F477255

General Info

Members Datasets Scaffolds Average Seq Length
719 336 1438 335

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_095319|Ga0400483_095319_25782_26927
Length 381
Sequence MSWGFPCLIIVISVRIAYRTIFLMSQKMVFAIVWVRRCIIRAQSIQKEVFMSQWYLSYDGNPLGPFDYAQAVAQTRKNPNGYAWREGFAEWLPIGQISDLAPLEKPLPQAPPAARALVSDEIDFRIIGTEMQFVEVELDPGESAVAEAGAMMYKDAGVVMQTVFGDGSASTGGGFMDKLLGAGKRLLTGESLFMTVFSHTGDGKARVAFGAPYPGNIIPVHLNKFGGMLICQKDSFLCAAKGVAMGIYFQRKILTGLFGGEGFIMQKLEGDGLVFLHAGGTVADRTLSAGEVLHVDTGCIVAMEPSVQFEIEKAGGIKSALFGGEGLFFAKLLGPGKVWLQSLPFSRLAGRMLQAAPQRGGSKGEGSVLGALGGLLDGDNR

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
182 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
194 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
195 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
196 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
197 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
198 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
199 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
200 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
201 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
202 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
208 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
209 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
210 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
310 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
311 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
312 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
313 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
314 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
315 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
316 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
317 2818991457 Xanthomonas translucens 569 Isolate Unclassified
318 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
319 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
320 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
321 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
322 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
323 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
324 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
325 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
326 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
327 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
328 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
329 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
330 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
331 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
332 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
333 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
334 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
335 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
336 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0.14
Rhizoplane 0.56
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_095319 3300039062 Bacteria 29855
2 JGI24735J21928_10025197 3300002067 Bacteria 1796
3 JGI25152J39213_1000004 3300002773 Bacteria 191383
4 JGI25150J39212_1000491 3300002774 Bacteria 16611
5 JGI25151J46595_10000010 3300003187 Bacteria 277507
6 JGI25406J46586_10000294 3300003203 Bacteria 22402
7 JGI25406J46586_10000986 3300003203 Bacteria 13371
8 JGI25406J46586_10047026 3300003203 Bacteria 1473
9 JGI25153J46596_10000013 3300003215 Bacteria 303690
10 rootH2_10006882 3300003320 Bacteria 14761
11 rootH2_10081097 3300003320 Bacteria 7715
12 Ga0058692_1000005 3300003856 Bacteria 398815
13 Ga0065704_10071755 3300005289 Bacteria 10011
14 Ga0065712_10002276 3300005290 Bacteria 8803
15 Ga0065712_10017397 3300005290 Bacteria 1884
16 Ga0065715_10002535 3300005293 Bacteria 6357
17 Ga0070658_10129513 3300005327 Bacteria 2102
18 Ga0070676_10002232 3300005328 Bacteria 9885
19 Ga0070676_10036458 3300005328 Bacteria 2833
20 Ga0070690_100010170 3300005330 Bacteria 5465
21 Ga0070690_100021642 3300005330 Bacteria 3927
22 Ga0070670_100000644 3300005331 Bacteria 27141
23 Ga0070670_100001817 3300005331 Bacteria 17382
24 Ga0070670_100008954 3300005331 Bacteria 8551
25 Ga0070670_100026149 3300005331 Bacteria 5024
26 Ga0070670_100398406 3300005331 Bacteria 1215
27 Ga0070677_10016106 3300005333 Bacteria 2658
28 Ga0068869_100002035 3300005334 Bacteria 12146
29 Ga0068869_100003931 3300005334 Bacteria 9175
30 Ga0068869_100150836 3300005334 Bacteria 1803
31 Ga0070666_10049270 3300005335 Bacteria 2830
32 Ga0070680_100193619 3300005336 Bacteria 1714
33 Ga0070682_100039242 3300005337 Bacteria 2909
34 Ga0068868_100025104 3300005338 Bacteria 4527
35 Ga0068868_100119137 3300005338 Bacteria 2152
36 Ga0070689_100084992 3300005340 Bacteria 2487
37 Ga0070689_100212372 3300005340 Bacteria 1584
38 Ga0070687_100008498 3300005343 Bacteria 4355
39 Ga0070661_100199438 3300005344 Bacteria 1528
40 Ga0070668_100003349 3300005347 Bacteria 11818
41 Ga0070668_100077132 3300005347 Bacteria 2605
42 Ga0070669_100005634 3300005353 Bacteria 9043
43 Ga0070669_100029791 3300005353 Bacteria 3937
44 Ga0070669_100157854 3300005353 Bacteria 1760
45 Ga0070669_100243530 3300005353 Bacteria 1429
46 Ga0070675_100000344 3300005354 Bacteria 31386
47 Ga0070675_100002958 3300005354 Bacteria 12818
48 Ga0070675_100016192 3300005354 Bacteria 5913
49 Ga0070675_100018904 3300005354 Bacteria 5488
50 Ga0070675_100038145 3300005354 Bacteria 3915
51 Ga0070675_100054701 3300005354 Bacteria 3284
52 Ga0070675_100193098 3300005354 Bacteria 1765
53 Ga0070671_100064039 3300005355 Bacteria 3062
54 Ga0070671_100268597 3300005355 Bacteria 1450
55 Ga0070674_100000032 3300005356 Bacteria 64311
56 Ga0070674_100162426 3300005356 Unclassified 1696
57 Ga0070673_100004841 3300005364 Bacteria 8564
58 Ga0070673_100009483 3300005364 Bacteria 6534
59 Ga0070673_100175811 3300005364 Bacteria 1830
60 Ga0070688_100010886 3300005365 Bacteria 5034
61 Ga0070688_100023939 3300005365 Bacteria 3597
62 Ga0070688_100159250 3300005365 Bacteria 1550
63 Ga0070688_100162898 3300005365 Bacteria 1533
64 Ga0070659_100064651 3300005366 Bacteria 2896
65 Ga0070667_100008279 3300005367 Bacteria 8618
66 Ga0070667_100302339 3300005367 Bacteria 1441
67 Ga0070701_10063569 3300005438 Bacteria 1953
68 Ga0070701_10106746 3300005438 Bacteria 1559
69 Ga0070705_100153615 3300005440 Bacteria 1530
70 Ga0070700_100027345 3300005441 Bacteria 3381
71 Ga0070700_100068639 3300005441 Bacteria 2255
72 Ga0070700_100073272 3300005441 Bacteria 2192
73 Ga0070663_100044112 3300005455 Bacteria 3142
74 Ga0070678_100040275 3300005456 Bacteria 3305
75 Ga0070678_100081651 3300005456 Bacteria 2451
76 Ga0070678_100090289 3300005456 Bacteria 2347
77 Ga0070678_100205211 3300005456 Bacteria 1629
78 Ga0070678_100223793 3300005456 Bacteria 1565
79 Ga0070678_100248042 3300005456 Bacteria 1492
80 Ga0070662_100123610 3300005457 Bacteria 1986
81 Ga0070662_100214688 3300005457 Bacteria 1532
82 Ga0068867_100000578 3300005459 Bacteria 24270
