ga0068865_100159867 | Ga0068865_1001598672 | 301 |
| 84 | 3300006931 | Ga0097620_100768888 | Ga0097620_1007688881 | 301 |
| 85 | 3300009093 | Ga0105240_10017201 | Ga0105240_100172015 | 301 |
| 86 | 3300009094 | Ga0111539_10013581 | Ga0111539_100135816 | 301 |
| 87 | 3300009098 | Ga0105245_10052351 | Ga0105245_100523512 | 301 |
| 88 | 3300009147 | Ga0114129_10286667 | Ga0114129_102866672 | 301 |
| 89 | 3300009148 | Ga0105243_10077781 | Ga0105243_100777813 | 301 |
| 90 | 3300009545 | Ga0105237_10013047 | Ga0105237_100130476 | 301 |
| 91 | 3300009551 | Ga0105238_10074495 | Ga0105238_100744952 | 301 |
| 92 | 3300009553 | Ga0105249_10020835 | Ga0105249_100208353 | 301 |
| 93 | 3300010375 | Ga0105239_10202847 | Ga0105239_102028472 | 301 |
| 94 | 3300013297 | Ga0157378_10164863 | Ga0157378_101648633 | 301 |
| 95 | 3300013306 | Ga0163162_10344829 | Ga0163162_103448292 | 301 |
| 96 | 3300013308 | Ga0157375_10297543 | Ga0157375_102975432 | 301 |
| 97 | 3300014326 | Ga0157380_10039991 | Ga0157380_100399913 | 301 |
| 98 | 3300014968 | Ga0157379_10266007 | Ga0157379_102660072 | 301 |
| 99 | 3300014969 | Ga0157376_10205715 | Ga0157376_102057152 | 301 |
| 100 | 3300021377 | Ga0213874_10031407 | Ga0213874_100314072 | 301 |
| 101 | 3300025295 | Ga0209564_1000485 | Ga0209564_100048524 | 301 |
| 102 | 3300025898 | Ga0207692_10083908 | Ga0207692_100839082 | 301 |
| 103 | 3300025901 | Ga0207688_10082994 | Ga0207688_100829942 | 301 |
| 104 | 3300025912 | Ga0207707_10118204 | Ga0207707_101182042 | 301 |
| 105 | 3300025914 | Ga0207671_10013744 | Ga0207671_100137445 | 301 |
| 106 | 3300025915 | Ga0207693_10027789 | Ga0207693_100277892 | 301 |
| 107 | 3300025916 | Ga0207663_10028091 | Ga0207663_100280912 | 301 |
| 108 | 3300025917 | Ga0207660_10065983 | Ga0207660_100659832 | 301 |
| 109 | 3300025918 | Ga0207662_10039597 | Ga0207662_100395975 | 301 |
| 110 | 3300025919 | Ga0207657_10002910 | Ga0207657_100029108 | 301 |
| 111 | 3300025920 | Ga0207649_10295662 | Ga0207649_102956621 | 301 |
| 112 | 3300025921 | Ga0207652_10065819 | Ga0207652_100658192 | 301 |
| 113 | 3300025921 | Ga0207652_10118830 | Ga0207652_101188302 | 301 |
| 114 | 3300025922 | Ga0207646_10056330 | Ga0207646_100563303 | 301 |
| 115 | 3300025924 | Ga0207694_10090191 | Ga0207694_100901912 | 301 |
| 116 | 3300025926 | Ga0207659_10226482 | Ga0207659_102264822 | 301 |
| 117 | 3300025927 | Ga0207687_10067076 | Ga0207687_100670762 | 301 |
| 118 | 3300025929 | Ga0207664_10234462 | Ga0207664_102344622 | 301 |
| 119 | 3300025932 | Ga0207690_10100332 | Ga0207690_101003322 | 301 |
| 120 | 3300025932 | Ga0207690_10104894 | Ga0207690_101048942 | 301 |
| 121 | 3300025935 | Ga0207709_10098640 | Ga0207709_100986402 | 301 |
| 122 | 3300025938 | Ga0207704_10176442 | Ga0207704_101764422 | 301 |
| 123 | 3300025940 | Ga0207691_10019021 | Ga0207691_100190215 | 301 |
| 124 | 3300025944 | Ga0207661_10011376 | Ga0207661_100113765 | 301 |
| 125 | 3300025949 | Ga0207667_10007538 | Ga0207667_100075386 | 301 |
| 126 | 3300025961 | Ga0207712_10055902 | Ga0207712_100559023 | 301 |
| 127 | 3300026041 | Ga0207639_10009638 | Ga0207639_100096384 | 301 |
| 128 | 3300026067 | Ga0207678_10039941 | Ga0207678_100399413 | 301 |
| 129 | 3300026075 | Ga0207708_10060504 | Ga0207708_100605042 | 301 |
| 130 | 3300026116 | Ga0207674_10031482 | Ga0207674_100314823 | 301 |
| 131 | 3300026118 | Ga0207675_100038220 | Ga0207675_1000382204 | 301 |
| 132 | 3300026121 | Ga0207683_10042740 | Ga0207683_100427402 | 301 |
| 133 | 3300026142 | Ga0207698_10081343 | Ga0207698_100813432 | 301 |
| 134 | 3300026142 | Ga0207698_10172274 | Ga0207698_101722742 | 301 |
| 135 | 3300027907 | Ga0207428_10164272 | Ga0207428_101642722 | 301 |
| 136 | 3300033180 | Ga0307510_10004348 | Ga0307510_100043486 | 301 |
| 137 | 3300035113 | Ga0373936_0059575 | Ga0373936_0059575_537_1457 | 301 |
| 138 | 3300035170 | Ga0373943_0006580 | Ga0373943_0006580_1468_2388 | 301 |
| 139 | 3300035692 | Ga0373935_0000259 | Ga0373935_0000259_16376_17296 | 301 |
| 140 | 3300035695 | Ga0373927_0000339 | Ga0373927_0000339_35491_36411 | 301 |
| 141 | 3300035725 | Ga0373947_0000217 | Ga0373947_0000217_14342_15262 | 301 |
| 142 | 3300036401 | Ga0373937_0373348 | Ga0373937_0373348_134_1054 | 301 |
| 143 | 3300037068 | Ga0373925_0004501 | Ga0373925_0004501_6397_7317 | 301 |
| 144 | 3300037418 | Ga0395900_0445417 | Ga0395900_0445417_216_1142 | 301 |
| 145 | 3300037466 | Ga0395898_0160374 | Ga0395898_0160374_987_1913 | 301 |
| 146 | 3300039437 | Ga0436365_0023590 | Ga0436365_0023590_272_1189 | 301 |
| 147 | 3300039447 | Ga0436361_1121961 | Ga0436361_1121961_2825_3751 | 301 |
| 148 | 3300039450 | Ga0436363_0713686 | Ga0436363_0713686_530_1462 | 301 |
| 149 | 3300044735 | Ga0466968_0003374 | Ga0466968_0003374_2575_3501 | 301 |
| 150 | 3300045976 | Ga0466967_0499703 | Ga0466967_0499703_229_1155 | 301 |
| 151 | 3300046454 | Ga0495592_0045306 | Ga0495592_0045306_398_1318 | 301 |
| 152 | 3300046455 | Ga0495603_0000352 | Ga0495603_0000352_7687_8607 | 301 |
| 153 | 3300046459 | Ga0495629_0003719 | Ga0495629_0003719_6519_7439 | 301 |
| 154 | 3300046472 | Ga0495580_0062999 | Ga0495580_0062999_362_1282 | 301 |
| 155 | 3300046473 | Ga0495582_0000245 | Ga0495582_0000245_28484_29404 | 301 |
| 156 | 3300046474 | Ga0495605_0099169 | Ga0495605_0099169_33_953 | 301 |
| 157 | 3300046475 | Ga0495639_0001973 | Ga0495639_0001973_515_1435 | 301 |
| 158 | 3300046476 | Ga0495662_0000872 | Ga0495662_0000872_7396_8316 | 301 |
| 159 | 3300046477 | Ga0495664_0004666 | Ga0495664_0004666_5814_6734 | 301 |
| 160 | 3300046499 | Ga0495594_0001257 | Ga0495594_0001257_11921_12841 | 301 |
| 161 | 3300046517 | Ga0495630_0100139 | Ga0495630_0100139_536_1456 | 301 |
| 162 | 3300046526 | Ga0495666_0041105 | Ga0495666_0041105_1188_2108 | 301 |
| 163 | 3300046531 | Ga0495665_0000361 | Ga0495665_0000361_5481_6401 | 301 |
| 164 | 3300046533 | Ga0495640_0003002 | Ga0495640_0003002_5480_6400 | 301 |
| 165 | 3300046535 | Ga0495586_0055550 | Ga0495586_0055550_247_1170 | 301 |
| 166 | 3300046557 | Ga0495622_0006317 | Ga0495622_0006317_927_1847 | 301 |