83 Ga0068867_100051430 3300005459 Bacteria 3039
84 Ga0068867_100094451 3300005459 Bacteria 2274
85 Ga0070685_10009160 3300005466 Bacteria 5109
86 Ga0070685_10009810 3300005466 Bacteria 4965
87 Ga0070685_10304684 3300005466 Bacteria 1075
88 Ga0070706_100027284 3300005467 Bacteria 5255
89 Ga0070698_100002958 3300005471 Bacteria 18692
90 Ga0070698_100043831 3300005471 Bacteria 4585
91 Ga0070698_100354640 3300005471 Bacteria 1399
92 Ga0070699_100053104 3300005518 Bacteria 3508
93 Ga0070699_100237449 3300005518 Bacteria 1626
94 Ga0068853_100003732 3300005539 Bacteria 11684
95 Ga0068853_100225609 3300005539 Bacteria 1712
96 Ga0070672_100009427 3300005543 Bacteria 6728
97 Ga0070672_100015081 3300005543 Bacteria 5493
98 Ga0070672_100068226 3300005543 Bacteria 2820
99 Ga0070672_100083505 3300005543 Bacteria 2563
100 Ga0070672_100104221 3300005543 Bacteria 2304
101 Ga0070672_100188067 3300005543 Bacteria 1723
102 Ga0070686_100013664 3300005544 Bacteria 4656
103 Ga0070686_100167420 3300005544 Bacteria 1552
104 Ga0070695_100005599 3300005545 Bacteria 7398
105 Ga0070696_100101253 3300005546 Bacteria 2064
106 Ga0070665_100000417 3300005548 Bacteria 62091
107 Ga0070665_100093849 3300005548 Bacteria 3006
108 Ga0070665_100132700 3300005548 Bacteria 2492
109 Ga0070704_100074238 3300005549 Bacteria 2480
110 Ga0070704_100177471 3300005549 Bacteria 1700
111 Ga0068855_100294240 3300005563 Bacteria 1799
112 Ga0070664_100005128 3300005564 Bacteria 10517
113 Ga0070664_100040079 3300005564 Bacteria 3948
114 Ga0070664_100044735 3300005564 Bacteria 3738
115 Ga0070664_100078015 3300005564 Bacteria 2849
116 Ga0068854_100229420 3300005578 Bacteria 1473
117 Ga0068852_100409083 3300005616 Bacteria 1336
118 Ga0068859_100006708 3300005617 Bacteria 11694
119 Ga0068859_100078804 3300005617 Bacteria 3335
120 Ga0068859_100123928 3300005617 Bacteria 2652
121 Ga0068864_100027300 3300005618 Bacteria 4820
122 Ga0068864_100100025 3300005618 Bacteria 2570
123 Ga0068864_100138443 3300005618 Bacteria 2194
124 Ga0068864_100326655 3300005618 Bacteria 1442
125 Ga0068866_10056893 3300005718 Bacteria 2013
126 Ga0068861_100064991 3300005719 Bacteria 2808
127 Ga0068870_10015656 3300005840 Bacteria 3604
128 Ga0068870_10016802 3300005840 Bacteria 3505
129 Ga0068863_100016001 3300005841 Bacteria 7193
130 Ga0068863_100441691 3300005841 Bacteria 1276
131 Ga0068858_100023552 3300005842 Bacteria 5735
132 Ga0068858_100077956 3300005842 Bacteria 3079
133 Ga0068858_100324155 3300005842 Bacteria 1473
134 Ga0068860_100057807 3300005843 Bacteria 3687
135 Ga0068860_100108586 3300005843 Bacteria 2652
136 Ga0068862_100031342 3300005844 Bacteria 4487
137 Ga0081538_10050621 3300005981 Bacteria 2505
138 Ga0081539_10000013 3300005985 Bacteria 432395
139 Ga0081539_10000164 3300005985 Bacteria 154639
140 Ga0081539_10000750 3300005985 Bacteria 64517
141 Ga0081539_10038985 3300005985 Bacteria 2809
142 Ga0081539_10046258 3300005985 Bacteria 2495
143 Ga0075368_10070091 3300006042 Bacteria 1415
144 Ga0075364_10000276 3300006051 Bacteria 25091
145 Ga0075364_10158675 3300006051 Bacteria 1526
146 Ga0075366_10071524 3300006195 Bacteria 2066
147 Ga0097621_100117885 3300006237 Bacteria 2250
148 Ga0068871_100231017 3300006358 Bacteria 1605
149 Ga0068871_100334160 3300006358 Bacteria 1337
150 Ga0075428_100000166 3300006844 Bacteria 60871
151 Ga0075428_100015404 3300006844 Bacteria 8476
152 Ga0075428_100027849 3300006844 Bacteria 6252
153 Ga0075428_100083995 3300006844 Bacteria 3474
154 Ga0075428_100151426 3300006844 Bacteria 2520
155 Ga0075428_100256995 3300006844 Bacteria 1882
156 Ga0075430_100000691 3300006846 Bacteria 25696
157 Ga0075430_100054231 3300006846 Bacteria 3374
158 Ga0075430_100162716 3300006846 Bacteria 1858
159 Ga0075430_100173774 3300006846 Bacteria 1792
160 Ga0075430_100354721 3300006846 Bacteria 1211
161 Ga0075431_100001885 3300006847 Bacteria 19887
162 Ga0075431_100044479 3300006847 Bacteria 4580
163 Ga0075431_100066473 3300006847 Bacteria 3722
164 Ga0075431_100131410 3300006847 Bacteria 2582
165 Ga0075431_100179135 3300006847 Bacteria 2175
166 Ga0075431_100181072 3300006847 Bacteria 2163
167 Ga0075431_100389367 3300006847 Bacteria 1396
168 Ga0075433_10000037 3300006852 Bacteria 53492
169 Ga0075433_10001456 3300006852 Bacteria 17484
170 Ga0075433_10005012 3300006852 Bacteria 10372
171 Ga0075434_100000596 3300006871 Bacteria 27926
172 Ga0075434_100003672 3300006871 Bacteria 13714
173 Ga0075434_100027168 3300006871 Bacteria 5616
174 Ga0075429_100048999 3300006880 Bacteria 3673
175 Ga0075429_100062312 3300006880 Bacteria 3249
176 Ga0075429_100107600 3300006880 Bacteria 2437
177 Ga0075429_100250915 3300006880 Bacteria 1550
178 Ga0075429_100285745 3300006880 Bacteria 1444
179 Ga0068865_100001886 3300006881 Bacteria 12325
180 Ga0068865_100105016 3300006881 Bacteria 2074
181 Ga0068865_100215622 3300006881 Bacteria 1498
182 Ga0097620_100006708 3300006931 Bacteria 11694
183 Ga0097620_100078802 3300006931 Bacteria 3335
184 Ga0097620_100123925 3300006931 Bacteria 2652
185 Ga0075435_100016436 3300007076 Bacteria 5580
186 Ga0075435_100040676 3300007076 Bacteria 3713
187 Ga0075435_100201026 3300007076 Bacteria 1689
188 Ga0105244_10003455 3300009036 Bacteria 11260
189 Ga0105244_10023804 3300009036 Bacteria 3352
190 Ga0111539_10000417 3300009094 Bacteria 53293
191 Ga0111539_10002191 3300009094 Bacteria 26074
192 Ga0111539_10002820 3300009094 Bacteria 23099
193 Ga0111539_10004794 3300009094 Bacteria 17647
194 Ga0111539_10007840 3300009094 Bacteria 13638
195 Ga0111539_10015750 3300009094 Bacteria 9394
196 Ga0111539_10027136 3300009094 Bacteria 6993
197 Ga0111539_10033958 3300009094 Bacteria 6190
198 Ga0111539_10042748 3300009094 Bacteria 5439
199 Ga0111539_10077166 3300009094 Bacteria 3921
200 Ga0111539_10162823 3300009094 Bacteria 2609
201 Ga0105247_10002389 3300009101 Bacteria 12765
202 Ga0114129_10009591 3300009147 Bacteria 13809
203 Ga0114129_10034123 3300009147 Bacteria 7187
204 Ga0114129_10048306 3300009147 Bacteria 5979
205 Ga0114129_10076433 3300009147 Bacteria 4662
206 Ga0114129_10116587 3300009147 Bacteria 3680
207 Ga0114129_10267423 3300009147 Bacteria 2289
208 Ga0114129_10695544 3300009147 Bacteria 1307
209 Ga0105243_10015475 3300009148 Bacteria 5765
210 Ga0105241_10000371 3300009174 Bacteria 34199
211 Ga0105241_10098597 3300009174 Bacteria 2319
212 Ga0105248_10111233 3300009177 Bacteria 3089
213 Ga0105237_10007492 3300009545 Bacteria 11935
214 Ga0105238_10013627 3300009551 Bacteria 8212
215 Ga0105238_10115595 3300009551 Bacteria 2662
216 Ga0105238_10181197 3300009551 Bacteria 2083
217 Ga0105249_10007783 3300009553 Bacteria 9337
218 Ga0105249_10009765 3300009553 Bacteria 8407
219 Ga0105249_10015866 3300009553 Bacteria 6676
220 Ga0105249_10147327 3300009553 Bacteria 2263
221 Ga0105239_10250089 3300010375 Bacteria 1991
222 Ga0105246_10231957 3300011119 Bacteria 1454
223 Ga0157370_10103954 3300013104 Bacteria 2659
224 Ga0163162_10019877 3300013306 Bacteria 6595
225 Ga0163162_10308366 3300013306 Unclassified 1715
226 Ga0157372_10119169 3300013307 Bacteria 3029
227 Ga0157375_10042900 3300013308 Bacteria 4382
228 Ga0157375_10477908 3300013308 Bacteria 1411
229 Ga0163163_10207110 3300014325 Bacteria 2010
230 Ga0157380_10000799 3300014326 Bacteria 19789
231 Ga0157380_10005869 3300014326 Bacteria 8590
232 Ga0182008_10000083 3300014497 Bacteria 73635
233 Ga0157377_10001309 3300014745 Bacteria 10654
234 Ga0157379_10058700 3300014968 Bacteria 3441
235 Ga0157379_10093480 3300014968 Bacteria 2698
236 Ga0183369_1013 3300015685 Bacteria 222738
237 Ga0163161_10007719 3300017792 Bacteria 7442
238 Ga0163161_10017406 3300017792 Bacteria 5029
239 Ga0163161_10183547 3300017792 Bacteria 1605
240 Ga0207425_1000015 3300025245 Bacteria 466368
241 Ga0209129_1000074 3300025258 Bacteria 205648
242 Ga0209676_1000104 3300025292 Bacteria 226581
243 Ga0209025_1000002 3300025294 Bacteria 1393142
244 Ga0209758_1000003 3300025297 Bacteria 1398533
245 Ga0209050_1038650 3300025298 Bacteria 1357
246 Ga0207697_10002637 3300025315 Bacteria 9195
247 Ga0207655_1003689 3300025728 Bacteria 11283
248 Ga0207655_1035463 3300025728 Bacteria 2226
249 Ga0207653_10020057 3300025885 Bacteria 2113
250 Ga0207682_10001038 3300025893 Bacteria 12802
251 Ga0207682_10073052 3300025893 Bacteria 1456
252 Ga0207682_10078534 3300025893 Bacteria 1410
253 Ga0207642_10044334 3300025899 Bacteria 1968
254 Ga0207688_10007643 3300025901 Bacteria 5886
255 Ga0207645_10000611 3300025907 Bacteria 29564
256 Ga0207645_10005408 3300025907 Bacteria 9262
257 Ga0207643_10000068 3300025908 Bacteria 69282
258 Ga0207643_10002433 3300025908 Bacteria 10070
259 Ga0207643_10047403 3300025908 Bacteria 2431
260 Ga0207705_10264858 3300025909 Bacteria 1313
261 Ga0207660_10080772 3300025917 Bacteria 2388
262 Ga0207662_10009971 3300025918 Bacteria 5242
263 Ga0207649_10166394 3300025920 Bacteria 1532
264 Ga0207681_10004748 3300025923 Bacteria 8360
265 Ga0207681_10079435 3300025923 Bacteria 2311
266 Ga0207681_10100840 3300025923 Bacteria 2082
267 Ga0207681_10108179 3300025923 Bacteria 2018
268 Ga0207694_10003531 3300025924 Bacteria 12413
269 Ga0207694_10011457 3300025924 Bacteria 6692
270 Ga0207694_10015837 3300025924 Bacteria 5687
271 Ga0207650_10009832 3300025925 Bacteria 6543
272 Ga0207650_10014393 3300025925 Bacteria 5498
273 Ga0207650_10046351 3300025925 Bacteria 3201
274 Ga0207650_10361400 3300025925 Bacteria 1196
275 Ga0207659_10000353 3300025926 Bacteria 27408
276 Ga0207659_10002915 3300025926 Bacteria 10188
277 Ga0207659_10003941 3300025926 Bacteria 8960
278 Ga0207659_10009215 3300025926 Bacteria 6166
279 Ga0207659_10011872 3300025926 Bacteria 5518
280 Ga0207659_10056571 3300025926 Bacteria 2810
281 Ga0207659_10193622 3300025926 Bacteria 1619
282 Ga0207659_10300465 3300025926 Bacteria 1318
283 Ga0207687_10040448 3300025927 Bacteria 3196
284 Ga0207687_10318467 3300025927 Bacteria 1258
285 Ga0207644_10051921 3300025931 Bacteria 2945
286 Ga0207644_10064505 3300025931 Bacteria 2661
287 Ga0207644_10141485 3300025931 Bacteria 1853
288 Ga0207690_10009308 3300025932 Bacteria 5836
289 Ga0207706_10008244 3300025933 Bacteria 9613
290 Ga0207706_10052029 3300025933 Bacteria 3616
291 Ga0207706_10138031 3300025933 Bacteria 2145
292 Ga0207706_10167026 3300025933 Bacteria 1934
293 Ga0207709_10000954 3300025935 Bacteria 21622
294 Ga0207709_10004516 3300025935 Bacteria 8024
295 Ga0207670_10057930 3300025936 Bacteria 2630
296 Ga0207670_10114634 3300025936 Bacteria 1948
297 Ga0207669_10000642 3300025937 Bacteria 15113
298 Ga0207704_10002632 3300025938 Bacteria 8101
299 Ga0207691_10003313 3300025940 Bacteria 15693
300 Ga0207691_10011105 3300025940 Bacteria 8646
301 Ga0207691_10033132 3300025940 Bacteria 4812
302 Ga0207691_10042552 3300025940 Bacteria 4187
303 Ga0207691_10059555 3300025940 Bacteria 3472
304 Ga0207691_10256827 3300025940 Bacteria 1507
305 Ga0207711_10054368 3300025941 Bacteria 3436
306 Ga0207689_10000219 3300025942 Bacteria 50693
307 Ga0207689_10002433 3300025942 Bacteria 17334
308 Ga0207689_10043379 3300025942 Bacteria 3718
309 Ga0207689_10107077 3300025942 Bacteria 2297
310 Ga0207689_10118812 3300025942 Bacteria 2174
311 Ga0207679_10013441 3300025945 Bacteria 5368
312 Ga0207679_10064008 3300025945 Bacteria 2747
313 Ga0207679_10104385 3300025945 Bacteria 2224
314 Ga0207679_10168820 3300025945 Bacteria 1799
315 Ga0207679_10298136 3300025945 Bacteria 1388
316 Ga0207679_10303437 3300025945 Bacteria 1377
317 Ga0207667_10068982 3300025949 Bacteria 3680
318 Ga0207651_10000813 3300025960 Bacteria 13454
319 Ga0207651_10012886 3300025960 Bacteria 4755
320 Ga0207651_10091094 3300025960 Bacteria 2231
321 Ga0207651_10411410 3300025960 Bacteria 1152
322 Ga0207712_10007668 3300025961 Bacteria 6825
323 Ga0207668_10013679 3300025972 Bacteria 5006
324 Ga0207668_10222610 3300025972 Bacteria 1516
325 Ga0207640_10143130 3300025981 Bacteria 1746
326 Ga0207658_10011784 3300025986 Bacteria 5956
327 Ga0207677_10068506 3300026023 Bacteria 2491
328 Ga0207703_10060611 3300026035 Bacteria 3095
329 Ga0207703_10271081 3300026035 Bacteria 1537
330 Ga0207639_10001388 3300026041 Bacteria 16358
331 Ga0207678_10064681 3300026067 Bacteria 3142
332 Ga0207708_10015509 3300026075 Bacteria 5715
333 Ga0207708_10015853 3300026075 Bacteria 5657
334 Ga0207708_10102955 3300026075 Bacteria 2211
335 Ga0207641_10091615 3300026088 Bacteria 2660
336 Ga0207641_10098826 3300026088 Bacteria 2567
337 Ga0207648_10001252 3300026089 Bacteria 28387
338 Ga0207648_10178439 3300026089 Bacteria 1879
339 Ga0207676_10025450 3300026095 Bacteria 4391
340 Ga0207676_10121225 3300026095 Bacteria 2206
341 Ga0207676_10173795 3300026095 Bacteria 1879
342 Ga0207676_10409490 3300026095 Bacteria 1269
343 Ga0207674_10152404 3300026116 Bacteria 2268
344 Ga0207675_100088473 3300026118 Bacteria 2909
345 Ga0207683_10033861 3300026121 Bacteria 4439
346 Ga0207683_10037554 3300026121 Bacteria 4218
347 Ga0207683_10038335 3300026121 Bacteria 4176
348 Ga0207683_10065501 3300026121 Bacteria 3204
349 Ga0207683_10318098 3300026121 Bacteria 1425
350 Ga0209371_1000031 3300027312 Bacteria 399263
351 Ga0209974_10018478 3300027876 Bacteria 2313
352 Ga0207428_10000444 3300027907 Bacteria 50619
353 Ga0207428_10003654 3300027907 Bacteria 14827
354 Ga0207428_10019347 3300027907 Bacteria 5806
355 Ga0207428_10024118 3300027907 Bacteria 5108
356 Ga0207428_10028854 3300027907 Bacteria 4605
357 Ga0207428_10033872 3300027907 Bacteria 4190
358 Ga0207428_10061782 3300027907 Bacteria 2964
359 Ga0207428_10094480 3300027907 Bacteria 2318
360 Ga0268266_10000646 3300028379 Bacteria 47334
361 Ga0268266_10000688 3300028379 Bacteria 45589
362 Ga0268266_10071310 3300028379 Bacteria 3011
363 Ga0268264_10041798 3300028381 Bacteria 3793
364 Ga0268264_10304043 3300028381 Bacteria 1502
365 Ga0268256_1000034 3300030500 Bacteria 398909
366 Ga0316176_1036236 3300030732 Bacteria 2719
367 Ga0307408_100026796 3300031548 Bacteria 3964
368 Ga0307408_100249465 3300031548 Bacteria 1463
369 Ga0307408_100256067 3300031548 Bacteria 1446
370 Ga0316575_10004403 3300031665 Bacteria 4957