| 167 | 3300046642 | Ga0495634_0000249 | Ga0495634_0000249_6991_7911 | 301 |
| 168 | 3300046663 | Ga0495635_0000239 | Ga0495635_0000239_4650_5570 | 301 |
| 169 | 3300046674 | Ga0495588_0003787 | Ga0495588_0003787_850_1770 | 301 |
| 170 | 3300046675 | Ga0495657_0212667 | Ga0495657_0212667_147_1067 | 301 |
| 171 | 3300046678 | Ga0495599_0081034 | Ga0495599_0081034_998_1918 | 301 |
| 172 | 3300046680 | Ga0495646_0005453 | Ga0495646_0005453_2188_3108 | 301 |
| 173 | 3300046681 | Ga0495647_0001674 | Ga0495647_0001674_5520_6440 | 301 |
| 174 | 3300046683 | Ga0495658_0001058 | Ga0495658_0001058_5648_6568 | 301 |
| 175 | 3300046689 | Ga0495613_0000929 | Ga0495613_0000929_15838_16758 | 301 |
| 176 | 3300047315 | Ga0495581_0001238 | Ga0495581_0001238_12480_13400 | 301 |
| 177 | 3300047319 | Ga0495674_0001854 | Ga0495674_0001854_12452_13372 | 301 |
| 178 | 3300047320 | Ga0495672_0086060 | Ga0495672_0086060_532_1452 | 301 |
| 179 | 3300047673 | Ga0495593_0000034 | Ga0495593_0000034_50935_51855 | 301 |
| 180 | 3300048089 | Ga0495614_0033292 | Ga0495614_0033292_384_1304 | 301 |
| 181 | 3300048903 | Ga0496100_0097700 | Ga0496100_0097700_491_1414 | 301 |
| 182 | 3300048917 | Ga0496114_0146345 | Ga0496114_0146345_567_1487 | 301 |
| 183 | 3300049570 | Ga0501033_0000951 | Ga0501033_0000951_19826_20746 | 301 |
| 184 | 3300049572 | Ga0501036_0198103 | Ga0501036_0198103_103_1023 | 301 |
| 185 | 3300049573 | Ga0501037_0004019 | Ga0501037_0004019_7956_8876 | 301 |
| 186 | 3300049573 | Ga0501037_0184260 | Ga0501037_0184260_265_1185 | 301 |
| 187 | 3300049574 | Ga0501038_0018478 | Ga0501038_0018478_641_1561 | 301 |
| 188 | 3300049574 | Ga0501038_0101530 | Ga0501038_0101530_1067_1987 | 301 |
| 189 | 3300049575 | Ga0501039_0049318 | Ga0501039_0049318_1049_1969 | 301 |
| 190 | 3300049579 | Ga0501043_0016672 | Ga0501043_0016672_1065_1985 | 301 |
| 191 | 3300049580 | Ga0501046_0029168 | Ga0501046_0029168_534_1454 | 301 |
| 192 | 3300049822 | Ga0501035_0140810 | Ga0501035_0140810_704_1624 | 301 |
| 193 | 3300049823 | Ga0501044_0071079 | Ga0501044_0071079_1274_2194 | 301 |
| 194 | 3300050507 | nmdc:mga05p37_272375_c1 | nmdc:mga05p37_272375_c1_277_1209 | 301 |
| 195 | 3300050509 | nmdc:mga0qj67_139930_c1 | nmdc:mga0qj67_139930_c1_464_1486 | 301 |
| 196 | 3300050509 | nmdc:mga0qj67_2593_c1 | nmdc:mga0qj67_2593_c1_561_1493 | 301 |
| 197 | 3300050510 | nmdc:mga06r32_121694_c1 | nmdc:mga06r32_121694_c1_1582_2514 | 301 |
| 198 | 3300050511 | nmdc:mga08y16_38717_c1 | nmdc:mga08y16_38717_c1_2320_3252 | 301 |
| 199 | 3300053096 | Ga0500641_0102935 | Ga0500641_0102935_143_1069 | 301 |
| 200 | 3300053104 | Ga0500556_0028955 | Ga0500556_0028955_232_1155 | 301 |
| 201 | 3300053119 | Ga0500595_003935 | Ga0500595_003935_3820_4743 | 301 |
| 202 | 3300061719 | Ga0466962_0161495 | Ga0466962_0161495_56_976 | 301 |
| 203 | iso_pu_bacteria | 2721755755 | 2723843078 | 301 |
| 204 | iso_pu_bacteria | 2791355199 | 2793079515 | 301 |
| 205 | iso_pu_bacteria | 2829745981 | 2829749747 | 301 |
| 206 | iso_pu_bacteria | 2842698319 | 2842702397 | 301 |
| 207 | iso_pu_bacteria | 2861691609 | 2861693456 | 301 |
| 208 | iso_pu_bacteria | 2876761206 | 2876762404 | 301 |
| 209 | iso_pu_bacteria | 643348564 | 643604994 | 301 |
| 210 | iso_pu_bacteria | 8006984368 | 8006989353 | 301 |
| 211 | iso_pu_bacteria | 8056673599 | 8056674869 | 301 |
| 212 | 3300005330 | Ga0070690_100240637 | Ga0070690_1002406372 | 302 |
| 213 | 3300005334 | Ga0068869_100055145 | Ga0068869_1000551451 | 302 |
| 214 | 3300005336 | Ga0070680_100003071 | Ga0070680_1000030718 | 302 |
| 215 | 3300005336 | Ga0070680_100063518 | Ga0070680_1000635182 | 302 |
| 216 | 3300005337 | Ga0070682_100005762 | Ga0070682_1000057622 | 302 |
| 217 | 3300005345 | Ga0070692_10118036 | Ga0070692_101180361 | 302 |
| 218 | 3300005406 | Ga0070703_10000738 | Ga0070703_100007383 | 302 |
| 219 | 3300005438 | Ga0070701_10003932 | Ga0070701_100039325 | 302 |
| 220 | 3300005438 | Ga0070701_10129740 | Ga0070701_101297401 | 302 |
| 221 | 3300005440 | Ga0070705_100001479 | Ga0070705_1000014793 | 302 |
| 222 | 3300005440 | Ga0070705_100050475 | Ga0070705_1000504752 | 302 |
| 223 | 3300005441 | Ga0070700_100012951 | Ga0070700_1000129514 | 302 |
| 224 | 3300005444 | Ga0070694_100126384 | Ga0070694_1001263842 | 302 |
| 225 | 3300005445 | Ga0070708_100061419 | Ga0070708_1000614193 | 302 |
| 226 | 3300005455 | Ga0070663_100003445 | Ga0070663_1000034457 | 302 |
| 227 | 3300005455 | Ga0070663_100090695 | Ga0070663_1000906952 | 302 |
| 228 | 3300005458 | Ga0070681_10000939 | Ga0070681_100009395 | 302 |
| 229 | 3300005458 | Ga0070681_10014733 | Ga0070681_100147335 | 302 |
| 230 | 3300005459 | Ga0068867_100156317 | Ga0068867_1001563171 | 302 |
| 231 | 3300005468 | Ga0070707_100034678 | Ga0070707_1000346785 | 302 |
| 232 | 3300005518 | Ga0070699_100001258 | Ga0070699_10000125811 | 302 |
| 233 | 3300005544 | Ga0070686_100040502 | Ga0070686_1000405022 | 302 |
| 234 | 3300005546 | Ga0070696_100000199 | Ga0070696_10000019926 | 302 |
| 235 | 3300005546 | Ga0070696_100044315 | Ga0070696_1000443152 | 302 |
| 236 | 3300005547 | Ga0070693_100002723 | Ga0070693_1000027237 | 302 |
| 237 | 3300005549 | Ga0070704_100001140 | Ga0070704_1000011407 | 302 |
| 238 | 3300005549 | Ga0070704_100081177 | Ga0070704_1000811771 | 302 |
| 239 | 3300005577 | Ga0068857_100010845 | Ga0068857_1000108452 | 302 |
| 240 | 3300005577 | Ga0068857_100085275 | Ga0068857_1000852753 | 302 |
| 241 | 3300005617 | Ga0068859_100195348 | Ga0068859_1001953482 | 302 |
| 242 | 3300005618 | Ga0068864_100013353 | Ga0068864_1000133535 | 302 |
| 243 | 3300005618 | Ga0068864_100326283 | Ga0068864_1003262831 | 302 |
| 244 | 3300005718 | Ga0068866_10011117 | Ga0068866_100111174 | 302 |
| 245 | 3300005719 | Ga0068861_100221076 | Ga0068861_1002210762 | 302 |
| 246 | 3300005840 | Ga0068870_10064936 | Ga0068870_100649362 | 302 |
| 247 | 3300005841 | Ga0068863_100139933 | Ga0068863_1001399332 | 302 |
| 248 | 3300005841 | Ga0068863_100386187 | Ga0068863_1003861872 | 302 |
| 249 | 3300005842 | Ga0068858_100118767 | Ga0068858_1001187672 | 302 |
| 250 | 3300005842 | Ga0068858_100209204 | Ga0068858_1002092042 | 302 |
| 251 | 3300005843 | Ga0068860_100012706 | Ga0068860_1000127065 | 302 |
| 252 | 3300005844 | Ga0068862_100004157 | Ga0068862_1000041578 | 302 |
| 253 | 3300005981 | Ga0081538_10114849 | Ga0081538_101148492 | 302 |
| 254 | 3300005983 | Ga0081540_1008498 | Ga0081540_10084983 | 302 |
| 255 | 3300005985 | Ga0081539_10043185 | Ga0081539_100431853 | 302 |
| 256 | 3300006038 | Ga0075365_10167966 | Ga0075365_101679661 | 302 |
| 257 | 3300006042 | Ga0075368_10002354 | Ga0075368_100023543 | 302 |
| 258 | 3300006048 | Ga0075363_100013015 | Ga0075363_1000130153 | 302 |
| 259 | 3300006163 | Ga0070715_10099577 | Ga0070715_100995772 | 302 |
| 260 | 3300006178 | Ga0075367_10027267 | Ga0075367_100272672 | 302 |
| 261 | 3300006358 | Ga0068871_100186662 | Ga0068871_1001866622 | 302 |
| 262 | 3300006844 | Ga0075428_100138493 | Ga0075428_1001384932 | 302 |
| 263 | 3300006846 | Ga0075430_100008098 | Ga0075430_1000080983 | 302 |
| 264 | 3300006847 | Ga0075431_100016133 | Ga0075431_1000161334 | 302 |
| 265 | 3300006871 | Ga0075434_100006094 | Ga0075434_1000060943 | 302 |
| 266 | 3300006880 | Ga0075429_100378431 | Ga0075429_1003784312 | 302 |
| 267 | 3300006881 | Ga0068865_100323847 | Ga0068865_1003238472 | 302 |
| 268 | 3300006931 | Ga0097620_100195348 | Ga0097620_1001953482 | 302 |
| 269 | 3300009094 | Ga0111539_10002984 | Ga0111539_1000298413 | 302 |
| 270 | 3300009094 | Ga0111539_10029331 | Ga0111539_100293312 | 302 |
| 271 | 3300009094 | Ga0111539_10472320 | Ga0111539_104723201 | 302 |
| 272 | 3300009101 | Ga0105247_10172977 | Ga0105247_101729772 | 302 |
| 273 | 3300009147 | Ga0114129_10006490 | Ga0114129_100064908 | 302 |
| 274 | 3300009147 | Ga0114129_10405923 | Ga0114129_104059232 | 302 |
| 275 | 3300009148 | Ga0105243_10059120 | Ga0105243_100591202 | 302 |
| 276 | 3300009174 | Ga0105241_10124317 | Ga0105241_101243172 | 302 |
| 277 | 3300009177 | Ga0105248_10344234 | Ga0105248_103442341 | 302 |
| 278 | 3300009545 | Ga0105237_10006667 | Ga0105237_100066675 | 302 |
| 279 | 3300009551 | Ga0105238_10056851 | Ga0105238_100568513 | 302 |
| 280 | 3300009553 | Ga0105249_10048959 | Ga0105249_100489592 | 302 |
| 281 | 3300011119 | Ga0105246_10012955 | Ga0105246_100129554 | 302 |
| 282 | 3300011119 | Ga0105246_10137577 | Ga0105246_101375772 | 302 |
| 283 | 3300013306 | Ga0163162_10329713 | Ga0163162_103297132 | 302 |
| 284 | 3300014326 | Ga0157380_10100365 | Ga0157380_101003653 | 302 |
| 285 | 3300014968 | Ga0157379_10034256 | Ga0157379_100342562 | 302 |
| 286 | 3300014968 | Ga0157379_10188887 | Ga0157379_101888872 | 302 |
| 287 | 3300014969 | Ga0157376_10125052 | Ga0157376_101250522 | 302 |
| 288 | 3300014969 | Ga0157376_10382186 | Ga0157376_103821862 | 302 |
| 289 | 3300017792 | Ga0163161_10006062 | Ga0163161_100060622 | 302 |
| 290 | 3300017792 | Ga0163161_10210100 | Ga0163161_102101001 | 302 |
| 291 | 3300025885 | Ga0207653_10001221 | Ga0207653_100012216 | 302 |
| 292 | 3300025908 | Ga0207643_10053536 | Ga0207643_100535362 | 302 |
| 293 | 3300025910 | Ga0207684_10063894 | Ga0207684_100638942 | 302 |
| 294 | 3300025911 | Ga0207654_10057474 | Ga0207654_100574742 | 302 |
| 295 | 3300025912 | Ga0207707_10021729 | Ga0207707_100217294 | 302 |
| 296 | 3300025912 | Ga0207707_10055109 | Ga0207707_100551093 | 302 |
| 297 | 3300025917 | Ga0207660_10044863 | Ga0207660_100448633 | 302 |
| 298 | 3300025917 | Ga0207660_10046845 | Ga0207660_100468453 | 302 |
| 299 | 3300025921 | Ga0207652_10019094 | Ga0207652_100190942 | 302 |
| 300 | 3300025922 | Ga0207646_10050170 | Ga0207646_100501702 | 302 |
| 301 | 3300025935 | Ga0207709_10189739 | Ga0207709_101897392 | 302 |
| 302 | 3300025940 | Ga0207691_10175841 | Ga0207691_101758412 | 302 |
| 303 | 3300025961 | Ga0207712_10103501 | Ga0207712_101035012 | 302 |
| 304 | 3300025972 | Ga0207668_10067997 | Ga0207668_100679972 | 302 |
| 305 | 3300026035 | Ga0207703_10232955 | Ga0207703_102329552 | 302 |
| 306 | 3300026067 | Ga0207678_10000635 | Ga0207678_1000063521 | 302 |
| 307 | 3300026075 | Ga0207708_10006325 | Ga0207708_100063254 | 302 |
| 308 | 3300026075 | Ga0207708_10043439 | Ga0207708_100434394 | 302 |
| 309 | 3300026075 | Ga0207708_10090745 | Ga0207708_100907452 | 302 |
| 310 | 3300026089 | Ga0207648_10171095 | Ga0207648_101710952 | 302 |
| 311 | 3300026089 | Ga0207648_10211581 | Ga0207648_102115812 | 302 |
| 312 | 3300026095 | Ga0207676_10009929 | Ga0207676_100099295 | 302 |
| 313 | 3300026116 | Ga0207674_10002969 | Ga0207674_1000296915 | 302 |
| 314 | 3300026118 | Ga0207675_100021202 | Ga0207675_1000212023 | 302 |
| 315 | 3300026118 | Ga0207675_100130678 | Ga0207675_1001306782 | 302 |
| 316 | 3300027866 | Ga0209813_10002124 | Ga0209813_100021242 | 302 |
| 317 | 3300027907 | Ga0207428_10003753 | Ga0207428_100037537 | 302 |
| 318 | 3300028380 | Ga0268265_10007628 | Ga0268265_100076286 | 302 |
| 319 | 3300028380 | Ga0268265_10100982 | Ga0268265_101009821 | 302 |
| 320 | 3300028380 | Ga0268265_10242537 | Ga0268265_102425371 | 302 |
| 321 | 3300028381 | Ga0268264_10003915 | Ga0268264_100039158 | 302 |
| 322 | 3300028381 | Ga0268264_10048635 | Ga0268264_100486352 | 302 |
| 323 | 3300028381 | Ga0268264_10427995 | Ga0268264_104279952 | 302 |
| 324 | 3300031824 | Ga0307413_10152447 | Ga0307413_101524471 | 302 |
| 325 | 3300033180 | Ga0307510_10176364 | Ga0307510_101763642 | 302 |
| 326 | 3300035115 | Ga0373941_0004480 | Ga0373941_0004480_1916_2881 | 302 |
| 327 | 3300035117 | Ga0373953_0007878 | Ga0373953_0007878_538_1503 | 302 |
| 328 | 3300035695 | Ga0373927_0106323 | Ga0373927_0106323_234_1202 | 302 |
| 329 | 3300037068 | Ga0373925_0248511 | Ga0373925_0248511_445_1413 | 302 |
| 330 | 3300038741 | Ga0400488_29404 | Ga0400488_29404_110_1057 | 302 |
| 331 | 3300046462 | Ga0495651_0183959 | Ga0495651_0183959_77_1042 | 302 |
| 332 | 3300048904 | Ga0496101_0008012 | Ga0496101_0008012_5181_6110 | 302 |
| 333 | 3300048904 | Ga0496101_0027240 | Ga0496101_0027240_2284_3267 | 302 |
| 334 | 3300048904 | Ga0496101_0050383 | Ga0496101_0050383_327_1313 | 302 |
| 335 | 3300048905 | Ga0496102_0019579 | Ga0496102_0019579_3919_4905 | 302 |