371 Ga0316575_10051417 3300031665 Bacteria 1641
372 Ga0316579_10009229 3300031691 Bacteria 4143
373 Ga0316579_10109556 3300031691 Bacteria 1325
374 Ga0316576_10001606 3300031727 Bacteria 12342
375 Ga0316576_10003024 3300031727 Bacteria 9771
376 Ga0316576_10003307 3300031727 Bacteria 9411
377 Ga0316576_10007410 3300031727 Bacteria 6912
378 Ga0316576_10007966 3300031727 Bacteria 6711
379 Ga0316576_10040530 3300031727 Bacteria 3348
380 Ga0316576_10071225 3300031727 Bacteria 2564
381 Ga0316576_10150142 3300031727 Bacteria 1756
382 Ga0316576_10171913 3300031727 Bacteria 1635
383 Ga0316578_10000406 3300031728 Bacteria 14022
384 Ga0316578_10007802 3300031728 Bacteria 5402
385 Ga0316578_10014816 3300031728 Bacteria 4178
386 Ga0316578_10020356 3300031728 Bacteria 3665
387 Ga0307405_10003265 3300031731 Bacteria 7402
388 Ga0307405_10009616 3300031731 Bacteria 4966
389 Ga0316577_10027166 3300031733 Bacteria 3191
390 Ga0307413_10009265 3300031824 Bacteria 4703
391 Ga0307410_10011351 3300031852 Bacteria 5091
392 Ga0307410_10036143 3300031852 Bacteria 3214
393 Ga0307410_10039157 3300031852 Bacteria 3110
394 Ga0307410_10190881 3300031852 Bacteria 1558
395 Ga0307406_10027319 3300031901 Bacteria 3438
396 Ga0307407_10003095 3300031903 Bacteria 6721
397 Ga0307412_10014576 3300031911 Bacteria 4640
398 Ga0307412_10023477 3300031911 Bacteria 3795
399 Ga0307409_100004703 3300031995 Bacteria 7727
400 Ga0307409_100064353 3300031995 Bacteria 2880
401 Ga0307409_100084635 3300031995 Bacteria 2576
402 Ga0307409_100186988 3300031995 Bacteria 1840
403 Ga0307416_100014475 3300032002 Bacteria 5411
404 Ga0307416_100050742 3300032002 Bacteria 3309
405 Ga0307416_100053949 3300032002 Bacteria 3228
406 Ga0307416_100107092 3300032002 Bacteria 2452
407 Ga0307416_100133426 3300032002 Bacteria 2241
408 Ga0307416_100596403 3300032002 Bacteria 1184
409 Ga0307414_10055384 3300032004 Bacteria 2776
410 Ga0307414_10055409 3300032004 Bacteria 2776
411 Ga0307411_10003472 3300032005 Bacteria 7321
412 Ga0307411_10036389 3300032005 Bacteria 3084
413 Ga0307415_100001761 3300032126 Bacteria 10574
414 Ga0307415_100019882 3300032126 Bacteria 4087
415 Ga0307415_100201023 3300032126 Bacteria 1581
416 Ga0307415_100244426 3300032126 Bacteria 1454
417 Ga0316583_10003725 3300032133 Bacteria 5393
418 Ga0316585_10000650 3300032137 Bacteria 8577
419 Ga0316580_10006382 3300032139 Bacteria 3485
420 Ga0316580_10017769 3300032139 Bacteria 2188
421 Ga0316580_10045856 3300032139 Bacteria 1348
422 Ga0373961_0015297 3300035241 Bacteria 1960
423 Ga0316574_0016859 3300035398 Unclassified 4263
424 Ga0316574_0158144 3300035398 Unclassified 1460
425 Ga0316582_0002036 3300036647 Bacteria 9299
426 Ga0316582_0005548 3300036647 Bacteria 6514
427 Ga0316582_0015154 3300036647 Bacteria 4398
428 Ga0316582_0070413 3300036647 Bacteria 2263
429 Ga0316582_0132388 3300036647 Bacteria 1676
430 Ga0316584_0002001 3300036712 Bacteria 12732
431 Ga0316584_0002281 3300036712 Bacteria 12072
432 Ga0316584_0005005 3300036712 Bacteria 8829
433 Ga0316584_0051174 3300036712 Bacteria 3089
434 Ga0316584_0061836 3300036712 Bacteria 2804
435 Ga0316584_0095851 3300036712 Bacteria 2221
436 Ga0395899_0007681 3300037312 Bacteria 8313
437 Ga0395899_0107908 3300037312 Bacteria 2003
438 Ga0395900_0001792 3300037418 Bacteria 24630
439 Ga0395900_0021154 3300037418 Bacteria 6648
440 Ga0395900_0105645 3300037418 Bacteria 2893
441 Ga0395898_0021442 3300037466 Bacteria 6551
442 Ga0395898_0037984 3300037466 Bacteria 4774
443 Ga0395898_0082078 3300037466 Bacteria 3107
444 Ga0395898_0154467 3300037466 Bacteria 2195
445 Ga0395898_0263108 3300037466 Unclassified 1645
446 Ga0395905_0005868 3300037471 Bacteria 12470
447 Ga0395905_0159651 3300037471 Bacteria 2119
448 Ga0395905_0166445 3300037471 Bacteria 2072
449 Ga0395905_0475261 3300037471 Bacteria 1149
450 Ga0316581_0072207 3300037588 Bacteria 1061
451 Ga0395901_0005884 3300038443 Bacteria 12410
452 Ga0395901_0016478 3300038443 Bacteria 7529
453 Ga0395901_0017096 3300038443 Bacteria 7394
454 Ga0395901_0101173 3300038443 Bacteria 3024
455 Ga0395901_0508565 3300038443 Bacteria 1226
456 Ga0237819_07252 3300038705 Bacteria 1604
457 Ga0400484_10749 3300038725 Bacteria 4779
458 Ga0400484_11841 3300038725 Bacteria 7739
459 Ga0400484_32425 3300038725 Bacteria 1880
460 Ga0400490_04360 3300038726 Bacteria 4580
461 Ga0400490_10536 3300038726 Bacteria 5004
462 Ga0400490_11632 3300038726 Bacteria 4628
463 Ga0400490_24154 3300038726 Bacteria 25221
464 Ga0400490_55129 3300038726 Bacteria 10975
465 Ga0400491_06558 3300038727 Bacteria 4193
466 Ga0400485_07187 3300038735 Bacteria 1337
467 Ga0400485_12416 3300038735 Bacteria 14304
468 Ga0400485_18741 3300038735 Bacteria 31288
469 Ga0400485_20208 3300038735 Bacteria 42303
470 Ga0400488_17101 3300038741 Bacteria 3345
471 Ga0400488_36447 3300038741 Bacteria 1414
472 Ga0400488_56624 3300038741 Bacteria 33459
473 Ga0400488_61529 3300038741 Bacteria 8471
474 Ga0400486_01713 3300038742 Bacteria 7445
475 Ga0400486_08357 3300038742 Bacteria 47260
476 Ga0400486_13010 3300038742 Bacteria 13533
477 Ga0400486_19352 3300038742 Bacteria 4221
478 Ga0400486_32970 3300038742 Bacteria 19800
479 Ga0400483_113209 3300039062 Bacteria 4110
480 Ga0400483_172553 3300039062 Bacteria 18169
481 Ga0400483_202581 3300039062 Bacteria 1914
482 Ga0400483_259742 3300039062 Bacteria 2269
483 Ga0400489_19794 3300039093 Bacteria 11642
484 Ga0400489_24659 3300039093 Bacteria 24146
485 Ga0400489_56300 3300039093 Bacteria 20080
486 Ga0400489_70520 3300039093 Bacteria 12186
487 Ga0400489_94355 3300039093 Bacteria 9207
488 Ga0400487_06632 3300039110 Bacteria 20467
489 Ga0400487_15943 3300039110 Unclassified 1634
490 Ga0400487_29500 3300039110 Unclassified 2176
491 Ga0400487_49500 3300039110 Bacteria 2637
492 Ga0439453_0008816 3300041408 Bacteria 1629
493 Ga0451800_1190734 3300041459 Bacteria 1551
494 Ga0451807_2431939 3300041486 Bacteria 1519
495 Ga0439442_028246 3300042002 Bacteria 1170
496 Ga0439450_003741 3300042008 Bacteria 2545
497 Ga0450911_004969 3300042115 Bacteria 2116
498 Ga0450894_012888 3300042131 Bacteria 1096
499 Ga0450895_004883 3300042132 Bacteria 1069
500 Ga0450896_002709 3300042133 Bacteria 2308
501 Ga0450905_003275 3300042142 Bacteria 2124
502 Ga0439435_0001971 3300042436 Bacteria 3956
503 Ga0439435_0036416 3300042436 Bacteria 1360
504 Ga0451577_0003629 3300042876 Bacteria 16952
505 Ga0451577_0003928 3300042876 Bacteria 16057
506 Ga0451577_0007132 3300042876 Bacteria 11021
507 Ga0451577_0038348 3300042876 Bacteria 4310
508 Ga0451577_0089686 3300042876 Bacteria 2744
509 Ga0451577_0142465 3300042876 Bacteria 2154
510 Ga0453683_0005885 3300044673 Bacteria 8482
511 Ga0453683_0146652 3300044673 Bacteria 1490
512 Ga0453684_0000107 3300044712 Bacteria 362864
513 Ga0453684_0000414 3300044712 Bacteria 174278
514 Ga0453684_0001111 3300044712 Bacteria 84488
515 Ga0453684_0001479 3300044712 Bacteria 66322
516 Ga0453684_0008066 3300044712 Bacteria 19041
517 Ga0453684_0012382 3300044712 Bacteria 14081
518 Ga0453684_0017106 3300044712 Bacteria 11261
519 Ga0453684_0047924 3300044712 Bacteria 5659
520 Ga0453684_0054288 3300044712 Bacteria 5220
521 Ga0453684_0079097 3300044712 Bacteria 4111
522 Ga0453684_0126419 3300044712 Bacteria 3076
523 Ga0453684_0138113 3300044712 Bacteria 2915
524 Ga0453684_0485231 3300044712 Bacteria 1370
525 Ga0453684_0724351 3300044712 Bacteria 1079
526 Ga0451576_0000171 3300045051 Bacteria 162452
527 Ga0451576_0012714 3300045051 Bacteria 9450
528 Ga0451576_0028416 3300045051 Bacteria 5991
529 Ga0451576_0076467 3300045051 Bacteria 3484
530 Ga0451576_0374292 3300045051 Bacteria 1492
531 Ga0451576_0615425 3300045051 Bacteria 1141
532 Ga0495627_006967 3300046453 Bacteria 4387
533 Ga0495627_010488 3300046453 Bacteria 3367
534 Ga0495638_0000923 3300046460 Bacteria 29918
535 Ga0495650_0017522 3300046471 Bacteria 3589
536 Ga0495605_0000036 3300046474 Bacteria 203902
537 Ga0495594_0000608 3300046499 Bacteria 18446
538 Ga0495594_0118132 3300046499 Bacteria 1498
539 Ga0495583_0000028 3300046506 Bacteria 255787
540 Ga0495608_0000358 3300046511 Bacteria 31895
541 Ga0495610_0044263 3300046512 Bacteria 2210
542 Ga0495620_0000073 3300046515 Bacteria 83446
543 Ga0495643_0001805 3300046522 Bacteria 18329
544 Ga0495648_0005020 3300046524 Bacteria 11120
545 Ga0495663_0011415 3300046525 Bacteria 2472
546 Ga0495663_0013141 3300046525 Bacteria 2314
547 Ga0495654_0000246 3300046530 Bacteria 50620
548 Ga0495609_0000115 3300046538 Bacteria 93419
549 Ga0495621_0023854 3300046539 Bacteria 2038
550 Ga0495597_0001109 3300046542 Bacteria 20383
551 Ga0495633_0000028 3300046558 Bacteria 203214
552 Ga0495633_0039461 3300046558 Bacteria 2253
553 Ga0495667_0000569 3300046559 Bacteria 23532
554 Ga0495656_0003673 3300046615 Bacteria 5208
555 Ga0495656_0005742 3300046615 Bacteria 4306
556 Ga0495656_0017989 3300046615 Bacteria 2706
557 Ga0495668_0004574 3300046616 Bacteria 9731
558 Ga0495611_0002080 3300046648 Bacteria 9410
559 Ga0495625_0103741 3300046660 Bacteria 1949
560 Ga0495659_0020578 3300046664 Bacteria 2217
561 Ga0495661_0000211 3300046665 Bacteria 67481
562 Ga0495613_0001198 3300046689 Bacteria 19793
563 Ga0495670_0026477 3300046691 Bacteria 2870
564 Ga0495589_0000402 3300046794 Bacteria 32574
565 Ga0495660_0001852 3300046810 Bacteria 13881
566 Ga0495636_0026359 3300047318 Bacteria 2364
567 Ga0495672_0000214 3300047320 Bacteria 82882
568 Ga0495672_0011967 3300047320 Bacteria 6082
569 Ga0495683_0000091 3300047323 Bacteria 91313
570 Ga0495679_000083 3300047446 Bacteria 87051
571 Ga0495673_0015663 3300047469 Bacteria 3899
572 Ga0495681_0020864 3300047470 Bacteria 3543
573 Ga0495684_0005372 3300047471 Bacteria 9975
574 Ga0495686_0008753 3300047472 Bacteria 7383
575 Ga0496109_0013461 3300048912 Bacteria 7097
576 Ga0496113_0168093 3300048916 Bacteria 1736
577 Ga0496116_0001111 3300048919 Bacteria 32190
578 Ga0496117_0001300 3300048920 Bacteria 36745
579 Ga0496117_0002433 3300048920 Bacteria 23537
580 Ga0496117_0065177 3300048920 Bacteria 2478
581 Ga0496118_0000406 3300048921 Bacteria 71874
582 Ga0496118_0000703 3300048921 Bacteria 54182
583 Ga0496118_0075438 3300048921 Bacteria 2405
584 Ga0496119_0114047 3300048922 Bacteria 1495
585 Ga0496121_0000705 3300048924 Bacteria 62174
586 Ga0496121_0146557 3300048924 Bacteria 1743
587 Ga0496122_0047585 3300048925 Bacteria 3309
588 Ga0496122_0048434 3300048925 Bacteria 3267
589 Ga0496123_0104074 3300048926 Bacteria 1642
590 Ga0496124_0010087 3300048927 Bacteria 9631
591 Ga0496124_0074196 3300048927 Bacteria 2812
592 Ga0496125_0077446 3300048928 Bacteria 2563
593 Ga0496126_0209196 3300048929 Bacteria 1643
594 Ga0495678_000020 3300049459 Bacteria 253654
595 Ga0501034_0057034 3300049571 Bacteria 3928
596 Ga0501034_0130797 3300049571 Bacteria 2493
597 Ga0501036_0040305 3300049572 Bacteria 3950
598 Ga0501037_0046762 3300049573 Bacteria 3173
599 Ga0501038_0008714 3300049574 Bacteria 9310
600 Ga0501040_0211126 3300049576 Bacteria 1380
601 Ga0501041_0238114 3300049577 Bacteria 1143
602 Ga0501042_0029378 3300049578 Bacteria 3876
603 Ga0501046_0005153 3300049580 Bacteria 11714
604 Ga0501047_0211453 3300049581 Bacteria 1798
605 Ga0501047_0363103 3300049581 Bacteria 1283
606 Ga0501048_0026046 3300049582 Bacteria 4260
607 Ga0501067_0086371 3300049583 Bacteria 1741
608 Ga0501070_0083722 3300049586 Bacteria 2641
609 Ga0501070_0143736 3300049586 Bacteria 1969
610 Ga0501071_0032418 3300049587 Bacteria 3710
611 Ga0501072_0039227 3300049588 Bacteria 3719
612 Ga0501073_0032803 3300049589 Bacteria 3701
613 Ga0501074_0096470 3300049590 Bacteria 2117
614 Ga0501074_0276950 3300049590 Bacteria 1193
615 Ga0501075_0005648 3300049591 Bacteria 8560
616 Ga0501075_0074216 3300049591 Bacteria 2573
617 Ga0501075_0123032 3300049591 Bacteria 1975
618 Ga0501076_0009612 3300049592 Bacteria 7143
619 Ga0501076_0061862 3300049592 Bacteria 2980
620 Ga0501076_0085931 3300049592 Bacteria 2528
621 Ga0501076_0222157 3300049592 Bacteria 1544
622 Ga0501080_0037427 3300049742 Bacteria 4532
623 Ga0501080_0113976 3300049742 Bacteria 2506
624 Ga0501035_0056757 3300049822 Bacteria 3492
625 Ga0501044_0003608 3300049823 Bacteria 17419
626 Ga0501045_0088061 3300049824 Bacteria 2293
627 nmdc:mga00v17_158982_c1 3300050491 Bacteria 1454
628 nmdc:mga00v17_308_c1 3300050491 Bacteria 28036
629 nmdc:mga06z11_125702_c1 3300050494 Bacteria 1435
630 nmdc:mga06z11_63686_c1 3300050494 Bacteria 1930
631 nmdc:mga05p37_105144_c1 3300050507 Bacteria 3473
632 nmdc:mga05p37_15154_c1 3300050507 Bacteria 9257
633 nmdc:mga05p37_167625_c1 3300050507 Bacteria 2680
634 nmdc:mga05p37_198058_c1 3300050507 Bacteria 2435
635 nmdc:mga05p37_26140_c1 3300050507 Bacteria 7098
636 nmdc:mga05p37_357485_c1 3300050507 Bacteria 1718
637 nmdc:mga05p37_408122_c1 3300050507 Bacteria 1584
638 nmdc:mga05p37_564673_c1 3300050507 Bacteria 1292
639 nmdc:mga05p37_68215_c1 3300050507 Bacteria 4374
640 nmdc:mga05p37_74450_c1 3300050507 Bacteria 4179
641 nmdc:mga09592_186101_c1 3300050508 Bacteria 1797
642 nmdc:mga09592_34058_c1 3300050508 Bacteria 4257
643 nmdc:mga09592_45261_c1 3300050508 Bacteria 3706
644 nmdc:mga09592_49274_c1 3300050508 Bacteria 3551
645 nmdc:mga09592_77335_c1 3300050508 Bacteria 2831
646 nmdc:mga0qj67_2782_c1 3300050509 Bacteria 12549
647 nmdc:mga0qj67_34774_c1 3300050509 Bacteria 3938
648 nmdc:mga0qj67_356695_c1 3300050509 Bacteria 1182
649 nmdc:mga06r32_15677_c1 3300050510 Bacteria 6885
650 nmdc:mga06r32_194757_c1 3300050510 Bacteria 2014
651 nmdc:mga06r32_533696_c1 3300050510 Bacteria 1148
652 nmdc:mga06r32_573928_c1 3300050510 Bacteria 1100
653 nmdc:mga06r32_8270_c1 3300050510 Bacteria 9366
654 nmdc:mga08y16_110480_c1 3300050511 Bacteria 2863
655 nmdc:mga08y16_190862_c1 3300050511 Bacteria 2125
656 nmdc:mga08y16_1926_c1 3300050511 Bacteria 21179
657 nmdc:mga08y16_204146_c1 3300050511 Unclassified 2048
658 nmdc:mga08y16_21348_c1 3300050511 Bacteria 6838
659 nmdc:mga08y16_25726_c1 3300050511 Bacteria 6210
660 nmdc:mga08y16_284929_c1 3300050511 Bacteria 1704
661 nmdc:mga08y16_394121_c1 3300050511 Bacteria 1418
662 nmdc:mga08y16_43821_c1 3300050511 Bacteria 4688