| 336 | 3300048905 | Ga0496102_0041385 | Ga0496102_0041385_1422_2351 | 302 |
| 337 | 3300048905 | Ga0496102_0043014 | Ga0496102_0043014_413_1435 | 302 |
| 338 | 3300048905 | Ga0496102_0136802 | Ga0496102_0136802_259_1224 | 302 |
| 339 | 3300048906 | Ga0496103_0140629 | Ga0496103_0140629_211_1194 | 302 |
| 340 | 3300048907 | Ga0496104_0000896 | Ga0496104_0000896_17747_18733 | 302 |
| 341 | 3300048907 | Ga0496104_0003861 | Ga0496104_0003861_2375_3328 | 302 |
| 342 | 3300048907 | Ga0496104_0012253 | Ga0496104_0012253_2508_3437 | 302 |
| 343 | 3300048907 | Ga0496104_0156641 | Ga0496104_0156641_887_1852 | 302 |
| 344 | 3300048908 | Ga0496105_0010634 | Ga0496105_0010634_5492_6445 | 302 |
| 345 | 3300048909 | Ga0496106_0018675 | Ga0496106_0018675_3814_4797 | 302 |
| 346 | 3300048909 | Ga0496106_0074183 | Ga0496106_0074183_1602_2534 | 302 |
| 347 | 3300048910 | Ga0496107_0007804 | Ga0496107_0007804_4589_5518 | 302 |
| 348 | 3300048910 | Ga0496107_0014980 | Ga0496107_0014980_460_1482 | 302 |
| 349 | 3300048911 | Ga0496108_0001756 | Ga0496108_0001756_5602_6555 | 302 |
| 350 | 3300048911 | Ga0496108_0022494 | Ga0496108_0022494_3375_4361 | 302 |
| 351 | 3300048911 | Ga0496108_0027953 | Ga0496108_0027953_2726_3691 | 302 |
| 352 | 3300048912 | Ga0496109_0007783 | Ga0496109_0007783_3719_4672 | 302 |
| 353 | 3300048912 | Ga0496109_0022983 | Ga0496109_0022983_525_1454 | 302 |
| 354 | 3300048913 | Ga0496110_0006306 | Ga0496110_0006306_3445_4398 | 302 |
| 355 | 3300048914 | Ga0496111_0039983 | Ga0496111_0039983_1429_2394 | 302 |
| 356 | 3300048914 | Ga0496111_0047425 | Ga0496111_0047425_514_1467 | 302 |
| 357 | 3300048914 | Ga0496111_0085829 | Ga0496111_0085829_250_1236 | 302 |
| 358 | 3300048915 | Ga0496112_0004975 | Ga0496112_0004975_9579_10544 | 302 |
| 359 | 3300048916 | Ga0496113_0006365 | Ga0496113_0006365_3760_4725 | 302 |
| 360 | 3300048916 | Ga0496113_0010550 | Ga0496113_0010550_1919_2872 | 302 |
| 361 | 3300048917 | Ga0496114_0021328 | Ga0496114_0021328_412_1341 | 302 |
| 362 | 3300048918 | Ga0496115_0004097 | Ga0496115_0004097_8514_9500 | 302 |
| 363 | 3300048918 | Ga0496115_0006428 | Ga0496115_0006428_4303_5286 | 302 |
| 364 | 3300048922 | Ga0496119_0006190 | Ga0496119_0006190_9871_10794 | 302 |
| 365 | 3300048925 | Ga0496122_0004307 | Ga0496122_0004307_15483_16406 | 302 |
| 366 | 3300048926 | Ga0496123_0001264 | Ga0496123_0001264_100_1023 | 302 |
| 367 | 3300048927 | Ga0496124_0021627 | Ga0496124_0021627_4289_5254 | 302 |
| 368 | 3300049569 | Ga0501032_0005003 | Ga0501032_0005003_4359_5336 | 302 |
| 369 | 3300049569 | Ga0501032_0148701 | Ga0501032_0148701_550_1530 | 302 |
| 370 | 3300049571 | Ga0501034_0000068 | Ga0501034_0000068_128776_129753 | 302 |
| 371 | 3300049571 | Ga0501034_0122200 | Ga0501034_0122200_42_1022 | 302 |
| 372 | 3300049572 | Ga0501036_0073052 | Ga0501036_0073052_583_1560 | 302 |
| 373 | 3300049573 | Ga0501037_0014308 | Ga0501037_0014308_3450_4427 | 302 |
| 374 | 3300049575 | Ga0501039_0000138 | Ga0501039_0000138_11531_12508 | 302 |
| 375 | 3300049577 | Ga0501041_0138617 | Ga0501041_0138617_154_1116 | 302 |
| 376 | 3300049578 | Ga0501042_0113757 | Ga0501042_0113757_145_1110 | 302 |
| 377 | 3300049580 | Ga0501046_0000246 | Ga0501046_0000246_5351_6322 | 302 |
| 378 | 3300049580 | Ga0501046_0001138 | Ga0501046_0001138_20102_21079 | 302 |
| 379 | 3300049580 | Ga0501046_0009035 | Ga0501046_0009035_2609_3589 | 302 |
| 380 | 3300049580 | Ga0501046_0099067 | Ga0501046_0099067_1248_2222 | 302 |
| 381 | 3300049581 | Ga0501047_0000873 | Ga0501047_0000873_20678_21655 | 302 |
| 382 | 3300049581 | Ga0501047_0045210 | Ga0501047_0045210_292_1272 | 302 |
| 383 | 3300049581 | Ga0501047_0047475 | Ga0501047_0047475_525_1505 | 302 |
| 384 | 3300049581 | Ga0501047_0241804 | Ga0501047_0241804_259_1236 | 302 |
| 385 | 3300049582 | Ga0501048_0003772 | Ga0501048_0003772_1566_2534 | 302 |
| 386 | 3300049583 | Ga0501067_0000720 | Ga0501067_0000720_16001_16978 | 302 |
| 387 | 3300049583 | Ga0501067_0002784 | Ga0501067_0002784_4738_5715 | 302 |
| 388 | 3300049585 | Ga0501069_0095720 | Ga0501069_0095720_320_1282 | 302 |
| 389 | 3300049586 | Ga0501070_0018079 | Ga0501070_0018079_3997_4974 | 302 |
| 390 | 3300049586 | Ga0501070_0128627 | Ga0501070_0128627_131_1108 | 302 |
| 391 | 3300049587 | Ga0501071_0135895 | Ga0501071_0135895_400_1362 | 302 |
| 392 | 3300049589 | Ga0501073_0035793 | Ga0501073_0035793_1707_2684 | 302 |
| 393 | 3300049589 | Ga0501073_0052011 | Ga0501073_0052011_1160_2125 | 302 |
| 394 | 3300049590 | Ga0501074_0008973 | Ga0501074_0008973_2496_3458 | 302 |
| 395 | 3300049593 | Ga0501077_0072055 | Ga0501077_0072055_1097_2062 | 302 |
| 396 | 3300049593 | Ga0501077_0097586 | Ga0501077_0097586_173_1135 | 302 |
| 397 | 3300049742 | Ga0501080_0000001 | Ga0501080_0000001_227546_228523 | 302 |
| 398 | 3300049822 | Ga0501035_0000015 | Ga0501035_0000015_63419_64396 | 302 |
| 399 | 3300049822 | Ga0501035_0223043 | Ga0501035_0223043_285_1262 | 302 |
| 400 | 3300049823 | Ga0501044_0000026 | Ga0501044_0000026_96823_97800 | 302 |
| 401 | 3300049823 | Ga0501044_0088879 | Ga0501044_0088879_2001_2960 | 302 |
| 402 | 3300049823 | Ga0501044_0137160 | Ga0501044_0137160_1325_2305 | 302 |
| 403 | 3300049824 | Ga0501045_0057189 | Ga0501045_0057189_14_982 | 302 |
| 404 | 3300049824 | Ga0501045_0154905 | Ga0501045_0154905_375_1352 | 302 |
| 405 | 3300050492 | nmdc:mga0yw44_82060_c1 | nmdc:mga0yw44_82060_c1_769_1722 | 302 |
| 406 | 3300050494 | nmdc:mga06z11_10108_c1 | nmdc:mga06z11_10108_c1_1060_2049 | 302 |
| 407 | 3300050507 | nmdc:mga05p37_104104_c1 | nmdc:mga05p37_104104_c1_2166_3131 | 302 |
| 408 | 3300050508 | nmdc:mga09592_140460_c1 | nmdc:mga09592_140460_c1_430_1386 | 302 |
| 409 | 3300050509 | nmdc:mga0qj67_101136_c1 | nmdc:mga0qj67_101136_c1_753_1709 | 302 |
| 410 | 3300050510 | nmdc:mga06r32_122065_c1 | nmdc:mga06r32_122065_c1_1157_2113 | 302 |
| 411 | 3300050510 | nmdc:mga06r32_171466_c1 | nmdc:mga06r32_171466_c1_823_1779 | 302 |
| 412 | 3300050510 | nmdc:mga06r32_207291_c1 | nmdc:mga06r32_207291_c1_97_1065 | 302 |
| 413 | 3300050511 | nmdc:mga08y16_29966_c1 | nmdc:mga08y16_29966_c1_4557_5522 | 302 |