663 nmdc:mga08y16_71485_c1 3300050511 Bacteria 3616
664 nmdc:mga08y16_870_c1 3300050511 Bacteria 29078
665 nmdc:mga08y16_9903_c1 3300050511 Bacteria 10004
666 nmdc:mga0n895_115260_c1 3300050512 Bacteria 2705
667 nmdc:mga0n895_16759_c1 3300050512 Bacteria 6733
668 nmdc:mga0n895_64110_c1 3300050512 Bacteria 3634
669 nmdc:mga0n895_76562_c1 3300050512 Bacteria 3327
670 nmdc:mga0rr50_38400_c1 3300050513 Bacteria 3464
671 nmdc:mga0rr50_708_c1 3300050513 Bacteria 17916
672 nmdc:mga0a205_13094_c1 3300050515 Bacteria 7704
673 nmdc:mga0a205_14896_c1 3300050515 Bacteria 7255
674 nmdc:mga0a205_716_c1 3300050515 Bacteria 26671
675 nmdc:mga0a205_84_c1 3300050515 Bacteria 51647
676 Ga0500610_0090926 3300053079 Bacteria 1586
677 Ga0500555_000051 3300053103 Bacteria 59969
678 Ga0500568_0011205 3300053139 Bacteria 4175
679 Ga0500616_0000306 3300053153 Bacteria 70571
680 Ga0500645_000041 3300053730 Bacteria 110646
681 Ga0501084_0089348 3300054114 Bacteria 2586
682 Ga0501084_0213056 3300054114 Bacteria 1630
683 Ga0590071_000235 3300059421 Bacteria 16189
684 Ga0590071_000716 3300059421 Bacteria 9395
685 Ga0590074_000382 3300059423 Bacteria 6308
686 Ga0590075_002569 3300059424 Bacteria 4336
687 Ga0590075_020193 3300059424 Bacteria 1658
688 Ga0590077_000031 3300059426 Bacteria 33228
689 Ga0590077_001251 3300059426 Bacteria 6081
690 Ga0590077_013308 3300059426 Bacteria 1711
691 Ga0501082_0262590 3300060353 Bacteria 1502
692 2538834869 2537561836 Bacteria 3910579
693 2547502318 2547132130 Bacteria 4660562
694 2578460294 2576861471 Bacteria 4648976
695 2643893820 2643221577 Bacteria 3710843
696 2644476045 2643221685 Bacteria 3673288
697 2747950618 2747842428 Bacteria 4689383
698 2765577002 2765235840 Bacteria 4663337
699 2816519629 2816332141 Bacteria 4436036
700 2819662074 2818991457 Bacteria 5323295
701 2842393428 2842391507 Bacteria 4486072
702 2842760348 2842757796 Bacteria 3981385
703 2857444084 2857442823 Bacteria 4562550
704 2874224088 2874220319 Bacteria 4594709
705 2895397192 2895395659 Bacteria 3983269
706 2895503264 2895498888 Bacteria 5283788
707 2895513090 2895511927 Bacteria 6802080
708 2895523102 2895522137 Bacteria 3284416
709 2895527005 2895525241 Bacteria 3388457
710 2919089977 2919089067 Bacteria 4560942
711 2919138254 2919134579 Bacteria 4480386
712 2928499988 2928496128 Bacteria 4631123
713 2929209037 2929206907 Bacteria 5918291
714 2931382703 2931380184 Bacteria 4455911
715 2937613420 2937610967 Bacteria 4618818
716 2939623274 2939622612 Bacteria 4698046
717 2939628120 2939626828 Bacteria 4695272
718 2961050852 2961047084 Bacteria 4594415
719 2961067932 2961064222 Bacteria 4749990
720 Ga0400483_095319
721 JGI24735J21928_10025197
722 JGI25152J39213_1000004
723 JGI25150J39212_1000491
724 JGI25151J46595_10000010
725 JGI25406J46586_10000294
726 JGI25406J46586_10000986
727 JGI25406J46586_10047026
728 JGI25153J46596_10000013
729 rootH2_10006882
730 rootH2_10081097
731 Ga0058692_1000005
732 Ga0065704_10071755
733 Ga0065712_10002276
734 Ga0065712_10017397
735 Ga0065715_10002535
736 Ga0070658_10129513
737 Ga0070676_10002232
738 Ga0070676_10036458
739 Ga0070690_100010170
740 Ga0070690_100021642
741 Ga0070670_100000644
742 Ga0070670_100001817
743 Ga0070670_100008954
744 Ga0070670_100026149
745 Ga0070670_100398406
746 Ga0070677_10016106
747 Ga0068869_100002035
748 Ga0068869_100003931
749 Ga0068869_100150836
750 Ga0070666_10049270
751 Ga0070680_100193619
752 Ga0070682_100039242
753 Ga0068868_100025104
754 Ga0068868_100119137
755 Ga0070689_100084992
756 Ga0070689_100212372
757 Ga0070687_100008498
758 Ga0070661_100199438
759 Ga0070668_100003349
760 Ga0070668_100077132
761 Ga0070669_100005634
762 Ga0070669_100029791
763 Ga0070669_100157854
764 Ga0070669_100243530
765 Ga0070675_100000344
766 Ga0070675_100002958
767 Ga0070675_100016192
768 Ga0070675_100018904
769 Ga0070675_100038145
770 Ga0070675_100054701
771 Ga0070675_100193098
772 Ga0070671_100064039
773 Ga0070671_100268597
774 Ga0070674_100000032
775 Ga0070674_100162426
776 Ga0070673_100004841
777 Ga0070673_100009483
778 Ga0070673_100175811
779 Ga0070688_100010886
780 Ga0070688_100023939
781 Ga0070688_100159250
782 Ga0070688_100162898
783 Ga0070659_100064651
784 Ga0070667_100008279
785 Ga0070667_100302339
786 Ga0070701_10063569
787 Ga0070701_10106746
788 Ga0070705_100153615
789 Ga0070700_100027345
790 Ga0070700_100068639
791 Ga0070700_100073272
792 Ga0070663_100044112
793 Ga0070678_100040275
794 Ga0070678_100081651
795 Ga0070678_100090289
796 Ga0070678_100205211
797 Ga0070678_100223793
798 Ga0070678_100248042
799 Ga0070662_100123610
800 Ga0070662_100214688
801 Ga0068867_100000578
802 Ga0068867_100051430
803 Ga0068867_100094451
804 Ga0070685_10009160
805 Ga0070685_10009810
806 Ga0070685_10304684
807 Ga0070706_100027284
808 Ga0070698_100002958
809 Ga0070698_100043831
810 Ga0070698_100354640
811 Ga0070699_100053104
812 Ga0070699_100237449
813 Ga0068853_100003732
814 Ga0068853_100225609
815 Ga0070672_100009427
816 Ga0070672_100015081
817 Ga0070672_100068226
818 Ga0070672_100083505
819 Ga0070672_100104221
820 Ga0070672_100188067
821 Ga0070686_100013664
822 Ga0070686_100167420
823 Ga0070695_100005599
824 Ga0070696_100101253
825 Ga0070665_100000417
826 Ga0070665_100093849
827 Ga0070665_100132700
828 Ga0070704_100074238
829 Ga0070704_100177471
830 Ga0068855_100294240
831 Ga0070664_100005128
832 Ga0070664_100040079
833 Ga0070664_100044735
834 Ga0070664_100078015
835 Ga0068854_100229420
836 Ga0068852_100409083
837 Ga0068859_100006708
838 Ga0068859_100078804
839 Ga0068859_100123928
840 Ga0068864_100027300
841 Ga0068864_100100025
842 Ga0068864_100138443
843 Ga0068864_100326655
844 Ga0068866_10056893
845 Ga0068861_100064991
846 Ga0068870_10015656
847 Ga0068870_10016802
848 Ga0068863_100016001
849 Ga0068863_100441691
850 Ga0068858_100023552
851 Ga0068858_100077956
852 Ga0068858_100324155
853 Ga0068860_100057807
854 Ga0068860_100108586
855 Ga0068862_100031342
856 Ga0081538_10050621
857 Ga0081539_10000013
858 Ga0081539_10000164
859 Ga0081539_10000750
860 Ga0081539_10038985
861 Ga0081539_10046258
862 Ga0075368_10070091
863 Ga0075364_10000276
864 Ga0075364_10158675
865 Ga0075366_10071524
866 Ga0097621_100117885
867 Ga0068871_100231017
868 Ga0068871_100334160
869 Ga0075428_100000166
870 Ga0075428_100015404
871 Ga0075428_100027849
872 Ga0075428_100083995
873 Ga0075428_100151426
874 Ga0075428_100256995
875 Ga0075430_100000691
876 Ga0075430_100054231
877 Ga0075430_100162716
878 Ga0075430_100173774
879 Ga0075430_100354721
880 Ga0075431_100001885
881 Ga0075431_100044479
882 Ga0075431_100066473
883 Ga0075431_100131410
884 Ga0075431_100179135
885 Ga0075431_100181072
886 Ga0075431_100389367
887 Ga0075433_10000037
888 Ga0075433_10001456
889 Ga0075433_10005012
890 Ga0075434_100000596
891 Ga0075434_100003672
892 Ga0075434_100027168
893 Ga0075429_100048999
894 Ga0075429_100062312
895 Ga0075429_100107600
896 Ga0075429_100250915
897 Ga0075429_100285745
898 Ga0068865_100001886
899 Ga0068865_100105016
900 Ga0068865_100215622