| 414 | 3300050511 | nmdc:mga08y16_4688_c1 | nmdc:mga08y16_4688_c1_5957_6925 | 302 |
| 415 | 3300050512 | nmdc:mga0n895_4339_c1 | nmdc:mga0n895_4339_c1_2204_3172 | 302 |
| 416 | 3300050513 | nmdc:mga0rr50_206727_c1 | nmdc:mga0rr50_206727_c1_87_1055 | 302 |
| 417 | 3300053104 | Ga0500556_0000880 | Ga0500556_0000880_11900_12865 | 302 |
| 418 | 3300053104 | Ga0500556_0005856 | Ga0500556_0005856_1048_1971 | 302 |
| 419 | 3300053119 | Ga0500595_030317 | Ga0500595_030317_603_1583 | 302 |
| 420 | 3300053730 | Ga0500645_001299 | Ga0500645_001299_11578_12501 | 302 |
| 421 | 3300053730 | Ga0500645_048969 | Ga0500645_048969_189_1154 | 302 |
| 422 | 3300061734 | Ga0530510_0013419 | Ga0530510_0013419_4328_5296 | 302 |
| 423 | 3300061734 | Ga0530510_0080532 | Ga0530510_0080532_55_1017 | 302 |
| 424 | 3300035695 | Ga0373927_0016655 | Ga0373927_0016655_1475_2413 | 304 |
| 425 | 3300053150 | Ga0500603_000277 | Ga0500603_000277_5002_5970 | 305 |
| 426 | 3300005327 | Ga0070658_10134984 | Ga0070658_101349842 | 306 |
| 427 | 3300005328 | Ga0070676_10001181 | Ga0070676_100011819 | 306 |
| 428 | 3300005329 | Ga0070683_100067788 | Ga0070683_1000677882 | 306 |
| 429 | 3300005330 | Ga0070690_100000545 | Ga0070690_1000005455 | 306 |
| 430 | 3300005331 | Ga0070670_100005981 | Ga0070670_1000059818 | 306 |
| 431 | 3300005334 | Ga0068869_100091465 | Ga0068869_1000914651 | 306 |
| 432 | 3300005335 | Ga0070666_10004683 | Ga0070666_100046836 | 306 |
| 433 | 3300005337 | Ga0070682_100010119 | Ga0070682_1000101194 | 306 |
| 434 | 3300005338 | Ga0068868_100072838 | Ga0068868_1000728382 | 306 |
| 435 | 3300005339 | Ga0070660_100004348 | Ga0070660_1000043485 | 306 |
| 436 | 3300005340 | Ga0070689_100001025 | Ga0070689_1000010257 | 306 |
| 437 | 3300005341 | Ga0070691_10000109 | Ga0070691_1000010914 | 306 |
| 438 | 3300005343 | Ga0070687_100001058 | Ga0070687_1000010585 | 306 |
| 439 | 3300005344 | Ga0070661_100010613 | Ga0070661_1000106135 | 306 |
| 440 | 3300005347 | Ga0070668_100000323 | Ga0070668_1000003238 | 306 |
| 441 | 3300005353 | Ga0070669_100015233 | Ga0070669_1000152332 | 306 |
| 442 | 3300005354 | Ga0070675_100001821 | Ga0070675_1000018219 | 306 |
| 443 | 3300005355 | Ga0070671_100001054 | Ga0070671_10000105418 | 306 |
| 444 | 3300005356 | Ga0070674_100000932 | Ga0070674_1000009322 | 306 |
| 445 | 3300005364 | Ga0070673_100001383 | Ga0070673_1000013835 | 306 |
| 446 | 3300005365 | Ga0070688_100000138 | Ga0070688_10000013819 | 306 |
| 447 | 3300005366 | Ga0070659_100000915 | Ga0070659_1000009158 | 306 |
| 448 | 3300005367 | Ga0070667_100002638 | Ga0070667_1000026385 | 306 |
| 449 | 3300005367 | Ga0070667_100312877 | Ga0070667_1003128771 | 306 |
| 450 | 3300005406 | Ga0070703_10015964 | Ga0070703_100159642 | 306 |
| 451 | 3300005434 | Ga0070709_10000884 | Ga0070709_100008844 | 306 |
| 452 | 3300005435 | Ga0070714_100110855 | Ga0070714_1001108552 | 306 |
| 453 | 3300005438 | Ga0070701_10001670 | Ga0070701_100016705 | 306 |
| 454 | 3300005441 | Ga0070700_100000877 | Ga0070700_1000008774 | 306 |
| 455 | 3300005441 | Ga0070700_100161296 | Ga0070700_1001612962 | 306 |
| 456 | 3300005444 | Ga0070694_100000159 | Ga0070694_10000015914 | 306 |
| 457 | 3300005455 | Ga0070663_100001241 | Ga0070663_1000012415 | 306 |
| 458 | 3300005456 | Ga0070678_100001723 | Ga0070678_1000017239 | 306 |
| 459 | 3300005456 | Ga0070678_100237942 | Ga0070678_1002379422 | 306 |
| 460 | 3300005457 | Ga0070662_100002638 | Ga0070662_1000026384 | 306 |
| 461 | 3300005457 | Ga0070662_100293407 | Ga0070662_1002934072 | 306 |
| 462 | 3300005458 | Ga0070681_10015319 | Ga0070681_100153193 | 306 |
| 463 | 3300005459 | Ga0068867_100090121 | Ga0068867_1000901212 | 306 |
| 464 | 3300005466 | Ga0070685_10002967 | Ga0070685_100029673 | 306 |
| 465 | 3300005518 | Ga0070699_100455596 | Ga0070699_1004555962 | 306 |
| 466 | 3300005530 | Ga0070679_100047103 | Ga0070679_1000471031 | 306 |
| 467 | 3300005535 | Ga0070684_100011323 | Ga0070684_1000113234 | 306 |
| 468 | 3300005536 | Ga0070697_100017448 | Ga0070697_1000174483 | 306 |
| 469 | 3300005539 | Ga0068853_100000477 | Ga0068853_10000047713 | 306 |
| 470 | 3300005543 | Ga0070672_100003489 | Ga0070672_1000034898 | 306 |
| 471 | 3300005544 | Ga0070686_100005159 | Ga0070686_1000051592 | 306 |
| 472 | 3300005545 | Ga0070695_100001605 | Ga0070695_1000016054 | 306 |
| 473 | 3300005546 | Ga0070696_100001417 | Ga0070696_1000014179 | 306 |
| 474 | 3300005547 | Ga0070693_100000188 | Ga0070693_10000018811 | 306 |
| 475 | 3300005548 | Ga0070665_100006048 | Ga0070665_1000060487 | 306 |
| 476 | 3300005549 | Ga0070704_100000534 | Ga0070704_1000005346 | 306 |
| 477 | 3300005563 | Ga0068855_100002324 | Ga0068855_10000232423 | 306 |
| 478 | 3300005564 | Ga0070664_100030975 | Ga0070664_1000309754 | 306 |
| 479 | 3300005578 | Ga0068854_100060234 | Ga0068854_1000602342 | 306 |
| 480 | 3300005614 | Ga0068856_100001302 | Ga0068856_10000130212 | 306 |
| 481 | 3300005615 | Ga0070702_100000205 | Ga0070702_10000020515 | 306 |
| 482 | 3300005617 | Ga0068859_100002806 | Ga0068859_10000280612 | 306 |
| 483 | 3300005618 | Ga0068864_100004194 | Ga0068864_1000041945 | 306 |
| 484 | 3300005718 | Ga0068866_10030357 | Ga0068866_100303572 | 306 |
| 485 | 3300005719 | Ga0068861_100000196 | Ga0068861_10000019616 | 306 |
| 486 | 3300005841 | Ga0068863_100022888 | Ga0068863_1000228884 | 306 |
| 487 | 3300005842 | Ga0068858_100001779 | Ga0068858_10000177916 | 306 |
| 488 | 3300005842 | Ga0068858_100024420 | Ga0068858_1000244202 | 306 |
| 489 | 3300005843 | Ga0068860_100000872 | Ga0068860_1000008728 | 306 |
| 490 | 3300005844 | Ga0068862_100002619 | Ga0068862_1000026192 | 306 |
| 491 | 3300005937 | Ga0081455_10002009 | Ga0081455_100020099 | 306 |
| 492 | 3300006038 | Ga0075365_10022286 | Ga0075365_100222862 | 306 |
| 493 | 3300006048 | Ga0075363_100061813 | Ga0075363_1000618132 | 306 |
| 494 | 3300006051 | Ga0075364_10001857 | Ga0075364_1000185711 | 306 |
| 495 | 3300006163 | Ga0070715_10000410 | Ga0070715_100004105 | 306 |
| 496 | 3300006173 | Ga0070716_100002026 | Ga0070716_1000020266 | 306 |
| 497 | 3300006175 | Ga0070712_100010253 | Ga0070712_1000102533 | 306 |
| 498 | 3300006178 | Ga0075367_10007598 | Ga0075367_100075985 | 306 |
| 499 | 3300006237 | Ga0097621_100021184 | Ga0097621_1000211844 | 306 |
| 500 | 3300006358 | Ga0068871_100065695 | Ga0068871_1000656953 | 306 |
| 501 | 3300006358 | Ga0068871_100093790 | Ga0068871_1000937902 | 306 |
| 502 | 3300006844 | Ga0075428_100006002 | Ga0075428_1000060024 | 306 |
| 503 | 3300006844 | Ga0075428_100235198 | Ga0075428_1002351982 | 306 |
| 504 | 3300006847 | Ga0075431_100098618 | Ga0075431_1000986183 | 306 |
| 505 | 3300006880 | Ga0075429_100013543 | Ga0075429_1000135432 | 306 |
| 506 | 3300006881 | Ga0068865_100001326 | Ga0068865_1000013267 | 306 |
| 507 | 3300006914 | Ga0075436_100037850 | Ga0075436_1000378502 | 306 |
| 508 | 3300006931 | Ga0097620_100002806 | Ga0097620_10000280612 | 306 |
| 509 | 3300007076 | Ga0075435_100045719 | Ga0075435_1000457193 | 306 |
| 510 | 3300009036 | Ga0105244_10032109 | Ga0105244_100321093 | 306 |
| 511 | 3300009092 | Ga0105250_10005666 | Ga0105250_100056662 | 306 |
| 512 | 3300009093 | Ga0105240_10020968 | Ga0105240_100209682 | 306 |
| 513 | 3300009098 | Ga0105245_10001489 | Ga0105245_1000148914 | 306 |
| 514 | 3300009101 | Ga0105247_10002044 | Ga0105247_100020448 | 306 |
| 515 | 3300009101 | Ga0105247_10084000 | Ga0105247_100840002 | 306 |
| 516 | 3300009147 | Ga0114129_10115511 | Ga0114129_101155113 | 306 |
| 517 | 3300009147 | Ga0114129_10342191 | Ga0114129_103421912 | 306 |
| 518 | 3300009148 | Ga0105243_10002388 | Ga0105243_1000238811 | 306 |
| 519 | 3300009148 | Ga0105243_10058138 | Ga0105243_100581383 | 306 |
| 520 | 3300009174 | Ga0105241_10006466 | Ga0105241_100064662 | 306 |
| 521 | 3300009177 | Ga0105248_10001500 | Ga0105248_1000150018 | 306 |
| 522 | 3300009177 | Ga0105248_10036884 | Ga0105248_100368844 | 306 |
| 523 | 3300009545 | Ga0105237_10002959 | Ga0105237_1000295914 | 306 |
| 524 | 3300009553 | Ga0105249_10000775 | Ga0105249_100007754 | 306 |
| 525 | 3300009553 | Ga0105249_10005964 | Ga0105249_100059648 | 306 |
| 526 | 3300010375 | Ga0105239_10056224 | Ga0105239_100562242 | 306 |
| 527 | 3300011119 | Ga0105246_10001892 | Ga0105246_100018925 | 306 |
| 528 | 3300013102 | Ga0157371_10006736 | Ga0157371_100067367 | 306 |
| 529 | 3300013105 | Ga0157369_10006271 | Ga0157369_100062713 | 306 |
| 530 | 3300013297 | Ga0157378_10002206 | Ga0157378_1000220614 | 306 |
| 531 | 3300013297 | Ga0157378_10069630 | Ga0157378_100696301 | 306 |
| 532 | 3300013306 | Ga0163162_10002752 | Ga0163162_100027521 | 306 |
| 533 | 3300013308 | Ga0157375_10003722 | Ga0157375_100037228 | 306 |
| 534 | 3300013308 | Ga0157375_10004209 | Ga0157375_100042095 | 306 |
| 535 | 3300013308 | Ga0157375_10308030 | Ga0157375_103080302 | 306 |
| 536 | 3300014326 | Ga0157380_10141486 | Ga0157380_101414862 | 306 |
| 537 | 3300014326 | Ga0157380_10476500 | Ga0157380_104765001 | 306 |
| 538 | 3300014968 | Ga0157379_10092823 | Ga0157379_100928233 | 306 |
| 539 | 3300014969 | Ga0157376_10000823 | Ga0157376_1000082318 | 306 |
| 540 | 3300014969 | Ga0157376_10011387 | Ga0157376_100113875 | 306 |
| 541 | 3300025899 | Ga0207642_10002770 | Ga0207642_100027702 | 306 |
| 542 | 3300025900 | Ga0207710_10001172 | Ga0207710_100011725 | 306 |
| 543 | 3300025900 | Ga0207710_10062342 | Ga0207710_100623422 | 306 |
| 544 | 3300025901 | Ga0207688_10005595 | Ga0207688_100055955 | 306 |
| 545 | 3300025903 | Ga0207680_10004778 | Ga0207680_100047782 | 306 |
| 546 | 3300025905 | Ga0207685_10000332 | Ga0207685_100003324 | 306 |
| 547 | 3300025906 | Ga0207699_10001135 | Ga0207699_100011359 | 306 |
| 548 | 3300025907 | Ga0207645_10005698 | Ga0207645_100056983 | 306 |
| 549 | 3300025909 | Ga0207705_10279722 | Ga0207705_102797222 | 306 |
| 550 | 3300025911 | Ga0207654_10032096 | Ga0207654_100320962 | 306 |
| 551 | 3300025912 | Ga0207707_10020800 | Ga0207707_100208003 | 306 |
| 552 | 3300025913 | Ga0207695_10060681 | Ga0207695_100606813 | 306 |
| 553 | 3300025914 | Ga0207671_10015825 | Ga0207671_100158253 | 306 |
| 554 | 3300025915 | Ga0207693_10000313 | Ga0207693_1000031311 | 306 |
| 555 | 3300025915 | Ga0207693_10031514 | Ga0207693_100315142 | 306 |
| 556 | 3300025915 | Ga0207693_10099806 | Ga0207693_100998062 | 306 |
| 557 | 3300025918 | Ga0207662_10013266 | Ga0207662_100132664 | 306 |
| 558 | 3300025919 | Ga0207657_10000112 | Ga0207657_1000011218 | 306 |
| 559 | 3300025926 | Ga0207659_10010412 | Ga0207659_100104124 | 306 |
| 560 | 3300025927 | Ga0207687_10004391 | Ga0207687_100043915 | 306 |
| 561 | 3300025929 | Ga0207664_10106423 | Ga0207664_101064232 | 306 |
| 562 | 3300025932 | Ga0207690_10002166 | Ga0207690_100021669 | 306 |
| 563 | 3300025933 | Ga0207706_10000831 | Ga0207706_100008319 | 306 |
| 564 | 3300025934 | Ga0207686_10004856 | Ga0207686_100048565 | 306 |
| 565 | 3300025938 | Ga0207704_10008196 | Ga0207704_100081962 | 306 |
| 566 | 3300025939 | Ga0207665_10000565 | Ga0207665_1000056515 | 306 |
| 567 | 3300025940 | Ga0207691_10000623 | Ga0207691_1000062319 | 306 |
| 568 | 3300025941 | Ga0207711_10007904 | Ga0207711_100079042 | 306 |
| 569 | 3300025944 | Ga0207661_10087609 | Ga0207661_100876092 | 306 |
| 570 | 3300025945 | Ga0207679_10009793 | Ga0207679_100097934 | 306 |
| 571 | 3300025949 | Ga0207667_10083775 | Ga0207667_100837753 | 306 |
| 572 | 3300025960 | Ga0207651_10018895 | Ga0207651_100188953 | 306 |
| 573 | 3300025981 | Ga0207640_10004101 | Ga0207640_100041013 | 306 |
| 574 | 3300025986 | Ga0207658_10039058 | Ga0207658_100390583 | 306 |
| 575 | 3300026023 | Ga0207677_10072886 | Ga0207677_100728862 | 306 |
| 576 | 3300026035 | Ga0207703_10015420 | Ga0207703_100154202 | 306 |
| 577 | 3300026067 | Ga0207678_10000086 | Ga0207678_1000008613 | 306 |
| 578 | 3300026075 | Ga0207708_10000858 | Ga0207708_1000085818 | 306 |
| 579 | 3300026088 | Ga0207641_10043891 | Ga0207641_100438912 | 306 |
| 580 | 3300026089 | Ga0207648_10065450 | Ga0207648_100654502 | 306 |
| 581 | 3300026095 | Ga0207676_10034688 | Ga0207676_100346882 | 306 |
| 582 | 3300026116 | Ga0207674_10003298 | Ga0207674_1000329818 | 306 |