901 Ga0097620_100006708
902 Ga0097620_100078802
903 Ga0097620_100123925
904 Ga0075435_100016436
905 Ga0075435_100040676
906 Ga0075435_100201026
907 Ga0105244_10003455
908 Ga0105244_10023804
909 Ga0111539_10000417
910 Ga0111539_10002191
911 Ga0111539_10002820
912 Ga0111539_10004794
913 Ga0111539_10007840
914 Ga0111539_10015750
915 Ga0111539_10027136
916 Ga0111539_10033958
917 Ga0111539_10042748
918 Ga0111539_10077166
919 Ga0111539_10162823
920 Ga0105247_10002389
921 Ga0114129_10009591
922 Ga0114129_10034123
923 Ga0114129_10048306
924 Ga0114129_10076433
925 Ga0114129_10116587
926 Ga0114129_10267423
927 Ga0114129_10695544
928 Ga0105243_10015475
929 Ga0105241_10000371
930 Ga0105241_10098597
931 Ga0105248_10111233
932 Ga0105237_10007492
933 Ga0105238_10013627
934 Ga0105238_10115595
935 Ga0105238_10181197
936 Ga0105249_10007783
937 Ga0105249_10009765
938 Ga0105249_10015866
939 Ga0105249_10147327
940 Ga0105239_10250089
941 Ga0105246_10231957
942 Ga0157370_10103954
943 Ga0163162_10019877
944 Ga0163162_10308366
945 Ga0157372_10119169
946 Ga0157375_10042900
947 Ga0157375_10477908
948 Ga0163163_10207110
949 Ga0157380_10000799
950 Ga0157380_10005869
951 Ga0182008_10000083
952 Ga0157377_10001309
953 Ga0157379_10058700
954 Ga0157379_10093480
955 Ga0183369_1013
956 Ga0163161_10007719
957 Ga0163161_10017406
958 Ga0163161_10183547
959 Ga0207425_1000015
960 Ga0209129_1000074
961 Ga0209676_1000104
962 Ga0209025_1000002
963 Ga0209758_1000003
964 Ga0209050_1038650
965 Ga0207697_10002637
966 Ga0207655_1003689
967 Ga0207655_1035463
968 Ga0207653_10020057
969 Ga0207682_10001038
970 Ga0207682_10073052
971 Ga0207682_10078534
972 Ga0207642_10044334
973 Ga0207688_10007643
974 Ga0207645_10000611
975 Ga0207645_10005408
976 Ga0207643_10000068
977 Ga0207643_10002433
978 Ga0207643_10047403
979 Ga0207705_10264858
980 Ga0207660_10080772
981 Ga0207662_10009971
982 Ga0207649_10166394
983 Ga0207681_10004748
984 Ga0207681_10079435
985 Ga0207681_10100840
986 Ga0207681_10108179
987 Ga0207694_10003531
988 Ga0207694_10011457
989 Ga0207694_10015837
990 Ga0207650_10009832
991 Ga0207650_10014393
992 Ga0207650_10046351
993 Ga0207650_10361400
994 Ga0207659_10000353
995 Ga0207659_10002915
996 Ga0207659_10003941
997 Ga0207659_10009215
998 Ga0207659_10011872
999 Ga0207659_10056571
1000 Ga0207659_10193622
1001 Ga0207659_10300465
1002 Ga0207687_10040448
1003 Ga0207687_10318467
1004 Ga0207644_10051921
1005 Ga0207644_10064505
1006 Ga0207644_10141485
1007 Ga0207690_10009308
1008 Ga0207706_10008244
1009 Ga0207706_10052029
1010 Ga0207706_10138031
1011 Ga0207706_10167026
1012 Ga0207709_10000954
1013 Ga0207709_10004516
1014 Ga0207670_10057930
1015 Ga0207670_10114634
1016 Ga0207669_10000642
1017 Ga0207704_10002632
1018 Ga0207691_10003313
1019 Ga0207691_10011105
1020 Ga0207691_10033132
1021 Ga0207691_10042552
1022 Ga0207691_10059555
1023 Ga0207691_10256827
1024 Ga0207711_10054368
1025 Ga0207689_10000219
1026 Ga0207689_10002433
1027 Ga0207689_10043379
1028 Ga0207689_10107077
1029 Ga0207689_10118812
1030 Ga0207679_10013441
1031 Ga0207679_10064008
1032 Ga0207679_10104385
1033 Ga0207679_10168820
1034 Ga0207679_10298136
1035 Ga0207679_10303437
1036 Ga0207667_10068982
1037 Ga0207651_10000813
1038 Ga0207651_10012886
1039 Ga0207651_10091094
1040 Ga0207651_10411410
1041 Ga0207712_10007668
1042 Ga0207668_10013679
1043 Ga0207668_10222610
1044 Ga0207640_10143130
1045 Ga0207658_10011784
1046 Ga0207677_10068506
1047 Ga0207703_10060611
1048 Ga0207703_10271081
1049 Ga0207639_10001388
1050 Ga0207678_10064681
1051 Ga0207708_10015509
1052 Ga0207708_10015853
1053 Ga0207708_10102955
1054 Ga0207641_10091615
1055 Ga0207641_10098826
1056 Ga0207648_10001252
1057 Ga0207648_10178439
1058 Ga0207676_10025450
1059 Ga0207676_10121225
1060 Ga0207676_10173795
1061 Ga0207676_10409490
1062 Ga0207674_10152404
1063 Ga0207675_100088473
1064 Ga0207683_10033861
1065 Ga0207683_10037554
1066 Ga0207683_10038335
1067 Ga0207683_10065501
1068 Ga0207683_10318098
1069 Ga0209371_1000031
1070 Ga0209974_10018478
1071 Ga0207428_10000444
1072 Ga0207428_10003654
1073 Ga0207428_10019347
1074 Ga0207428_10024118
1075 Ga0207428_10028854
1076 Ga0207428_10033872
1077 Ga0207428_10061782
1078 Ga0207428_10094480
1079 Ga0268266_10000646
1080 Ga0268266_10000688
1081 Ga0268266_10071310
1082 Ga0268264_10041798
1083 Ga0268264_10304043
1084 Ga0268256_1000034
1085 Ga0316176_1036236
1086 Ga0307408_100026796
1087 Ga0307408_100249465
1088 Ga0307408_100256067
1089 Ga0316575_10004403
1090 Ga0316575_10051417
1091 Ga0316579_10009229
1092 Ga0316579_10109556
1093 Ga0316576_10001606
1094 Ga0316576_10003024
1095 Ga0316576_10003307
1096 Ga0316576_10007410
1097 Ga0316576_10007966
1098 Ga0316576_10040530
1099 Ga0316576_10071225
1100 Ga0316576_10150142
1101 Ga0316576_10171913
1102 Ga0316578_10000406
1103 Ga0316578_10007802
1104 Ga0316578_10014816
1105 Ga0316578_10020356
1106 Ga0307405_10003265
1107 Ga0307405_10009616
1108 Ga0316577_10027166
1109 Ga0307413_10009265
1110 Ga0307410_10011351
1111 Ga0307410_10036143
1112 Ga0307410_10039157
1113 Ga0307410_10190881
1114 Ga0307406_10027319
1115 Ga0307407_10003095
1116 Ga0307412_10014576
1117 Ga0307412_10023477
1118 Ga0307409_100004703
1119 Ga0307409_100064353
1120 Ga0307409_100084635
1121 Ga0307409_100186988
1122 Ga0307416_100014475
1123 Ga0307416_100050742
1124 Ga0307416_100053949
1125 Ga0307416_100107092
1126 Ga0307416_100133426
1127 Ga0307416_100596403
1128 Ga0307414_10055384
1129 Ga0307414_10055409
1130 Ga0307411_10003472
1131 Ga0307411_10036389
1132 Ga0307415_100001761
1133 Ga0307415_100019882
1134 Ga0307415_100201023
1135 Ga0307415_100244426
1136 Ga0316583_10003725
1137 Ga0316585_10000650
1138 Ga0316580_10006382
1139 Ga0316580_10017769
1140 Ga0316580_10045856
1141 Ga0373961_0015297
1142 Ga0316574_0016859
1143 Ga0316574_0158144
1144 Ga0316582_0002036
1145 Ga0316582_0005548
1146 Ga0316582_0015154
1147 Ga0316582_0070413
1148 Ga0316582_0132388
1149 Ga0316584_0002001
1150 Ga0316584_0002281
1151 Ga0316584_0005005
1152 Ga0316584_0051174
1153 Ga0316584_0061836
1154 Ga0316584_0095851
1155 Ga0395899_0007681
1156 Ga0395899_0107908
1157 Ga0395900_0001792
1158 Ga0395900_0021154
1159 Ga0395900_0105645
1160 Ga0395898_0021442
1161 Ga0395898_0037984
1162 Ga0395898_0082078
1163 Ga0395898_0154467
1164 Ga0395898_0263108
1165 Ga0395905_0005868
1166 Ga0395905_0159651
1167 Ga0395905_0166445
1168 Ga0395905_0475261
1169 Ga0316581_0072207
1170 Ga0395901_0005884
1171 Ga0395901_0016478
1172 Ga0395901_0017096
1173 Ga0395901_0101173
1174 Ga0395901_0508565
1175 Ga0237819_07252
1176 Ga0400484_10749
1177 Ga0400484_11841
1178 Ga0400484_32425
1179 Ga0400490_04360
1180 Ga0400490_10536
1181 Ga0400490_11632
1182 Ga0400490_24154
1183 Ga0400490_55129
1184 Ga0400491_06558
1185 Ga0400485_07187
1186 Ga0400485_12416
1187 Ga0400485_18741
1188 Ga0400485_20208
1189 Ga0400488_17101
1190 Ga0400488_36447
1191 Ga0400488_56624
1192 Ga0400488_61529
1193 Ga0400486_01713
1194 Ga0400486_08357
1195 Ga0400486_13010
1196 Ga0400486_19352
1197 Ga0400486_32970
1198 Ga0400483_113209
1199 Ga0400483_172553
1200 Ga0400483_202581
1201 Ga0400483_259742
1202 Ga0400489_19794
1203 Ga0400489_24659
1204 Ga0400489_56300
1205 Ga0400489_70520
1206 Ga0400489_94355
1207 Ga0400487_06632
1208 Ga0400487_15943
1209 Ga0400487_29500
1210 Ga0400487_49500
1211 Ga0439453_0008816
1212 Ga0451800_1190734
1213 Ga0451807_2431939
1214 Ga0439442_028246
1215 Ga0439450_003741
1216 Ga0450911_004969
1217 Ga0450894_012888
1218 Ga0450895_004883
1219 Ga0450896_002709
1220 Ga0450905_003275
1221 Ga0439435_0001971
1222 Ga0439435_0036416
1223 Ga0451577_0003629
1224 Ga0451577_0003928
1225 Ga0451577_0007132
1226 Ga0451577_0038348
1227 Ga0451577_0089686
1228 Ga0451577_0142465
1229 Ga0453683_0005885
1230 Ga0453683_0146652
1231 Ga0453684_0000107
1232 Ga0453684_0000414
1233 Ga0453684_0001111
1234 Ga0453684_0001479
1235 Ga0453684_0008066
1236 Ga0453684_0012382
1237 Ga0453684_0017106
1238 Ga0453684_0047924
1239 Ga0453684_0054288
1240 Ga0453684_0079097
1241 Ga0453684_0126419
1242 Ga0453684_0138113
1243 Ga0453684_0485231
1244 Ga0453684_0724351
1245 Ga0451576_0000171
1246 Ga0451576_0012714
1247 Ga0451576_0028416
1248 Ga0451576_0076467
1249 Ga0451576_0374292
1250 Ga0451576_0615425
1251 Ga0495627_006967
1252 Ga0495627_010488
1253 Ga0495638_0000923
1254 Ga0495650_0017522
1255 Ga0495605_0000036
1256 Ga0495594_0000608
1257 Ga0495594_0118132
1258 Ga0495583_0000028
1259 Ga0495608_0000358
1260 Ga0495610_0044263
1261 Ga0495620_0000073
1262 Ga0495643_0001805
1263 Ga0495648_0005020
1264 Ga0495663_0011415
1265 Ga0495663_0013141
1266 Ga0495654_0000246
1267 Ga0495609_0000115
1268 Ga0495621_0023854
1269 Ga0495597_0001109
1270 Ga0495633_0000028
1271 Ga0495633_0039461
1272 Ga0495667_0000569
1273 Ga0495656_0003673
1274 Ga0495656_0005742
1275 Ga0495656_0017989
1276 Ga0495668_0004574
1277 Ga0495611_0002080
1278 Ga0495625_0103741
1279 Ga0495659_0020578
1280 Ga0495661_0000211
1281 Ga0495613_0001198
1282 Ga0495670_0026477
1283 Ga0495589_0000402
1284 Ga0495660_0001852
1285 Ga0495636_0026359
1286 Ga0495672_0000214
1287 Ga0495672_0011967
1288 Ga0495683_0000091
1289 Ga0495679_000083
1290 Ga0495673_0015663
1291 Ga0495681_0020864
1292 Ga0495684_0005372
1293 Ga0495686_0008753
1294 Ga0496109_0013461
1295 Ga0496113_0168093
1296 Ga0496116_0001111
1297 Ga0496117_0001300
1298 Ga0496117_0002433
1299 Ga0496117_0065177
1300 Ga0496118_0000406
1301 Ga0496118_0000703
1302 Ga0496118_0075438
1303 Ga0496119_0114047
1304 Ga0496121_0000705
1305 Ga0496121_0146557
1306 Ga0496122_0047585
1307 Ga0496122_0048434
1308 Ga0496123_0104074
1309 Ga0496124_0010087
1310 Ga0496124_0074196
1311 Ga0496125_0077446
1312 Ga0496126_0209196
1313 Ga0495678_000020
1314 Ga0501034_0057034
1315 Ga0501034_0130797
1316 Ga0501036_0040305
1317 Ga0501037_0046762
1318 Ga0501038_0008714
1319 Ga0501040_0211126
1320 Ga0501041_0238114
1321 Ga0501042_0029378
1322 Ga0501046_0005153
1323 Ga0501047_0211453
1324 Ga0501047_0363103
1325 Ga0501048_0026046
1326 Ga0501067_0086371
1327 Ga0501070_0083722
1328 Ga0501070_0143736
1329 Ga0501071_0032418
1330 Ga0501072_0039227
1331 Ga0501073_0032803
1332 Ga0501074_0096470
1333 Ga0501074_0276950
1334 Ga0501075_0005648
1335 Ga0501075_0074216
1336 Ga0501075_0123032
1337 Ga0501076_0009612
1338 Ga0501076_0061862
1339 Ga0501076_0085931
1340 Ga0501076_0222157
1341 Ga0501080_0037427
1342 Ga0501080_0113976
1343 Ga0501035_0056757
1344 Ga0501044_0003608
1345 Ga0501045_0088061
1346 nmdc:mga00v17_158982_c1
1347 nmdc:mga00v17_308_c1
1348 nmdc:mga06z11_125702_c1
1349 nmdc:mga06z11_63686_c1
1350 nmdc:mga05p37_105144_c1
1351 nmdc:mga05p37_15154_c1
1352 nmdc:mga05p37_167625_c1
1353 nmdc:mga05p37_198058_c1
1354 nmdc:mga05p37_26140_c1
1355 nmdc:mga05p37_357485_c1
1356 nmdc:mga05p37_408122_c1
1357 nmdc:mga05p37_564673_c1
1358 nmdc:mga05p37_68215_c1
1359 nmdc:mga05p37_74450_c1
1360 nmdc:mga09592_186101_c1
1361 nmdc:mga09592_34058_c1
1362 nmdc:mga09592_45261_c1
1363 nmdc:mga09592_49274_c1
1364 nmdc:mga09592_77335_c1
1365 nmdc:mga0qj67_2782_c1
1366 nmdc:mga0qj67_34774_c1
1367 nmdc:mga0qj67_356695_c1
1368 nmdc:mga06r32_15677_c1
1369 nmdc:mga06r32_194757_c1
1370 nmdc:mga06r32_533696_c1
1371 nmdc:mga06r32_573928_c1
1372 nmdc:mga06r32_8270_c1
1373 nmdc:mga08y16_110480_c1
1374 nmdc:mga08y16_190862_c1
1375 nmdc:mga08y16_1926_c1
1376 nmdc:mga08y16_204146_c1
1377 nmdc:mga08y16_21348_c1
1378 nmdc:mga08y16_25726_c1
1379 nmdc:mga08y16_284929_c1
1380 nmdc:mga08y16_394121_c1
1381 nmdc:mga08y16_43821_c1
1382 nmdc:mga08y16_71485_c1
1383 nmdc:mga08y16_870_c1
1384 nmdc:mga08y16_9903_c1
1385 nmdc:mga0n895_115260_c1
1386 nmdc:mga0n895_16759_c1
1387 nmdc:mga0n895_64110_c1
1388 nmdc:mga0n895_76562_c1
1389 nmdc:mga0rr50_38400_c1
1390 nmdc:mga0rr50_708_c1
1391 nmdc:mga0a205_13094_c1
1392 nmdc:mga0a205_14896_c1
1393 nmdc:mga0a205_716_c1
1394 nmdc:mga0a205_84_c1
1395 Ga0500610_0090926
1396 Ga0500555_000051
1397 Ga0500568_0011205
1398 Ga0500616_0000306
1399 Ga0500645_000041
1400 Ga0501084_0089348
1401 Ga0501084_0213056
1402 Ga0590071_000235
1403 Ga0590071_000716
1404 Ga0590074_000382
1405 Ga0590075_002569
1406 Ga0590075_020193
1407 Ga0590077_000031
1408 Ga0590077_001251
1409 Ga0590077_013308
1410 Ga0501082_0262590
1411 2538834869
1412 2547502318
1413 2578460294
1414 2643893820
1415 2644476045
1416 2747950618
1417 2765577002
1418 2816519629
1419 2819662074
1420 2842393428
1421 2842760348
1422 2857444084
1423 2874224088
1424 2895397192
1425 2895503264
1426 2895513090
1427 2895523102
1428 2895527005
1429 2919089977
1430 2919138254
1431 2928499988
1432 2929209037
1433 2931382703
1434 2937613420
1435 2939623274
1436 2939628120
1437 2961050852
1438 2961067932

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14237

GYF_2

GYF domain 2

54

100

0.97

PF01987

AIM24

Mitochondrial biogenesis AIM24

124

343

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yox-assembly1.cif.gz_C structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9143 72 308
1yox-assembly2.cif.gz_E structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9098 70 307
1yox-assembly1.cif.gz_A structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9097 72 308
1yox-assembly2.cif.gz_F structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9062 72 308
1yox-assembly1.cif.gz_C structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9054 72 308
ID Description Score Start End Superfamily
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8913 72 308 3.60.160.10
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8504 72 308 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7968 68 308 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7874 68 308 3.60.160.10
1pg6A00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7729 74 307 3.60.160.10
ID Description Score Start End GO Terms
AF-A0A6M0BLV1-F1-model_v4 AIM24 family protein 0.9185 163 309
AF-A0A7C6WUJ8-F1-model_v4 AIM24 family protein 0.9114 165 313
AF-A0A7S1GJ19-F1-model_v4 Altered inheritance of mitochondria protein 24, mitochondrial 0.9075 162 296
AF-A0A4Q3R9G4-F1-model_v4 AIM24 family protein 0.9068 164 300
AF-A0A7C6WUJ8-F1-model_v4 AIM24 family protein 0.9056 165 313

Map