| 583 | 3300026118 | Ga0207675_100000111 | Ga0207675_10000011142 | 306 |
| 584 | 3300026121 | Ga0207683_10000120 | Ga0207683_1000012035 | 306 |
| 585 | 3300026142 | Ga0207698_10007677 | Ga0207698_100076772 | 306 |
| 586 | 3300027717 | Ga0209998_10014548 | Ga0209998_100145482 | 306 |
| 587 | 3300027876 | Ga0209974_10044999 | Ga0209974_100449992 | 306 |
| 588 | 3300027907 | Ga0207428_10042572 | Ga0207428_100425722 | 306 |
| 589 | 3300028379 | Ga0268266_10033432 | Ga0268266_100334324 | 306 |
| 590 | 3300028381 | Ga0268264_10050991 | Ga0268264_100509913 | 306 |
| 591 | 3300028381 | Ga0268264_10051331 | Ga0268264_100513311 | 306 |
| 592 | 3300031665 | Ga0316575_10069424 | Ga0316575_100694241 | 306 |
| 593 | 3300031691 | Ga0316579_10017334 | Ga0316579_100173342 | 306 |
| 594 | 3300031728 | Ga0316578_10072659 | Ga0316578_100726592 | 306 |
| 595 | 3300031733 | Ga0316577_10005671 | Ga0316577_100056714 | 306 |
| 596 | 3300032133 | Ga0316583_10002017 | Ga0316583_100020174 | 306 |
| 597 | 3300032137 | Ga0316585_10000782 | Ga0316585_100007822 | 306 |
| 598 | 3300032139 | Ga0316580_10063379 | Ga0316580_100633792 | 306 |
| 599 | 3300034820 | Ga0373959_0007799 | Ga0373959_0007799_353_1273 | 306 |
| 600 | 3300035091 | Ga0373951_0003799 | Ga0373951_0003799_1903_2823 | 306 |
| 601 | 3300035112 | Ga0373932_0026249 | Ga0373932_0026249_55_975 | 306 |
| 602 | 3300035114 | Ga0373939_0000816 | Ga0373939_0000816_108_1028 | 306 |
| 603 | 3300035171 | Ga0373946_0001327 | Ga0373946_0001327_7065_7985 | 306 |
| 604 | 3300035242 | Ga0373962_0022926 | Ga0373962_0022926_99_1019 | 306 |
| 605 | 3300035398 | Ga0316574_0016545 | Ga0316574_0016545_3107_4027 | 306 |
| 606 | 3300035691 | Ga0373931_0010450 | Ga0373931_0010450_1208_2128 | 306 |
| 607 | 3300035692 | Ga0373935_0096150 | Ga0373935_0096150_79_999 | 306 |
| 608 | 3300035725 | Ga0373947_0003875 | Ga0373947_0003875_3093_4013 | 306 |
| 609 | 3300036712 | Ga0316584_0035110 | Ga0316584_0035110_168_1088 | 306 |
| 610 | 3300037068 | Ga0373925_0004411 | Ga0373925_0004411_8378_9298 | 306 |
| 611 | 3300037418 | Ga0395900_0038434 | Ga0395900_0038434_3294_4214 | 306 |
| 612 | 3300037466 | Ga0395898_0027692 | Ga0395898_0027692_1582_2502 | 306 |
| 613 | 3300037471 | Ga0395905_0002147 | Ga0395905_0002147_5385_6305 | 306 |
| 614 | 3300037588 | Ga0316581_0000762 | Ga0316581_0000762_206_1126 | 306 |
| 615 | 3300046455 | Ga0495603_0000690 | Ga0495603_0000690_8024_8944 | 306 |
| 616 | 3300046461 | Ga0495641_0019556 | Ga0495641_0019556_989_1909 | 306 |
| 617 | 3300046472 | Ga0495580_0036111 | Ga0495580_0036111_861_1781 | 306 |
| 618 | 3300046473 | Ga0495582_0002379 | Ga0495582_0002379_1678_2598 | 306 |
| 619 | 3300046475 | Ga0495639_0009977 | Ga0495639_0009977_1786_2706 | 306 |
| 620 | 3300046476 | Ga0495662_0173474 | Ga0495662_0173474_76_996 | 306 |
| 621 | 3300046499 | Ga0495594_0004267 | Ga0495594_0004267_1737_2657 | 306 |
| 622 | 3300046526 | Ga0495666_0005612 | Ga0495666_0005612_4191_5111 | 306 |
| 623 | 3300046557 | Ga0495622_0005361 | Ga0495622_0005361_1773_2693 | 306 |
| 624 | 3300046642 | Ga0495634_0027901 | Ga0495634_0027901_1785_2705 | 306 |
| 625 | 3300046663 | Ga0495635_0035103 | Ga0495635_0035103_1314_2234 | 306 |
| 626 | 3300046674 | Ga0495588_0000969 | Ga0495588_0000969_7696_8616 | 306 |
| 627 | 3300046681 | Ga0495647_0006037 | Ga0495647_0006037_1380_2300 | 306 |
| 628 | 3300046683 | Ga0495658_0000894 | Ga0495658_0000894_9552_10472 | 306 |
| 629 | 3300046690 | Ga0495624_0029524 | Ga0495624_0029524_719_1639 | 306 |
| 630 | 3300047315 | Ga0495581_0009037 | Ga0495581_0009037_3923_4843 | 306 |
| 631 | 3300047321 | Ga0495676_0006581 | Ga0495676_0006581_9647_10567 | 306 |
| 632 | 3300047673 | Ga0495593_0003109 | Ga0495593_0003109_2540_3460 | 306 |
| 633 | 3300048903 | Ga0496100_0014301 | Ga0496100_0014301_3432_4352 | 306 |
| 634 | 3300048903 | Ga0496100_0036866 | Ga0496100_0036866_1347_2267 | 306 |
| 635 | 3300048903 | Ga0496100_0077437 | Ga0496100_0077437_480_1496 | 306 |
| 636 | 3300048903 | Ga0496100_0334359 | Ga0496100_0334359_140_1060 | 306 |
| 637 | 3300048904 | Ga0496101_0004744 | Ga0496101_0004744_6222_7142 | 306 |
| 638 | 3300048904 | Ga0496101_0016183 | Ga0496101_0016183_3422_4342 | 306 |
| 639 | 3300048905 | Ga0496102_0041393 | Ga0496102_0041393_992_1912 | 306 |
| 640 | 3300048905 | Ga0496102_0097661 | Ga0496102_0097661_821_1741 | 306 |
| 641 | 3300048905 | Ga0496102_0160435 | Ga0496102_0160435_808_1728 | 306 |
| 642 | 3300048906 | Ga0496103_0021847 | Ga0496103_0021847_11_931 | 306 |
| 643 | 3300048907 | Ga0496104_0047777 | Ga0496104_0047777_256_1176 | 306 |
| 644 | 3300048907 | Ga0496104_0067013 | Ga0496104_0067013_1669_2589 | 306 |
| 645 | 3300048907 | Ga0496104_0110524 | Ga0496104_0110524_905_1921 | 306 |
| 646 | 3300048907 | Ga0496104_0473218 | Ga0496104_0473218_149_1069 | 306 |
| 647 | 3300048908 | Ga0496105_0003076 | Ga0496105_0003076_6782_7702 | 306 |
| 648 | 3300048908 | Ga0496105_0060224 | Ga0496105_0060224_1877_2797 | 306 |
| 649 | 3300048908 | Ga0496105_0267914 | Ga0496105_0267914_394_1314 | 306 |
| 650 | 3300048909 | Ga0496106_0003602 | Ga0496106_0003602_5350_6270 | 306 |
| 651 | 3300048909 | Ga0496106_0056783 | Ga0496106_0056783_693_1613 | 306 |
| 652 | 3300048910 | Ga0496107_0000864 | Ga0496107_0000864_11624_12544 | 306 |
| 653 | 3300048910 | Ga0496107_0002347 | Ga0496107_0002347_7315_8331 | 306 |
| 654 | 3300048910 | Ga0496107_0042076 | Ga0496107_0042076_693_1613 | 306 |
| 655 | 3300048911 | Ga0496108_0052743 | Ga0496108_0052743_1669_2589 | 306 |
| 656 | 3300048911 | Ga0496108_0080436 | Ga0496108_0080436_455_1375 | 306 |
| 657 | 3300048912 | Ga0496109_0089084 | Ga0496109_0089084_1112_2032 | 306 |
| 658 | 3300048912 | Ga0496109_0104497 | Ga0496109_0104497_949_1869 | 306 |
| 659 | 3300048915 | Ga0496112_0033821 | Ga0496112_0033821_2817_3737 | 306 |
| 660 | 3300048917 | Ga0496114_0006801 | Ga0496114_0006801_1576_2496 | 306 |
| 661 | 3300048918 | Ga0496115_0008945 | Ga0496115_0008945_5031_5951 | 306 |
| 662 | 3300048918 | Ga0496115_0080950 | Ga0496115_0080950_693_1613 | 306 |
| 663 | 3300049572 | Ga0501036_0215419 | Ga0501036_0215419_374_1294 | 306 |
| 664 | 3300049574 | Ga0501038_0121078 | Ga0501038_0121078_349_1269 | 306 |
| 665 | 3300049575 | Ga0501039_0071747 | Ga0501039_0071747_1460_2380 | 306 |
| 666 | 3300049576 | Ga0501040_0018623 | Ga0501040_0018623_358_1278 | 306 |
| 667 | 3300049576 | Ga0501040_0245199 | Ga0501040_0245199_204_1124 | 306 |
| 668 | 3300049578 | Ga0501042_0054738 | Ga0501042_0054738_1173_2093 | 306 |
| 669 | 3300049580 | Ga0501046_0033104 | Ga0501046_0033104_2359_3279 | 306 |
| 670 | 3300049582 | Ga0501048_0025718 | Ga0501048_0025718_3116_4036 | 306 |
| 671 | 3300049582 | Ga0501048_0096937 | Ga0501048_0096937_894_1814 | 306 |
| 672 | 3300049582 | Ga0501048_0111950 | Ga0501048_0111950_490_1518 | 306 |
| 673 | 3300049584 | Ga0501068_0093350 | Ga0501068_0093350_22_942 | 306 |
| 674 | 3300049585 | Ga0501069_0120888 | Ga0501069_0120888_501_1421 | 306 |
| 675 | 3300049588 | Ga0501072_0047056 | Ga0501072_0047056_1083_2030 | 306 |
| 676 | 3300049588 | Ga0501072_0078433 | Ga0501072_0078433_857_1777 | 306 |
| 677 | 3300049588 | Ga0501072_0082658 | Ga0501072_0082658_1391_2311 | 306 |
| 678 | 3300049588 | Ga0501072_0149359 | Ga0501072_0149359_82_1002 | 306 |
| 679 | 3300049590 | Ga0501074_0090284 | Ga0501074_0090284_481_1401 | 306 |
| 680 | 3300049590 | Ga0501074_0179244 | Ga0501074_0179244_75_995 | 306 |
| 681 | 3300049591 | Ga0501075_0023749 | Ga0501075_0023749_1349_2269 | 306 |
| 682 | 3300049592 | Ga0501076_0017141 | Ga0501076_0017141_2119_3039 | 306 |
| 683 | 3300049592 | Ga0501076_0201687 | Ga0501076_0201687_255_1175 | 306 |
| 684 | 3300049593 | Ga0501077_0013027 | Ga0501077_0013027_373_1293 | 306 |
| 685 | 3300049593 | Ga0501077_0018697 | Ga0501077_0018697_1847_2767 | 306 |
| 686 | 3300049593 | Ga0501077_0024533 | Ga0501077_0024533_895_1827 | 306 |
| 687 | 3300049593 | Ga0501077_0102564 | Ga0501077_0102564_157_1089 | 306 |
| 688 | 3300049741 | Ga0501079_0496256 | Ga0501079_0496256_28_948 | 306 |
| 689 | 3300049742 | Ga0501080_0218400 | Ga0501080_0218400_565_1485 | 306 |
| 690 | 3300049742 | Ga0501080_0277943 | Ga0501080_0277943_202_1122 | 306 |
| 691 | 3300049743 | Ga0501081_0064699 | Ga0501081_0064699_1215_2135 | 306 |
| 692 | 3300049743 | Ga0501081_0077345 | Ga0501081_0077345_388_1320 | 306 |
| 693 | 3300049744 | Ga0501083_0093525 | Ga0501083_0093525_127_1047 | 306 |
| 694 | 3300049822 | Ga0501035_0123163 | Ga0501035_0123163_318_1238 | 306 |
| 695 | 3300049824 | Ga0501045_0215720 | Ga0501045_0215720_19_939 | 306 |
| 696 | 3300050490 | nmdc:mga03n38_4892_c1 | nmdc:mga03n38_4892_c1_200_1306 | 306 |
| 697 | 3300050492 | nmdc:mga0yw44_6754_c1 | nmdc:mga0yw44_6754_c1_3115_4236 | 306 |
| 698 | 3300050494 | nmdc:mga06z11_2473_c1 | nmdc:mga06z11_2473_c1_5434_6540 | 306 |
| 699 | 3300050494 | nmdc:mga06z11_5316_c1 | nmdc:mga06z11_5316_c1_1718_2839 | 306 |
| 700 | 3300050508 | nmdc:mga09592_86312_c1 | nmdc:mga09592_86312_c1_1151_2071 | 306 |
| 701 | 3300050509 | nmdc:mga0qj67_5024_c1 | nmdc:mga0qj67_5024_c1_5781_6785 | 306 |
| 702 | 3300050510 | nmdc:mga06r32_158391_c1 | nmdc:mga06r32_158391_c1_1010_1930 | 306 |
| 703 | 3300050510 | nmdc:mga06r32_171925_c1 | nmdc:mga06r32_171925_c1_643_1563 | 306 |
| 704 | 3300050510 | nmdc:mga06r32_194225_c1 | nmdc:mga06r32_194225_c1_594_1598 | 306 |
| 705 | 3300050514 | nmdc:mga08x19_122731_c1 | nmdc:mga08x19_122731_c1_580_1500 | 306 |
| 706 | 3300050515 | nmdc:mga0a205_15593_c1 | nmdc:mga0a205_15593_c1_1925_2845 | 306 |
| 707 | 3300050515 | nmdc:mga0a205_172290_c1 | nmdc:mga0a205_172290_c1_895_1842 | 306 |
| 708 | 3300053077 | Ga0495601_0003880 | Ga0495601_0003880_1794_2747 | 306 |
| 709 | 3300053085 | Ga0495619_0000737 | Ga0495619_0000737_9393_10313 | 306 |
| 710 | 3300054114 | Ga0501084_0048092 | Ga0501084_0048092_555_1475 | 306 |
| 711 | 3300054114 | Ga0501084_0138192 | Ga0501084_0138192_846_1766 | 306 |
| 712 | 3300054114 | Ga0501084_0182300 | Ga0501084_0182300_400_1347 | 306 |
| 713 | 3300060353 | Ga0501082_0011098 | Ga0501082_0011098_838_1770 | 306 |
| 714 | 3300060353 | Ga0501082_0069173 | Ga0501082_0069173_1657_2577 | 306 |
| 715 | 3300060353 | Ga0501082_0106698 | Ga0501082_0106698_266_1186 | 306 |
| 716 | 3300060353 | Ga0501082_0180095 | Ga0501082_0180095_833_1753 | 306 |
| 717 | 3300061734 | Ga0530510_0007129 | Ga0530510_0007129_2673_3641 | 306 |
| 718 | 3300061734 | Ga0530510_0039774 | Ga0530510_0039774_1246_2193 | 306 |
| 719 | 3300061734 | Ga0530510_0072416 | Ga0530510_0072416_190_1110 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hsk-assembly1.cif.gz_A | crystal structure of s. aureus murb | 0.935 | 4 | 306 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9309 | 10 | 306 |
| 1hsk-assembly1.cif.gz_A | crystal structure of s. aureus murb | 0.9291 | 4 | 306 |
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.9272 | 8 | 304 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9249 | 10 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9838 | 227 | 306 | 3.90.78.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9409 | 93 | 219 | 3.30.465.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9268 | 93 | 219 | 3.30.465.10 |
| 3tx1A02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9261 | 93 | 219 | 3.30.465.10 |
| 3tx1A02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.919 | 93 | 219 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9YWJ8-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase | 0.9938 | 227 | 304 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
| AF-A0A442AS35-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate dehydrogenase) | 0.9937 | 103 | 202 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
| AF-A0A3N5RV35-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase | 0.9846 | 227 | 304 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
| AF-A0A845ZPU9-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein | 0.9784 | 227 | 300 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0050660 GO:0051301 GO:0071555 |
| AF-A0A0M9GQ79-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9711 | 2 | 306 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar