F477275

General Info

Members Datasets Scaffolds Average Seq Length
719 244 719 106

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0028442|Ga0501077_0028442_2423_2779
Length 118
Sequence VTSASIAAFSPTLSGVLRKRRFADLVNRQLDLFEEDERELLAEAAEADARWTHASAEESEELYGDYQLVVDAIAERLLDVRETYAASLDETTADQYRTTFDAAARKRFRRFASLLDGE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
164 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
165 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
166 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
167 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 4.03
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10020806 3300005327 Bacteria 5257
2 Ga0070658_10125516 3300005327 Bacteria 2136
3 Ga0070658_10741140 3300005327 Bacteria 853
4 Ga0070676_10199609 3300005328 Unclassified 1311
5 Ga0070683_100012761 3300005329 Bacteria 7308
6 Ga0070683_100116559 3300005329 Unclassified 2522
7 Ga0070683_100163196 3300005329 Bacteria 2114
8 Ga0070683_100204920 3300005329 Bacteria 1873
9 Ga0070683_100266500 3300005329 Unclassified 1629
10 Ga0070683_101176794 3300005329 Unclassified 737
11 Ga0070683_101284004 3300005329 Unclassified 704
12 Ga0070683_101772363 3300005329 Unclassified 593
13 Ga0070670_102072541 3300005331 Bacteria 524
14 Ga0070677_10238963 3300005333 Bacteria 896
15 Ga0068869_100109629 3300005334 Unclassified 2098
16 Ga0070666_10172962 3300005335 Bacteria 1513
17 Ga0070680_100013940 3300005336 Bacteria 6273
18 Ga0070680_100044542 3300005336 Bacteria 3605
19 Ga0070682_100001712 3300005337 Bacteria 12197
20 Ga0070682_100202698 3300005337 Unclassified 1400
21 Ga0070682_100230701 3300005337 Bacteria 1323
22 Ga0070682_100376022 3300005337 Unclassified 1067
23 Ga0070682_100778705 3300005337 Unclassified 775
24 Ga0068868_100013592 3300005338 Bacteria 5977
25 Ga0068868_100060980 3300005338 Bacteria 2987
26 Ga0070660_100006223 3300005339 Bacteria 8263
27 Ga0070660_100504565 3300005339 Unclassified 1006
28 Ga0070691_10000781 3300005341 Bacteria 12645
29 Ga0070691_10454999 3300005341 Bacteria 732
30 Ga0070691_10671094 3300005341 Bacteria 619
31 Ga0070687_100011765 3300005343 Bacteria 3840
32 Ga0070687_100165662 3300005343 Unclassified 1311
33 Ga0070661_100051608 3300005344 Bacteria 3010
34 Ga0070661_100150713 3300005344 Unclassified 1758
35 Ga0070692_10004463 3300005345 Bacteria 5850
36 Ga0070668_100174976 3300005347 Bacteria 1749
37 Ga0070668_101100576 3300005347 Bacteria 717
38 Ga0070668_101394095 3300005347 Unclassified 639
39 Ga0070668_101775827 3300005347 Bacteria 567
40 Ga0070669_100128448 3300005353 Bacteria 1942
41 Ga0070669_100669026 3300005353 Bacteria 875
42 Ga0070675_100013253 3300005354 Bacteria 6478
43 Ga0070675_100143919 3300005354 Bacteria 2039
44 Ga0070675_100176508 3300005354 Unclassified 1845
45 Ga0070675_100238849 3300005354 Bacteria 1587
46 Ga0070675_100264615 3300005354 Bacteria 1508
47 Ga0070671_100127913 3300005355 Unclassified 2139
48 Ga0070671_100134573 3300005355 Bacteria 2083
49 Ga0070671_100198696 3300005355 Unclassified 1700
50 Ga0070671_100262053 3300005355 Unclassified 1469
51 Ga0070671_100577024 3300005355 Bacteria 971
52 Ga0070674_100024608 3300005356 Bacteria 3910
53 Ga0070674_100026395 3300005356 Bacteria 3793
54 Ga0070674_100035054 3300005356 Unclassified 3358
55 Ga0070674_100164746 3300005356 Bacteria 1685
56 Ga0070674_100175982 3300005356 Bacteria 1635
57 Ga0070674_100215709 3300005356 Bacteria 1490
58 Ga0070674_100343715 3300005356 Unclassified 1203
59 Ga0070674_100741165 3300005356 Bacteria 843
60 Ga0070673_100001958 3300005364 Bacteria 12419
61 Ga0070673_100058421 3300005364 Bacteria 3049
62 Ga0070673_100346818 3300005364 Unclassified 1317
63 Ga0070659_100006531 3300005366 Bacteria 8420
64 Ga0070659_100212870 3300005366 Unclassified 1593
65 Ga0070659_100843002 3300005366 Unclassified 799
66 Ga0070701_10005023 3300005438 Bacteria 5424
67 Ga0070701_11072287 3300005438 Bacteria 566
68 Ga0070705_100052487 3300005440 Bacteria 2382
69 Ga0070700_100024808 3300005441 Bacteria 3526
70 Ga0070700_100854187 3300005441 Bacteria 737
71 Ga0070708_102090259 3300005445 Bacteria 524
72 Ga0070663_100099721 3300005455 Bacteria 2166
73 Ga0070663_100382113 3300005455 Unclassified 1147
74 Ga0070663_100426144 3300005455 Bacteria 1089
75 Ga0070678_100019284 3300005456 Bacteria 4443
76 Ga0070678_100093811 3300005456 Unclassified 2309
77 Ga0070678_101308050 3300005456 Unclassified 675
78 Ga0070678_101409162 3300005456 Bacteria 651
79 Ga0070678_102295950 3300005456 Bacteria 512
80 Ga0070662_100008794 3300005457 Bacteria 6586
81 Ga0070662_100464420 3300005457 Unclassified 1052
82 Ga0070662_101359677 3300005457 Bacteria 612
83 Ga0070681_10143620 3300005458 Bacteria 2316
84 Ga0070681_10325545 3300005458 Bacteria 1446
85 Ga0068867_100011666 3300005459 Bacteria 6206
86 Ga0068867_100095123 3300005459 Bacteria 2266
87 Ga0068867_100446742 3300005459 Bacteria 1101
88 Ga0068867_100532640 3300005459 Bacteria 1015
89 Ga0070685_10009536 3300005466 Bacteria 5020
90 Ga0070685_10041854 3300005466 Unclassified 2612
91 Ga0070698_100712639 3300005471 Bacteria 946
92 Ga0070679_100027697 3300005530 Bacteria 5580
93 Ga0070679_100924593 3300005530 Bacteria 816
94 Ga0070684_100016734 3300005535 Bacteria 6002
95 Ga0070684_100047370 3300005535 Bacteria 3725
96 Ga0070684_100053101 3300005535 Unclassified 3526
97 Ga0070684_100118958 3300005535 Bacteria 2375
98 Ga0070684_100687447 3300005535 Unclassified 953
99 Ga0068853_100002053 3300005539 Bacteria 14918
100 Ga0070672_100012897 3300005543 Bacteria 5888
101 Ga0070672_100019493 3300005543 Bacteria 4924
102 Ga0070672_100112092 3300005543 Unclassified 2225
103 Ga0070672_100491269 3300005543 Unclassified 1061
104 Ga0070686_100116613 3300005544 Unclassified 1828
105 Ga0070686_100943102 3300005544 Bacteria 704
106 Ga0070696_100178383 3300005546 Bacteria 1575
107 Ga0070696_101392235 3300005546 Bacteria 598
108 Ga0070693_100046774 3300005547 Bacteria 2459
109 Ga0070693_100609833 3300005547 Bacteria 789
110 Ga0070665_100087089 3300005548 Bacteria 3128
111 Ga0070665_100479102 3300005548 Bacteria 1255
112 Ga0070665_101567738 3300005548 Unclassified 667
113 Ga0068855_101222037 3300005563 Bacteria 781
114 Ga0070664_100011913 3300005564 Bacteria 7058
115 Ga0068857_100033412 3300005577 Bacteria 4549
116 Ga0068857_100105667 3300005577 Unclassified 2528
117 Ga0068857_100301716 3300005577 Unclassified 1477
118 Ga0068857_100450002 3300005577 Bacteria 1204
119 Ga0068854_100005835 3300005578 Bacteria 7796
120 Ga0068854_100274199 3300005578 Unclassified 1355
121 Ga0068856_100113518 3300005614 Unclassified 2707
122 Ga0070702_100009253 3300005615 Unclassified 4814
123 Ga0070702_100145435 3300005615 Unclassified 1515
124 Ga0068852_100002371 3300005616 Bacteria 12983
125 Ga0068859_100081776 3300005617 Bacteria 3272
126 Ga0068859_100476956 3300005617 Unclassified 1343
127 Ga0068864_100104963 3300005618 Unclassified 2511
128 Ga0068864_100856098 3300005618 Bacteria 896
129 Ga0068864_101261974 3300005618 Bacteria 738
130 Ga0068866_10050031 3300005718 Bacteria 2120
131 Ga0068866_10174499 3300005718 Unclassified 1264
132 Ga0068866_10197785 3300005718 Bacteria 1199
133 Ga0068866_10636179 3300005718 Bacteria 724
134 Ga0068866_10699229 3300005718 Bacteria 695
135 Ga0068866_10737600 3300005718 Bacteria 679
136 Ga0068866_10758397 3300005718 Bacteria 671
137 Ga0068861_100113603 3300005719 Bacteria 2173
138 Ga0068861_101756336 3300005719 Bacteria 614
139 Ga0068851_10134690 3300005834 Bacteria 1339
140 Ga0068851_10216565 3300005834 Bacteria 1074
141 Ga0068851_10493845 3300005834 Bacteria 733
142 Ga0068870_10000685 3300005840 Bacteria 12965
143 Ga0068870_10186527 3300005840 Unclassified 1249
144 Ga0068870_10655382 3300005840 Unclassified 720
145 Ga0068863_100098876 3300005841 Bacteria 2772
146 Ga0068863_101914888 3300005841 Bacteria 603
147 Ga0068858_100222261 3300005842 Bacteria 1789
148 Ga0068858_100575290 3300005842 Bacteria 1091
149 Ga0068860_100113669 3300005843 Bacteria 2589
150 Ga0068860_100179105 3300005843 Unclassified 2049
151 Ga0068860_100486778 3300005843 Unclassified 1230
152 Ga0068862_101127921 3300005844 Bacteria 780
153 Ga0081455_10011342 3300005937 Bacteria 8962
154 Ga0081455_10064761 3300005937 Bacteria 3059
155 Ga0081455_10071664 3300005937 Bacteria 2872
156 Ga0081538_10001394 3300005981 Bacteria 24783
157 Ga0081539_10001263 3300005985 Bacteria 44753
158 Ga0075365_10202266 3300006038 Bacteria 1391
159 Ga0075365_10760253 3300006038 Bacteria 684
160 Ga0075364_10101016 3300006051 Bacteria 1920
161 Ga0075364_11163294 3300006051 Bacteria 523
162 Ga0075367_10945511 3300006178 Unclassified 550
163 Ga0097621_100116158 3300006237 Unclassified 2266
164 Ga0097621_100249430 3300006237 Bacteria 1554
165 Ga0097621_100864649 3300006237 Bacteria 841
166 Ga0097621_100986186 3300006237 Unclassified 788
167 Ga0068871_100036187 3300006358 Bacteria 3929
168 Ga0068871_100641381 3300006358 Bacteria 969
169 Ga0075428_100188205 3300006844 Bacteria 2233
170 Ga0075430_100186571 3300006846 Bacteria 1724
171 Ga0075433_11707393 3300006852 Unclassified 542
172 Ga0075434_101462697 3300006871 Bacteria 693
173 Ga0075429_100633080 3300006880 Bacteria 937
174 Ga0075429_101707060 3300006880 Bacteria 547
175 Ga0068865_100014098 3300006881 Bacteria 5072
176 Ga0068865_100018100 3300006881 Bacteria 4541
177 Ga0068865_100212158 3300006881 Bacteria 1509
178 Ga0068865_100438663 3300006881 Bacteria 1077
179 Ga0068865_100823643 3300006881 Bacteria 802
180 Ga0097620_100081781 3300006931 Bacteria 3272
181 Ga0097620_100476918 3300006931 Unclassified 1343
182 Ga0105240_11877604 3300009093 Bacteria 623
183 Ga0105240_12621444 3300009093 Bacteria 521
184 Ga0111539_10006960 3300009094 Bacteria 14514
185 Ga0111539_10074007 3300009094 Bacteria 4015
186 Ga0111539_10385516 3300009094 Bacteria 1632
187 Ga0111539_11695879 3300009094 Unclassified 733
188 Ga0111539_11797939 3300009094 Unclassified 711
189 Ga0111539_12559193 3300009094 Bacteria 592
190 Ga0105245_10008068 3300009098 Bacteria 9206
191 Ga0105245_10068162 3300009098 Unclassified 3223
192 Ga0105245_10193633 3300009098 Bacteria 1949
193 Ga0105245_10265614 3300009098 Unclassified 1672
194 Ga0105245_10288603 3300009098 Bacteria 1606
195 Ga0105245_10364669 3300009098 Unclassified 1435
196 Ga0105245_10751275 3300009098 Bacteria 1011
197 Ga0105245_11863191 3300009098 Bacteria 654
198 Ga0105247_10041631 3300009101 Bacteria 2812
199 Ga0105247_10994977 3300009101 Bacteria 654
200 Ga0114129_10353057 3300009147 Bacteria 1947
201 Ga0114129_10451480 3300009147 Bacteria 1686
202 Ga0114129_10692940 3300009147 Bacteria 1310
203 Ga0114129_11077726 3300009147 Bacteria 1007
204 Ga0114129_11447774 3300009147 Bacteria 846
205 Ga0114129_11790774 3300009147 Bacteria 747
206 Ga0105243_10004018 3300009148 Bacteria 11716
207 Ga0105243_10007875 3300009148 Bacteria 8184
208 Ga0105243_10137679 3300009148 Bacteria 2079
209 Ga0105243_10372540 3300009148 Bacteria 1318
210 Ga0105243_11704686 3300009148 Unclassified 659
211 Ga0105243_12465050 3300009148 Bacteria 559
212 Ga0105242_10067548 3300009176 Unclassified 2956
213 Ga0105242_10142341 3300009176 Bacteria 2082
214 Ga0105242_10461250 3300009176 Bacteria 1200
215 Ga0105242_10791995 3300009176 Bacteria 937
216 Ga0105248_10286384 3300009177 Bacteria 1855
217 Ga0105248_10647613 3300009177 Unclassified 1192
218 Ga0105248_11043744 3300009177 Unclassified 923
219 Ga0105248_11414323 3300009177 Unclassified 787
220 Ga0105248_13468566 3300009177 Bacteria 501
221 Ga0105238_10021955 3300009551 Bacteria 6502
222 Ga0105238_10223925 3300009551 Bacteria 1858
223 Ga0105238_12682043 3300009551 Bacteria 535
224 Ga0105249_10015358 3300009553 Bacteria 6776
225 Ga0105249_10067152 3300009553 Bacteria 3303
226 Ga0105249_10067633 3300009553 Bacteria 3292
227 Ga0105239_10021141 3300010375 Bacteria 7178
228 Ga0105239_10218530 3300010375 Bacteria 2137
229 Ga0105239_10600201 3300010375 Bacteria 1256
230 Ga0105239_10683993 3300010375 Bacteria 1173
231 Ga0105246_10026274 3300011119 Bacteria 3802
232 Ga0105246_10078279 3300011119 Unclassified 2348
233 Ga0105246_10129824 3300011119 Bacteria 1880
234 Ga0157326_1070366 3300012513 Unclassified 553
235 Ga0157373_11393917 3300013100 Bacteria 533
236 Ga0157371_10003237 3300013102 Bacteria 14944
237 Ga0157369_10172235 3300013105 Bacteria 2280
238 Ga0157374_11181696 3300013296 Bacteria 786
239 Ga0157374_12227659 3300013296 Bacteria 575
240 Ga0157378_11015008 3300013297 Bacteria 864
241 Ga0157378_12537265 3300013297 Bacteria 565
242 Ga0163162_10076833 3300013306 Bacteria 3402
243 Ga0163162_10492366 3300013306 Unclassified 1357
244 Ga0163162_11856261 3300013306 Unclassified 689
245 Ga0157372_10008369 3300013307 Bacteria 10997
246 Ga0157372_12590993 3300013307 Unclassified 582
247 Ga0157375_10048535 3300013308 Bacteria 4153
248 Ga0157375_10720262 3300013308 Bacteria 1150
249 Ga0157375_11286039 3300013308 Unclassified 860
250 Ga0157375_12083114 3300013308 Bacteria 675
251 Ga0163163_10130751 3300014325 Unclassified 2551
252 Ga0163163_10289425 3300014325 Bacteria 1690
253 Ga0163163_10857583 3300014325 Unclassified 972
254 Ga0163163_10964601 3300014325 Bacteria 916
255 Ga0163163_11071496 3300014325 Unclassified 869
256 Ga0163163_11541761 3300014325 Bacteria 726
257 Ga0163163_11901115 3300014325 Bacteria 655
258 Ga0163163_12057016 3300014325 Bacteria 631
259 Ga0157380_10018392 3300014326 Bacteria 5186
260 Ga0157380_10031987 3300014326 Bacteria 4042
261 Ga0157380_10090420 3300014326 Unclassified 2525
262 Ga0157380_10277994 3300014326 Bacteria 1530
263 Ga0157380_11277449 3300014326 Bacteria 780
264 Ga0157380_12438997 3300014326 Bacteria 588
265 Ga0157380_12679987 3300014326 Bacteria 565
266 Ga0157377_10005725 3300014745 Bacteria 5860
267 Ga0157377_10046641 3300014745 Bacteria 2425
268 Ga0157377_10192467 3300014745 Bacteria 1290
269 Ga0157377_11492677 3300014745 Unclassified 537
270 Ga0157379_10349401 3300014968 Unclassified 1354
271 Ga0157379_11099008 3300014968 Bacteria 761
272 Ga0157379_11608103 3300014968 Unclassified 635
273 Ga0157376_10023873 3300014969 Bacteria 4794
274 Ga0157376_10228217 3300014969 Bacteria 1728
275 Ga0157376_10350635 3300014969 Bacteria 1412
276 Ga0157376_10384221 3300014969 Bacteria 1353
277 Ga0157376_10694176 3300014969 Unclassified 1022
278 Ga0163161_10135225 3300017792 Bacteria 1863
279 Ga0163161_10170556 3300017792 Unclassified 1663
280 Ga0163161_10616943 3300017792 Bacteria 896
281 Ga0207656_10288057 3300025321 Bacteria 811
282 Ga0207656_10397228 3300025321 Bacteria 693
283 Ga0207642_10034392 3300025899 Unclassified 2155
284 Ga0207688_10012183 3300025901 Bacteria 4678
285 Ga0207688_10014657 3300025901 Bacteria 4258
286 Ga0207688_10849052 3300025901 Bacteria 578
287 Ga0207680_10118518 3300025903 Bacteria 1728
288 Ga0207680_10726080 3300025903 Bacteria 712
289 Ga0207647_10084225 3300025904 Bacteria 1903
290 Ga0207645_10192233 3300025907 Unclassified 1342
291 Ga0207643_10002875 3300025908 Bacteria 9291
292 Ga0207643_10020606 3300025908 Bacteria 3620
293 Ga0207643_10131343 3300025908 Unclassified 1490
294 Ga0207643_10149907 3300025908 Unclassified 1398
295 Ga0207705_10142417 3300025909 Bacteria 1791
296 Ga0207654_10988194 3300025911 Bacteria 612
297 Ga0207707_10177704 3300025912 Unclassified 1859
298 Ga0207660_10178798 3300025917 Unclassified 1647
299 Ga0207662_10405667 3300025918 Bacteria 925
300 Ga0207657_10005874 3300025919 Bacteria 12787
301 Ga0207657_10115501 3300025919 Bacteria 2212
302 Ga0207649_10235848 3300025920 Unclassified 1311
303 Ga0207649_10477406 3300025920 Bacteria 945
304 Ga0207652_10163111 3300025921 Unclassified 1998
305 Ga0207652_10370220 3300025921 Bacteria 1293
306 Ga0207652_11817084 3300025921 Unclassified 514
307 Ga0207694_10085310 3300025924 Bacteria 2485
308 Ga0207650_10010107 3300025925 Bacteria 6466
309 Ga0207650_10336404 3300025925 Bacteria 1239
310 Ga0207650_10391692 3300025925 Unclassified 1149
311 Ga0207659_10125900 3300025926 Bacteria 1970
312 Ga0207687_10014081 3300025927 Bacteria 5230
313 Ga0207687_10095754 3300025927 Bacteria 2174
314 Ga0207687_10182411 3300025927 Bacteria 1627
315 Ga0207687_10675279 3300025927 Unclassified 875
316 Ga0207687_11263785 3300025927 Unclassified 635
317 Ga0207644_10107407 3300025931 Bacteria 2106
318 Ga0207644_10486246 3300025931 Bacteria 1017
319 Ga0207644_10761133 3300025931 Bacteria 809
320 Ga0207644_10971200 3300025931 Bacteria 713
321 Ga0207644_11483086 3300025931 Bacteria 569
322 Ga0207690_10558569 3300025932 Unclassified 931
323 Ga0207706_10006537 3300025933 Bacteria 10802
324 Ga0207706_10119519 3300025933 Bacteria 2317
325 Ga0207706_10330671 3300025933 Bacteria 1326
326 Ga0207686_10166983 3300025934 Bacteria 1548
327 Ga0207686_10251933 3300025934 Unclassified 1290
328 Ga0207686_10466096 3300025934 Bacteria 974
329 Ga0207686_10687048 3300025934 Bacteria 812
330 Ga0207686_11041167 3300025934 Bacteria 665
331 Ga0207709_10029522 3300025935 Unclassified 3182
332 Ga0207709_10041070 3300025935 Bacteria 2774
333 Ga0207709_10060410 3300025935 Bacteria 2363
334 Ga0207709_11296535 3300025935 Bacteria 602
335 Ga0207670_10012823 3300025936 Bacteria 4918
336 Ga0207669_10158728 3300025937 Bacteria 1594
337 Ga0207669_10208407 3300025937 Bacteria 1425
338 Ga0207669_10301324 3300025937 Unclassified 1218
339 Ga0207669_10511961 3300025937 Bacteria 962
340 Ga0207669_10521426 3300025937 Unclassified 954
341 Ga0207669_10897440 3300025937 Bacteria 740
342 Ga0207669_11100086 3300025937 Unclassified 671
343 Ga0207704_10061154 3300025938 Bacteria 2334
344 Ga0207704_11009042 3300025938 Bacteria 704
345 Ga0207704_11131668 3300025938 Unclassified 666
346 Ga0207704_11640817 3300025938 Bacteria 552
347 Ga0207691_10006369 3300025940 Bacteria 11405
348 Ga0207691_10008449 3300025940 Bacteria 9887
349 Ga0207691_10079394 3300025940 Unclassified 2953
350 Ga0207691_11183076 3300025940 Unclassified 634
351 Ga0207711_10158564 3300025941 Bacteria 2046
352 Ga0207711_10171587 3300025941 Bacteria 1968
353 Ga0207711_10216703 3300025941 Unclassified 1750
354 Ga0207661_10014245 3300025944 Bacteria 5823
355 Ga0207661_10035968 3300025944 Bacteria 3863
356 Ga0207661_10070450 3300025944 Bacteria 2855
357 Ga0207661_10389751 3300025944 Unclassified 1262
358 Ga0207661_10530880 3300025944 Bacteria 1077
359 Ga0207661_10960543 3300025944 Bacteria 787
360 Ga0207661_11704536 3300025944 Unclassified 575
361 Ga0207679_10335643 3300025945 Bacteria 1313
362 Ga0207679_11117337 3300025945 Unclassified 723
363 Ga0207667_10191644 3300025949 Bacteria 2098
364 Ga0207651_10068544 3300025960 Bacteria 2501
365 Ga0207651_10297401 3300025960 Unclassified 1341
366 Ga0207651_10939350 3300025960 Bacteria 771
367 Ga0207712_10052654 3300025961 Bacteria 2852
368 Ga0207712_10312348 3300025961 Bacteria 1294
369 Ga0207668_11681396 3300025972 Bacteria 573
370 Ga0207640_10044988 3300025981 Bacteria 2832
371 Ga0207640_11374061 3300025981 Bacteria 632
372 Ga0207658_10251207 3300025986 Bacteria 1503
373 Ga0207658_11069638 3300025986 Bacteria 737
374 Ga0207677_10210254 3300026023 Bacteria 1553
375 Ga0207677_10308783 3300026023 Bacteria 1310
376 Ga0207677_11499192 3300026023 Unclassified 623
377 Ga0207703_10080882 3300026035 Bacteria 2707
378 Ga0207703_10127398 3300026035 Unclassified 2194
379 Ga0207639_10184083 3300026041 Bacteria 1779
380 Ga0207639_10520389 3300026041 Bacteria 1089
381 Ga0207678_10046202 3300026067 Bacteria 3766
382 Ga0207678_10093063 3300026067 Bacteria 2576
383 Ga0207678_10418915 3300026067 Unclassified 1161
384 Ga0207678_10430975 3300026067 Bacteria 1144
385 Ga0207708_10038706 3300026075 Bacteria 3632
386 Ga0207708_10453528 3300026075 Unclassified 1068
387 Ga0207708_11101480 3300026075 Archaea 692
388 Ga0207708_11641790 3300026075 Bacteria 565
389 Ga0207702_10137847 3300026078 Unclassified 2204
390 Ga0207702_10151131 3300026078 Unclassified 2112
391 Ga0207641_10740567 3300026088 Unclassified 970
392 Ga0207641_10874658 3300026088 Unclassified 892
393 Ga0207641_12066872 3300026088 Unclassified 571
394 Ga0207648_10009895 3300026089 Bacteria 9090
395 Ga0207648_10092382 3300026089 Unclassified 2646
396 Ga0207648_10173742 3300026089 Unclassified 1905
397 Ga0207648_10658844 3300026089 Bacteria 968
398 Ga0207648_10745147 3300026089 Unclassified 910
399 Ga0207648_11187397 3300026089 Unclassified 717
400 Ga0207676_10029132 3300026095 Unclassified 4131
401 Ga0207676_10090067 3300026095 Bacteria 2516
402 Ga0207676_10572265 3300026095 Bacteria 1082
403 Ga0207674_10018022 3300026116 Bacteria 7691
404 Ga0207674_10281330 3300026116 Bacteria 1611
405 Ga0207674_10426357 3300026116 Bacteria 1282
406 Ga0207675_100084663 3300026118 Bacteria 2975
407 Ga0207675_100260370 3300026118 Bacteria 1681
408 Ga0207675_100285492 3300026118 Unclassified 1604
409 Ga0207683_10031736 3300026121 Bacteria 4586
410 Ga0207683_10094502 3300026121 Unclassified 2665
411 Ga0207683_10134886 3300026121 Bacteria 2222
412 Ga0207683_10319832 3300026121 Unclassified 1421
413 Ga0207683_10356898 3300026121 Bacteria 1342
414 Ga0207683_12196911 3300026121 Bacteria 500
415 Ga0207698_10028103 3300026142 Bacteria 4005
416 Ga0207698_10095357 3300026142 Bacteria 2449
417 Ga0207698_10518620 3300026142 Unclassified 1163
418 Ga0207698_10611624 3300026142 Unclassified 1075
419 Ga0268266_10409827 3300028379 Unclassified 1283
420 Ga0268265_10225582 3300028380 Unclassified 1643
421 Ga0268265_10327062 3300028380 Bacteria 1391
422 Ga0268265_11038064 3300028380 Bacteria 811
423 Ga0268264_10140205 3300028381 Bacteria 2155
424 Ga0268264_10265222 3300028381 Bacteria 1602
425 Ga0307408_100617055 3300031548 Unclassified 966
426 Ga0307408_102453957 3300031548 Bacteria 507
427 Ga0307409_102745913 3300031995 Bacteria 520
428 Ga0307416_100454147 3300032002 Bacteria 1335
429 Ga0373951_0137168 3300035091 Bacteria 677
430 Ga0373942_0111994 3300035207 Bacteria 845
431 Ga0451804_0721543 3300041463 Unclassified 1089
432 Ga0451807_1895063 3300041486 Bacteria 581
433 Ga0451853_2549579 3300041512 Bacteria 794
434 Ga0451853_2874699 3300041512 Bacteria 781
435 Ga0439463_013509 3300042016 Unclassified 2010
436 Ga0450902_105809 3300042137 Bacteria 502
437 Ga0450906_015068 3300042145 Unclassified 1408
438 Ga0450907_007288 3300042146 Bacteria 1848
439 Ga0450908_039235 3300042184 Unclassified 821
440 Ga0450918_081047 3300042531 Archaea 619
441 Ga0453683_0538970 3300044673 Bacteria 759
442 Ga0495603_0007432 3300046455 Bacteria 6590
443 Ga0495603_0146681 3300046455 Bacteria 1372
444 Ga0495603_0867761 3300046455 Bacteria 513
445 Ga0495641_0483541 3300046461 Unclassified 564
446 Ga0495653_0922998 3300046463 Bacteria 519
447 Ga0495582_0803114 3300046473 Bacteria 544
448 Ga0495631_0205104 3300046518 Bacteria 843
449 Ga0495631_0216032 3300046518 Bacteria 819
450 Ga0495644_0098290 3300046523 Bacteria 1107
451 Ga0495663_0265051 3300046525 Bacteria 613
452 Ga0495587_0550245 3300046536 Bacteria 637
453 Ga0495656_0016568 3300046615 Bacteria 2799
454 Ga0495656_0159212 3300046615 Bacteria 1096
455 Ga0495656_0262546 3300046615 Bacteria 875
456 Ga0495656_0292269 3300046615 Bacteria 833
457 Ga0495656_0569530 3300046615 Bacteria 605
458 Ga0495611_0354771 3300046648 Bacteria 673
459 Ga0495635_0169751 3300046663 Bacteria 1484
460 Ga0495588_0326999 3300046674 Unclassified 806
461 Ga0495588_0520010 3300046674 Bacteria 624
462 Ga0495657_0076277 3300046675 Bacteria 2177
463 Ga0495671_0170934 3300046692 Bacteria 1057
464 Ga0495589_0216495 3300046794 Bacteria 901
465 Ga0495589_0353498 3300046794 Bacteria 677
466 Ga0495604_0381666 3300047317 Bacteria 931
467 Ga0495674_0010972 3300047319 Bacteria 8560
468 Ga0496100_0421230 3300048903 Bacteria 1020
469 Ga0496100_0784341 3300048903 Bacteria 746
470 Ga0496101_0373463 3300048904 Bacteria 1121
471 Ga0496101_0719916 3300048904 Bacteria 788
472 Ga0496102_0374508 3300048905 Bacteria 1340
473 Ga0496102_1868497 3300048905 Bacteria 517
474 Ga0496104_0160961 3300048907 Unclassified 2153
475 Ga0496104_1450349 3300048907 Bacteria 589
476 Ga0496105_0154420 3300048908 Bacteria 1886
477 Ga0496105_0741211 3300048908 Bacteria 751
478 Ga0496107_0207087 3300048910 Unclassified 1458
479 Ga0496107_0311772 3300048910 Bacteria 1171
480 Ga0496107_0424615 3300048910 Bacteria 988
481 Ga0496108_0074930 3300048911 Unclassified 2858
482 Ga0496108_0631214 3300048911 Bacteria 932
483 Ga0496108_0640542 3300048911 Unclassified 924
484 Ga0496108_1437587 3300048911 Unclassified 576
485 Ga0496109_0246817 3300048912 Unclassified 1681
486 Ga0496109_1537389 3300048912 Unclassified 600
487 Ga0496110_0233407 3300048913 Unclassified 1673
488 Ga0496111_0021052 3300048914 Bacteria 4548
489 Ga0496111_0103492 3300048914 Unclassified 2094
490 Ga0496111_1261095 3300048914 Bacteria 522
491 Ga0496114_0048478 3300048917 Bacteria 3533
492 Ga0496114_0101719 3300048917 Bacteria 2454
493 Ga0496114_0544188 3300048917 Bacteria 1026
494 Ga0496114_0658644 3300048917 Bacteria 920
495 Ga0501031_0005742 3300049568 Bacteria 8085
496 Ga0501031_0030821 3300049568 Bacteria 3498
497 Ga0501031_0032813 3300049568 Bacteria 3386
498 Ga0501031_0172835 3300049568 Bacteria 1412
499 Ga0501031_0254597 3300049568 Unclassified 1141
500 Ga0501031_0331320 3300049568 Bacteria 986
501 Ga0501032_0294593 3300049569 Unclassified 1049
502 Ga0501033_0023999 3300049570 Bacteria 4601
503 Ga0501033_0223902 3300049570 Bacteria 1338
504 Ga0501034_0302561 3300049571 Bacteria 1536
505 Ga0501036_0015890 3300049572 Bacteria 6287
506 Ga0501036_0016429 3300049572 Bacteria 6181
507 Ga0501036_0019052 3300049572 Bacteria 5758
508 Ga0501036_0022425 3300049572 Bacteria 5311
509 Ga0501036_0126475 3300049572 Unclassified 2158
510 Ga0501036_0186225 3300049572 Unclassified 1747
511 Ga0501036_0490701 3300049572 Unclassified 1022
512 Ga0501036_0527690 3300049572 Bacteria 982
513 Ga0501037_0086920 3300049573 Bacteria 2263
514 Ga0501037_0230640 3300049573 Bacteria 1300
515 Ga0501038_0001233 3300049574 Bacteria 23205
516 Ga0501038_0063079 3300049574 Bacteria 3164
517 Ga0501038_0081404 3300049574 Bacteria 2728
518 Ga0501038_0086589 3300049574 Bacteria 2632
519 Ga0501038_0239779 3300049574 Bacteria 1440
520 Ga0501039_0002571 3300049575 Bacteria 13554
521 Ga0501039_0042951 3300049575 Bacteria 3492
522 Ga0501039_0202075 3300049575 Bacteria 1562
523 Ga0501039_0491962 3300049575 Unclassified 963
524 Ga0501040_0021623 3300049576 Bacteria 4298
525 Ga0501040_0057485 3300049576 Bacteria 2670
526 Ga0501040_0064842 3300049576 Bacteria 2515
527 Ga0501040_0177247 3300049576 Bacteria 1510
528 Ga0501040_0201982 3300049576 Bacteria 1411
529 Ga0501040_0216803 3300049576 Bacteria 1361
530 Ga0501040_0298707 3300049576 Unclassified 1151
531 Ga0501041_0016374 3300049577 Bacteria 4406
532 Ga0501041_0067223 3300049577 Bacteria 2197
533 Ga0501041_0084006 3300049577 Bacteria 1962
534 Ga0501041_0457128 3300049577 Bacteria 811
535 Ga0501041_0815030 3300049577 Bacteria 599
536 Ga0501042_0001944 3300049578 Bacteria 12443
537 Ga0501042_0013760 3300049578 Bacteria 5511
538 Ga0501042_0023089 3300049578 Bacteria 4348
539 Ga0501042_0029424 3300049578 Bacteria 3873
540 Ga0501042_0029643 3300049578 Bacteria 3860
541 Ga0501042_0066670 3300049578 Bacteria 2573
542 Ga0501043_0038684 3300049579 Bacteria 3751
543 Ga0501043_0060335 3300049579 Bacteria 2977
544 Ga0501043_0081171 3300049579 Bacteria 2548
545 Ga0501043_0128699 3300049579 Bacteria 1985
546 Ga0501046_0002238 3300049580 Bacteria 18255
547 Ga0501046_0046873 3300049580 Bacteria 3429
548 Ga0501046_0126345 3300049580 Unclassified 1942
549 Ga0501046_0287048 3300049580 Bacteria 1204
550 Ga0501048_0010299 3300049582 Bacteria 6988
551 Ga0501048_0022562 3300049582 Bacteria 4603
552 Ga0501048_0069452 3300049582 Bacteria 2488
553 Ga0501048_0079666 3300049582 Unclassified 2311
554 Ga0501048_0123624 3300049582 Bacteria 1829
555 Ga0501048_0835779 3300049582 Bacteria 662
556 Ga0501067_0007721 3300049583 Bacteria 5983
557 Ga0501067_0017547 3300049583 Bacteria 3961
558 Ga0501067_0403022 3300049583 Bacteria 763
559 Ga0501068_0032416 3300049584 Bacteria 3108
560 Ga0501068_0041064 3300049584 Bacteria 2779
561 Ga0501068_0340274 3300049584 Unclassified 963
562 Ga0501068_0973970 3300049584 Bacteria 559
563 Ga0501069_0007569 3300049585 Bacteria 5700
564 Ga0501069_0029282 3300049585 Bacteria 3022
565 Ga0501069_0056277 3300049585 Bacteria 2191
566 Ga0501069_0188959 3300049585 Bacteria 1192
567 Ga0501069_0383137 3300049585 Bacteria 831
568 Ga0501069_0590548 3300049585 Bacteria 666
569 Ga0501070_0021898 3300049586 Bacteria 5355
570 Ga0501070_0056221 3300049586 Bacteria 3262
571 Ga0501070_0078905 3300049586 Bacteria 2724
572 Ga0501070_0481905 3300049586 Archaea 998
573 Ga0501071_0015825 3300049587 Bacteria 5182
574 Ga0501071_0026430 3300049587 Bacteria 4074
575 Ga0501071_0041548 3300049587 Bacteria 3293
576 Ga0501071_0062523 3300049587 Bacteria 2697
577 Ga0501071_0081894 3300049587 Bacteria 2362
578 Ga0501071_0207622 3300049587 Bacteria 1472
579 Ga0501071_0249725 3300049587 Bacteria 1339
580 Ga0501071_0468716 3300049587 Bacteria 965
581 Ga0501071_0639434 3300049587 Bacteria 818
582 Ga0501071_1025061 3300049587 Bacteria 637
583 Ga0501072_0015977 3300049588 Bacteria 5755
584 Ga0501072_0041305 3300049588 Bacteria 3622
585 Ga0501072_0045386 3300049588 Bacteria 3455
586 Ga0501072_0069967 3300049588 Unclassified 2771
587 Ga0501072_0079048 3300049588 Bacteria 2604
588 Ga0501072_0104506 3300049588 Bacteria 2252
589 Ga0501072_0317278 3300049588 Bacteria 1238
590 Ga0501073_0053563 3300049589 Unclassified 2824
591 Ga0501073_0313037 3300049589 Bacteria 1083
592 Ga0501074_0015498 3300049590 Bacteria 5541
593 Ga0501074_0016179 3300049590 Bacteria 5420
594 Ga0501074_0019682 3300049590 Bacteria 4900
595 Ga0501074_0029712 3300049590 Bacteria 3959
596 Ga0501074_0227394 3300049590 Unclassified 1328
597 Ga0501074_0513004 3300049590 Bacteria 849
598 Ga0501074_0616857 3300049590 Bacteria 767
599 Ga0501075_0020640 3300049591 Bacteria 4794
600 Ga0501075_0029430 3300049591 Bacteria 4062
601 Ga0501075_0042558 3300049591 Unclassified 3405
602 Ga0501075_0072840 3300049591 Bacteria 2597
603 Ga0501075_0091945 3300049591 Bacteria 2302
604 Ga0501075_0101065 3300049591 Bacteria 2190
605 Ga0501075_0260162 3300049591 Unclassified 1323
606 Ga0501075_1055731 3300049591 Bacteria 617
607 Ga0501076_0017170 3300049592 Bacteria 5497
608 Ga0501076_0041066 3300049592 Bacteria 3637
609 Ga0501076_0042002 3300049592 Bacteria 3600
610 Ga0501076_0044689 3300049592 Bacteria 3493
611 Ga0501076_0069701 3300049592 Bacteria 2810
612 Ga0501076_0080631 3300049592 Unclassified 2613
613 Ga0501076_0108028 3300049592 Bacteria 2247
614 Ga0501076_0365248 3300049592 Unclassified 1186
615 Ga0501076_0392689 3300049592 Unclassified 1141
616 Ga0501076_0976121 3300049592 Bacteria 698
617 Ga0501076_1783658 3300049592 Bacteria 504
618 Ga0501077_0008860 3300049593 Bacteria 6243
619 Ga0501077_0015815 3300049593 Bacteria 4752
620 Ga0501077_0020119 3300049593 Bacteria 4224
621 Ga0501077_0028442 3300049593 Bacteria 3552
622 Ga0501077_0036010 3300049593 Bacteria 3152
623 Ga0501077_0048282 3300049593 Bacteria 2704
624 Ga0501077_0299344 3300049593 Bacteria 1025
625 Ga0501077_0539338 3300049593 Unclassified 748
626 Ga0501077_0688714 3300049593 Archaea 657
627 Ga0501079_0042134 3300049741 Bacteria 3526
628 Ga0501079_0052745 3300049741 Bacteria 3138
629 Ga0501079_0069293 3300049741 Bacteria 2722
630 Ga0501079_0086551 3300049741 Bacteria 2425
631 Ga0501079_0229335 3300049741 Bacteria 1451
632 Ga0501079_0366321 3300049741 Bacteria 1130
633 Ga0501080_0032915 3300049742 Bacteria 4837
634 Ga0501080_0033295 3300049742 Bacteria 4809
635 Ga0501080_0037636 3300049742 Bacteria 4518
636 Ga0501080_0056973 3300049742 Bacteria 3639
637 Ga0501080_0076337 3300049742 Bacteria 3117
638 Ga0501080_0097529 3300049742 Bacteria 2729
639 Ga0501080_0478851 3300049742 Bacteria 1114
640 Ga0501080_0610216 3300049742 Bacteria 968
641 Ga0501080_0783550 3300049742 Bacteria 837
642 Ga0501080_1268085 3300049742 Archaea 632
643 Ga0501081_0005337 3300049743 Bacteria 8292
644 Ga0501081_0017215 3300049743 Bacteria 4781
645 Ga0501081_0070783 3300049743 Bacteria 2430
646 Ga0501081_0096120 3300049743 Bacteria 2089
647 Ga0501081_0097930 3300049743 Bacteria 2070
648 Ga0501081_0150992 3300049743 Bacteria 1669
649 Ga0501081_0210410 3300049743 Bacteria 1412
650 Ga0501081_0218427 3300049743 Bacteria 1386
651 Ga0501083_0001237 3300049744 Bacteria 17325
652 Ga0501083_0019007 3300049744 Bacteria 4783
653 Ga0501083_0070801 3300049744 Bacteria 2319
654 Ga0501083_0078168 3300049744 Bacteria 2195
655 Ga0501083_0194040 3300049744 Unclassified 1325
656 Ga0501083_1112286 3300049744 Bacteria 514
657 Ga0501035_0006912 3300049822 Bacteria 10599
658 Ga0501035_0092494 3300049822 Bacteria 2661
659 Ga0501035_0242379 3300049822 Unclassified 1533
660 Ga0501035_0551313 3300049822 Bacteria 944
661 Ga0501044_0194459 3300049823 Bacteria 1989
662 Ga0501044_0317303 3300049823 Bacteria 1484
663 Ga0501045_0021740 3300049824 Bacteria 4593
664 Ga0501045_0026671 3300049824 Bacteria 4157
665 Ga0501045_0037507 3300049824 Bacteria 3523
666 Ga0501045_0046832 3300049824 Unclassified 3148
667 Ga0501045_0095884 3300049824 Bacteria 2194
668 Ga0501045_0154153 3300049824 Unclassified 1709
669 Ga0501045_0309378 3300049824 Bacteria 1176
670 Ga0501045_0371313 3300049824 Bacteria 1065
671 Ga0501045_0436225 3300049824 Bacteria 974
672 Ga0501045_0531236 3300049824 Bacteria 873
673 nmdc:mga00v17_167978_c1 3300050491 Bacteria 1414
674 nmdc:mga0yw44_15657_c1 3300050492 Bacteria 4070
675 nmdc:mga0yw44_707987_c1 3300050492 Bacteria 684
676 nmdc:mga06z11_392600_c1 3300050494 Bacteria 834
677 nmdc:mga05p37_1057987_c1 3300050507 Bacteria 855
678 nmdc:mga05p37_1712565_c1 3300050507 Bacteria 612
679 nmdc:mga05p37_2019990_c1 3300050507 Bacteria 544
680 nmdc:mga05p37_212203_c1 3300050507 Bacteria 2340
681 nmdc:mga05p37_265010_c1 3300050507 Bacteria 2055
682 nmdc:mga05p37_445176_c1 3300050507 Bacteria 1501
683 nmdc:mga09592_1144571_c1 3300050508 Bacteria 645
684 nmdc:mga0qj67_80648_c1 3300050509 Bacteria 2607
685 nmdc:mga06r32_73161_c1 3300050510 Bacteria 3319
686 nmdc:mga08y16_10062_c1 3300050511 Bacteria 9926
687 nmdc:mga08y16_258391_c1 3300050511 Bacteria 1799
688 nmdc:mga0n895_1869818_c1 3300050512 Unclassified 560
689 nmdc:mga0rr50_443861_c1 3300050513 Bacteria 1099
690 nmdc:mga08x19_1166353_c1 3300050514 Unclassified 546
691 nmdc:mga0a205_1344455_c1 3300050515 Bacteria 562
692 Ga0495619_0011342 3300053085 Bacteria 5611
693 Ga0501084_0006937 3300054114 Bacteria 9329
694 Ga0501084_0008276 3300054114 Bacteria 8580
695 Ga0501084_0038942 3300054114 Bacteria 3975
696 Ga0501084_0049123 3300054114 Bacteria 3531
697 Ga0501084_0104713 3300054114 Bacteria 2376
698 Ga0501084_0105788 3300054114 Bacteria 2363
699 Ga0501084_0427384 3300054114 Bacteria 1120
700 Ga0501084_0820090 3300054114 Unclassified 783
701 Ga0501082_0016449 3300060353 Bacteria 6367
702 Ga0501082_0017102 3300060353 Bacteria 6247
703 Ga0501082_0061060 3300060353 Bacteria 3245
704 Ga0501082_0119332 3300060353 Bacteria 2285
705 Ga0501082_0123555 3300060353 Bacteria 2244
706 Ga0501082_0188650 3300060353 Unclassified 1794
707 Ga0501082_0278193 3300060353 Bacteria 1457
708 Ga0501082_0357918 3300060353 Bacteria 1273
709 Ga0501082_0363187 3300060353 Bacteria 1263
710 Ga0501082_0518156 3300060353 Bacteria 1042
711 Ga0501082_0665664 3300060353 Unclassified 911
712 Ga0501082_1535340 3300060353 Bacteria 581
713 Ga0501082_1700359 3300060353 Bacteria 551
714 Ga0530510_0003037 3300061734 Bacteria 11528
715 Ga0530510_0059056 3300061734 Bacteria 2774
716 Ga0530510_0140380 3300061734 Bacteria 1780
717 Ga0530510_0642681 3300061734 Bacteria 808
718 Ga0530510_1013162 3300061734 Bacteria 636
719 Ga0530510_1194546 3300061734 Bacteria 583

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10971200 Ga0207644_109712002 81
2 3300026121 Ga0207683_12196911 Ga0207683_121969111 88
3 3300046463 Ga0495653_0922998 Ga0495653_0922998_12_335 88
4 3300046518 Ga0495631_0205104 Ga0495631_0205104_271_597 88
5 3300046536 Ga0495587_0550245 Ga0495587_0550245_64_387 88
6 3300046663 Ga0495635_0169751 Ga0495635_0169751_544_867 88
7 3300046675 Ga0495657_0076277 Ga0495657_0076277_223_546 88
8 3300047317 Ga0495604_0381666 Ga0495604_0381666_165_488 88
9 3300047319 Ga0495674_0010972 Ga0495674_0010972_2808_3131 88
10 3300053085 Ga0495619_0011342 Ga0495619_0011342_3392_3715 88
11 3300014325 Ga0163163_10964601 Ga0163163_109646012 89
12 3300014326 Ga0157380_12679987 Ga0157380_126799872 89
13 3300046455 Ga0495603_0867761 Ga0495603_0867761_19_345 89
14 3300046518 Ga0495631_0216032 Ga0495631_0216032_466_792 89
15 3300046674 Ga0495588_0326999 Ga0495588_0326999_365_691 89
16 3300048911 Ga0496108_1437587 Ga0496108_1437587_137_463 89
17 3300048912 Ga0496109_1537389 Ga0496109_1537389_119_445 89
18 3300049576 Ga0501040_0177247 Ga0501040_0177247_760_1074 95
19 3300049587 Ga0501071_1025061 Ga0501071_1025061_184_498 95
20 3300049741 Ga0501079_0229335 Ga0501079_0229335_189_503 95
21 3300049742 Ga0501080_0783550 Ga0501080_0783550_310_624 95
22 3300054114 Ga0501084_0820090 Ga0501084_0820090_29_343 95
23 3300005543 Ga0070672_100491269 Ga0070672_1004912693 96
24 3300005937 Ga0081455_10011342 Ga0081455_100113426 97
25 3300005981 Ga0081538_10001394 Ga0081538_1000139411 100
26 3300005354 Ga0070675_100238849 Ga0070675_1002388492 101
27 3300006237 Ga0097621_100249430 Ga0097621_1002494302 101
28 3300009098 Ga0105245_10288603 Ga0105245_102886032 101
29 3300009176 Ga0105242_10142341 Ga0105242_101423412 101
30 3300025927 Ga0207687_10182411 Ga0207687_101824112 101
31 3300025938 Ga0207704_11640817 Ga0207704_116408172 101
32 3300025940 Ga0207691_11183076 Ga0207691_111830762 101
33 3300046525 Ga0495663_0265051 Ga0495663_0265051_222_527 101
34 3300046674 Ga0495588_0520010 Ga0495588_0520010_83_388 101
35 3300005356 Ga0070674_100164746 Ga0070674_1001647462 102
36 3300005441 Ga0070700_100854187 Ga0070700_1008541871 102
37 3300006881 Ga0068865_100823643 Ga0068865_1008236432 102
38 3300009148 Ga0105243_10372540 Ga0105243_103725403 102
39 3300014326 Ga0157380_11277449 Ga0157380_112774492 102
40 3300025937 Ga0207669_10897440 Ga0207669_108974401 102
41 3300026075 Ga0207708_11641790 Ga0207708_116417902 102
42 3300048905 Ga0496102_1868497 Ga0496102_1868497_156_467 102
43 3300049583 Ga0501067_0017547 Ga0501067_0017547_2056_2367 102
44 3300049592 Ga0501076_0392689 Ga0501076_0392689_25_333 102
45 3300061734 Ga0530510_0642681 Ga0530510_0642681_364_675 102
46 3300005341 Ga0070691_10671094 Ga0070691_106710942 103
47 3300005356 Ga0070674_100175982 Ga0070674_1001759822 103
48 3300012513 Ga0157326_1070366 Ga0157326_10703662 103
49 3300014326 Ga0157380_12438997 Ga0157380_124389972 103
50 3300025937 Ga0207669_10511961 Ga0207669_105119611 103
51 3300049568 Ga0501031_0172835 Ga0501031_0172835_889_1200 103
52 3300049570 Ga0501033_0223902 Ga0501033_0223902_223_534 103
53 3300049572 Ga0501036_0019052 Ga0501036_0019052_3699_4010 103
54 3300049574 Ga0501038_0086589 Ga0501038_0086589_208_519 103
55 3300049574 Ga0501038_0239779 Ga0501038_0239779_532_843 103
56 3300049575 Ga0501039_0202075 Ga0501039_0202075_939_1250 103
57 3300049576 Ga0501040_0057485 Ga0501040_0057485_1733_2044 103
58 3300049578 Ga0501042_0013760 Ga0501042_0013760_4394_4705 103
59 3300049582 Ga0501048_0123624 Ga0501048_0123624_603_914 103
60 3300049584 Ga0501068_0973970 Ga0501068_0973970_122_433 103
61 3300049585 Ga0501069_0188959 Ga0501069_0188959_525_836 103
62 3300049587 Ga0501071_0062523 Ga0501071_0062523_1421_1732 103
63 3300049587 Ga0501071_0639434 Ga0501071_0639434_379_690 103
64 3300049588 Ga0501072_0079048 Ga0501072_0079048_647_958 103
65 3300049588 Ga0501072_0104506 Ga0501072_0104506_248_559 103
66 3300049588 Ga0501072_0317278 Ga0501072_0317278_619_930 103
67 3300049591 Ga0501075_0072840 Ga0501075_0072840_1587_1898 103
68 3300049591 Ga0501075_1055731 Ga0501075_1055731_134_445 103
69 3300049592 Ga0501076_0042002 Ga0501076_0042002_2428_2739 103
70 3300049592 Ga0501076_0069701 Ga0501076_0069701_2039_2350 103
71 3300049592 Ga0501076_0365248 Ga0501076_0365248_157_468 103
72 3300049592 Ga0501076_0976121 Ga0501076_0976121_17_331 103
73 3300049592 Ga0501076_1783658 Ga0501076_1783658_98_409 103
74 3300049593 Ga0501077_0048282 Ga0501077_0048282_979_1290 103
75 3300049593 Ga0501077_0299344 Ga0501077_0299344_625_939 103
76 3300049593 Ga0501077_0688714 Ga0501077_0688714_97_408 103
77 3300049742 Ga0501080_0032915 Ga0501080_0032915_4419_4730 103
78 3300049742 Ga0501080_0478851 Ga0501080_0478851_787_1098 103
79 3300049743 Ga0501081_0096120 Ga0501081_0096120_532_843 103
80 3300049743 Ga0501081_0210410 Ga0501081_0210410_415_726 103
81 3300049744 Ga0501083_0078168 Ga0501083_0078168_1716_2027 103
82 3300049822 Ga0501035_0242379 Ga0501035_0242379_475_786 103
83 3300049822 Ga0501035_0551313 Ga0501035_0551313_473_784 103
84 3300049824 Ga0501045_0037507 Ga0501045_0037507_599_910 103
85 3300050513 nmdc:mga0rr50_443861_c1 nmdc:mga0rr50_443861_c1_458_772 103
86 3300054114 Ga0501084_0049123 Ga0501084_0049123_2120_2431 103
87 3300054114 Ga0501084_0104713 Ga0501084_0104713_1431_1742 103
88 3300060353 Ga0501082_0016449 Ga0501082_0016449_2847_3158 103
89 3300060353 Ga0501082_0188650 Ga0501082_0188650_554_865 103
90 3300060353 Ga0501082_0518156 Ga0501082_0518156_699_1010 103
91 3300061734 Ga0530510_1194546 Ga0530510_1194546_101_412 103
92 3300005471 Ga0070698_100712639 Ga0070698_1007126392 104
93 3300005577 Ga0068857_100033412 Ga0068857_1000334123 104
94 3300005840 Ga0068870_10000685 Ga0068870_1000068511 104
95 3300006038 Ga0075365_10760253 Ga0075365_107602532 104
96 3300006051 Ga0075364_11163294 Ga0075364_111632942 104
97 3300006844 Ga0075428_100188205 Ga0075428_1001882053 104
98 3300006846 Ga0075430_100186571 Ga0075430_1001865712 104
99 3300006880 Ga0075429_100633080 Ga0075429_1006330802 104
100 3300006880 Ga0075429_101707060 Ga0075429_1017070602 104
101 3300006881 Ga0068865_100438663 Ga0068865_1004386632 104
102 3300009147 Ga0114129_10353057 Ga0114129_103530572 104
103 3300009147 Ga0114129_10451480 Ga0114129_104514802 104
104 3300009147 Ga0114129_10692940 Ga0114129_106929402 104
105 3300013297 Ga0157378_12537265 Ga0157378_125372652 104
106 3300025908 Ga0207643_10002875 Ga0207643_100028757 104
107 3300025925 Ga0207650_10010107 Ga0207650_100101074 104
108 3300025937 Ga0207669_11100086 Ga0207669_111000862 104
109 3300026095 Ga0207676_10572265 Ga0207676_105722651 104
110 3300042146 Ga0450907_007288 Ga0450907_007288_212_526 104
111 3300042531 Ga0450918_081047 Ga0450918_081047_23_337 104
112 3300046615 Ga0495656_0159212 Ga0495656_0159212_577_894 104
113 3300046615 Ga0495656_0569530 Ga0495656_0569530_209_523 104
114 3300049568 Ga0501031_0005742 Ga0501031_0005742_7736_8050 104
115 3300049571 Ga0501034_0302561 Ga0501034_0302561_498_812 104
116 3300049572 Ga0501036_0022425 Ga0501036_0022425_2020_2334 104
117 3300049574 Ga0501038_0001233 Ga0501038_0001233_10064_10378 104
118 3300049575 Ga0501039_0002571 Ga0501039_0002571_13130_13444 104
119 3300049577 Ga0501041_0016374 Ga0501041_0016374_2951_3265 104
120 3300049578 Ga0501042_0001944 Ga0501042_0001944_7569_7883 104
121 3300049579 Ga0501043_0038684 Ga0501043_0038684_1479_1793 104
122 3300049580 Ga0501046_0002238 Ga0501046_0002238_16935_17249 104
123 3300049582 Ga0501048_0010299 Ga0501048_0010299_812_1126 104
124 3300049583 Ga0501067_0007721 Ga0501067_0007721_1766_2080 104
125 3300049583 Ga0501067_0403022 Ga0501067_0403022_82_396 104
126 3300049585 Ga0501069_0029282 Ga0501069_0029282_299_613 104
127 3300049585 Ga0501069_0056277 Ga0501069_0056277_1115_1429 104
128 3300049585 Ga0501069_0383137 Ga0501069_0383137_341_655 104
129 3300049586 Ga0501070_0021898 Ga0501070_0021898_4836_5150 104
130 3300049587 Ga0501071_0026430 Ga0501071_0026430_2823_3137 104
131 3300049588 Ga0501072_0015977 Ga0501072_0015977_1195_1509 104
132 3300049589 Ga0501073_0313037 Ga0501073_0313037_675_989 104
133 3300049590 Ga0501074_0015498 Ga0501074_0015498_2136_2450 104
134 3300049591 Ga0501075_0029430 Ga0501075_0029430_643_957 104
135 3300049591 Ga0501075_0260162 Ga0501075_0260162_59_376 104
136 3300049592 Ga0501076_0017170 Ga0501076_0017170_2994_3308 104
137 3300049593 Ga0501077_0015815 Ga0501077_0015815_2868_3182 104
138 3300049593 Ga0501077_0028442 Ga0501077_0028442_2423_2779 104
139 3300049741 Ga0501079_0086551 Ga0501079_0086551_1089_1403 104
140 3300049742 Ga0501080_0037636 Ga0501080_0037636_1221_1535 104
141 3300049743 Ga0501081_0017215 Ga0501081_0017215_3323_3637 104
142 3300049744 Ga0501083_0001237 Ga0501083_0001237_13502_13816 104
143 3300049822 Ga0501035_0006912 Ga0501035_0006912_2984_3298 104
144 3300049823 Ga0501044_0317303 Ga0501044_0317303_331_645 104
145 3300049824 Ga0501045_0095884 Ga0501045_0095884_896_1210 104
146 3300049824 Ga0501045_0371313 Ga0501045_0371313_685_999 104
147 3300049824 Ga0501045_0436225 Ga0501045_0436225_398_712 104
148 3300050492 nmdc:mga0yw44_707987_c1 nmdc:mga0yw44_707987_c1_31_345 104
149 3300050507 nmdc:mga05p37_1057987_c1 nmdc:mga05p37_1057987_c1_527_841 104
150 3300050507 nmdc:mga05p37_1712565_c1 nmdc:mga05p37_1712565_c1_78_392 104
151 3300050507 nmdc:mga05p37_212203_c1 nmdc:mga05p37_212203_c1_1172_1486 104
152 3300050507 nmdc:mga05p37_265010_c1 nmdc:mga05p37_265010_c1_1242_1556 104
153 3300050508 nmdc:mga09592_1144571_c1 nmdc:mga09592_1144571_c1_234_548 104
154 3300050509 nmdc:mga0qj67_80648_c1 nmdc:mga0qj67_80648_c1_463_777 104
155 3300050510 nmdc:mga06r32_73161_c1 nmdc:mga06r32_73161_c1_2396_2710 104
156 3300054114 Ga0501084_0008276 Ga0501084_0008276_764_1078 104
157 3300060353 Ga0501082_0017102 Ga0501082_0017102_813_1127 104
158 3300060353 Ga0501082_0357918 Ga0501082_0357918_376_693 104
159 3300005577 Ga0068857_100450002 Ga0068857_1004500022 105
160 3300009094 Ga0111539_10074007 Ga0111539_100740072 105
161 3300009147 Ga0114129_11790774 Ga0114129_117907742 105
162 3300009148 Ga0105243_12465050 Ga0105243_124650501 105
163 3300014326 Ga0157380_10277994 Ga0157380_102779942 105
164 3300025937 Ga0207669_10208407 Ga0207669_102084072 105
165 3300026089 Ga0207648_10658844 Ga0207648_106588442 105
166 3300026116 Ga0207674_10018022 Ga0207674_100180225 105
167 3300026118 Ga0207675_100260370 Ga0207675_1002603702 105
168 3300046615 Ga0495656_0262546 Ga0495656_0262546_317_634 105
169 3300049568 Ga0501031_0331320 Ga0501031_0331320_603_920 105
170 3300049577 Ga0501041_0815030 Ga0501041_0815030_143_460 105
171 3300049590 Ga0501074_0513004 Ga0501074_0513004_474_791 105
172 3300049742 Ga0501080_0610216 Ga0501080_0610216_31_348 105
173 3300049824 Ga0501045_0309378 Ga0501045_0309378_654_971 105
174 3300050511 nmdc:mga08y16_258391_c1 nmdc:mga08y16_258391_c1_479_802 105
175 3300060353 Ga0501082_1700359 Ga0501082_1700359_65_382 105
176 3300005327 Ga0070658_10741140 Ga0070658_107411402 106
177 3300005329 Ga0070683_100163196 Ga0070683_1001631963 106
178 3300005329 Ga0070683_100204920 Ga0070683_1002049203 106
179 3300005329 Ga0070683_101284004 Ga0070683_1012840042 106
180 3300005336 Ga0070680_100013940 Ga0070680_1000139402 106
181 3300005337 Ga0070682_100376022 Ga0070682_1003760221 106
182 3300005347 Ga0070668_101775827 Ga0070668_1017758272 106
183 3300005354 Ga0070675_100264615 Ga0070675_1002646152 106
184 3300005356 Ga0070674_100741165 Ga0070674_1007411652 106
185 3300005455 Ga0070663_100426144 Ga0070663_1004261442 106
186 3300005456 Ga0070678_101409162 Ga0070678_1014091621 106
187 3300005459 Ga0068867_100532640 Ga0068867_1005326402 106
188 3300005530 Ga0070679_100924593 Ga0070679_1009245932 106
189 3300005535 Ga0070684_100047370 Ga0070684_1000473702 106
190 3300005535 Ga0070684_100687447 Ga0070684_1006874472 106
191 3300005546 Ga0070696_101392235 Ga0070696_1013922352 106
192 3300005718 Ga0068866_10699229 Ga0068866_106992292 106
193 3300005718 Ga0068866_10737600 Ga0068866_107376002 106
194 3300005937 Ga0081455_10064761 Ga0081455_100647613 106
195 3300005937 Ga0081455_10071664 Ga0081455_100716643 106
196 3300006038 Ga0075365_10202266 Ga0075365_102022663 106
197 3300006051 Ga0075364_10101016 Ga0075364_101010162 106
198 3300006178 Ga0075367_10945511 Ga0075367_109455111 106
199 3300006852 Ga0075433_11707393 Ga0075433_117073932 106
200 3300006871 Ga0075434_101462697 Ga0075434_1014626972 106
201 3300009098 Ga0105245_10751275 Ga0105245_107512752 106
202 3300009147 Ga0114129_11447774 Ga0114129_114477742 106
203 3300009176 Ga0105242_10791995 Ga0105242_107919952 106
204 3300009177 Ga0105248_13468566 Ga0105248_134685661 106
205 3300009553 Ga0105249_10067633 Ga0105249_100676333 106
206 3300010375 Ga0105239_10600201 Ga0105239_106002013 106
207 3300011119 Ga0105246_10129824 Ga0105246_101298243 106
208 3300013308 Ga0157375_10720262 Ga0157375_107202623 106
209 3300014325 Ga0163163_12057016 Ga0163163_120570162 106
210 3300014326 Ga0157380_10018392 Ga0157380_100183923 106
211 3300014745 Ga0157377_10046641 Ga0157377_100466412 106
212 3300014745 Ga0157377_10192467 Ga0157377_101924672 106
213 3300025921 Ga0207652_11817084 Ga0207652_118170842 106
214 3300025933 Ga0207706_10330671 Ga0207706_103306711 106
215 3300025934 Ga0207686_11041167 Ga0207686_110411672 106
216 3300025935 Ga0207709_11296535 Ga0207709_112965352 106
217 3300025937 Ga0207669_10158728 Ga0207669_101587282 106
218 3300025938 Ga0207704_11009042 Ga0207704_110090422 106
219 3300025944 Ga0207661_10014245 Ga0207661_100142455 106
220 3300025944 Ga0207661_10530880 Ga0207661_105308801 106
221 3300025945 Ga0207679_11117337 Ga0207679_111173372 106
222 3300025986 Ga0207658_11069638 Ga0207658_110696382 106
223 3300026041 Ga0207639_10520389 Ga0207639_105203892 106
224 3300026067 Ga0207678_10430975 Ga0207678_104309752 106
225 3300026075 Ga0207708_11101480 Ga0207708_111014802 106
226 3300026089 Ga0207648_10745147 Ga0207648_107451472 106
227 3300026121 Ga0207683_10356898 Ga0207683_103568983 106
228 3300026142 Ga0207698_10095357 Ga0207698_100953573 106
229 3300031548 Ga0307408_102453957 Ga0307408_1024539571 106
230 3300031995 Ga0307409_102745913 Ga0307409_1027459132 106
231 3300032002 Ga0307416_100454147 Ga0307416_1004541472 106
232 3300042137 Ga0450902_105809 Ga0450902_105809_131_454 106
233 3300042145 Ga0450906_015068 Ga0450906_015068_697_1020 106
234 3300042184 Ga0450908_039235 Ga0450908_039235_12_335 106
235 3300044673 Ga0453683_0538970 Ga0453683_0538970_120_440 106
236 3300048907 Ga0496104_1450349 Ga0496104_1450349_181_504 106
237 3300048908 Ga0496105_0154420 Ga0496105_0154420_32_355 106
238 3300048911 Ga0496108_0640542 Ga0496108_0640542_290_613 106
239 3300048917 Ga0496114_0544188 Ga0496114_0544188_383_706 106
240 3300049568 Ga0501031_0254597 Ga0501031_0254597_68_388 106
241 3300049572 Ga0501036_0016429 Ga0501036_0016429_587_910 106
242 3300049572 Ga0501036_0186225 Ga0501036_0186225_981_1301 106
243 3300049572 Ga0501036_0490701 Ga0501036_0490701_437_760 106
244 3300049572 Ga0501036_0527690 Ga0501036_0527690_592_912 106
245 3300049575 Ga0501039_0491962 Ga0501039_0491962_61_384 106
246 3300049576 Ga0501040_0064842 Ga0501040_0064842_782_1105 106
247 3300049576 Ga0501040_0216803 Ga0501040_0216803_499_819 106
248 3300049576 Ga0501040_0298707 Ga0501040_0298707_760_1083 106
249 3300049577 Ga0501041_0457128 Ga0501041_0457128_111_434 106
250 3300049578 Ga0501042_0023089 Ga0501042_0023089_2478_2801 106
251 3300049578 Ga0501042_0029643 Ga0501042_0029643_2882_3205 106
252 3300049579 Ga0501043_0128699 Ga0501043_0128699_1312_1635 106
253 3300049580 Ga0501046_0046873 Ga0501046_0046873_3003_3326 106
254 3300049582 Ga0501048_0022562 Ga0501048_0022562_649_972 106
255 3300049584 Ga0501068_0032416 Ga0501068_0032416_2746_3069 106
256 3300049584 Ga0501068_0340274 Ga0501068_0340274_466_789 106
257 3300049585 Ga0501069_0590548 Ga0501069_0590548_284_607 106
258 3300049586 Ga0501070_0056221 Ga0501070_0056221_2395_2718 106
259 3300049587 Ga0501071_0015825 Ga0501071_0015825_3989_4312 106
260 3300049587 Ga0501071_0041548 Ga0501071_0041548_598_921 106
261 3300049587 Ga0501071_0249725 Ga0501071_0249725_760_1080 106
262 3300049587 Ga0501071_0468716 Ga0501071_0468716_224_547 106
263 3300049588 Ga0501072_0045386 Ga0501072_0045386_2479_2802 106
264 3300049588 Ga0501072_0069967 Ga0501072_0069967_1667_1990 106
265 3300049590 Ga0501074_0029712 Ga0501074_0029712_2199_2522 106
266 3300049590 Ga0501074_0227394 Ga0501074_0227394_199_522 106
267 3300049590 Ga0501074_0616857 Ga0501074_0616857_159_479 106
268 3300049591 Ga0501075_0091945 Ga0501075_0091945_1432_1755 106
269 3300049591 Ga0501075_0101065 Ga0501075_0101065_688_1011 106
270 3300049592 Ga0501076_0080631 Ga0501076_0080631_710_1033 106
271 3300049592 Ga0501076_0108028 Ga0501076_0108028_178_498 106
272 3300049593 Ga0501077_0008860 Ga0501077_0008860_5421_5744 106
273 3300049593 Ga0501077_0036010 Ga0501077_0036010_1477_1800 106
274 3300049741 Ga0501079_0042134 Ga0501079_0042134_2624_2947 106
275 3300049741 Ga0501079_0366321 Ga0501079_0366321_525_845 106
276 3300049742 Ga0501080_0056973 Ga0501080_0056973_564_887 106
277 3300049742 Ga0501080_0076337 Ga0501080_0076337_2690_3013 106
278 3300049742 Ga0501080_1268085 Ga0501080_1268085_287_607 106
279 3300049743 Ga0501081_0005337 Ga0501081_0005337_455_778 106
280 3300049743 Ga0501081_0150992 Ga0501081_0150992_513_833 106
281 3300049743 Ga0501081_0218427 Ga0501081_0218427_882_1208 106
282 3300049744 Ga0501083_0019007 Ga0501083_0019007_2625_2948 106
283 3300049744 Ga0501083_1112286 Ga0501083_1112286_109_432 106
284 3300049824 Ga0501045_0021740 Ga0501045_0021740_1993_2316 106
285 3300049824 Ga0501045_0154153 Ga0501045_0154153_778_1101 106
286 3300049824 Ga0501045_0531236 Ga0501045_0531236_92_412 106
287 3300050491 nmdc:mga00v17_167978_c1 nmdc:mga00v17_167978_c1_137_460 106
288 3300050492 nmdc:mga0yw44_15657_c1 nmdc:mga0yw44_15657_c1_2810_3133 106
289 3300050494 nmdc:mga06z11_392600_c1 nmdc:mga06z11_392600_c1_481_804 106
290 3300050507 nmdc:mga05p37_2019990_c1 nmdc:mga05p37_2019990_c1_145_468 106
291 3300050512 nmdc:mga0n895_1869818_c1 nmdc:mga0n895_1869818_c1_62_385 106
292 3300054114 Ga0501084_0006937 Ga0501084_0006937_8376_8699 106
293 3300054114 Ga0501084_0427384 Ga0501084_0427384_508_831 106
294 3300060353 Ga0501082_0061060 Ga0501082_0061060_2630_2953 106
295 3300060353 Ga0501082_0278193 Ga0501082_0278193_742_1065 106
296 3300060353 Ga0501082_0363187 Ga0501082_0363187_453_773 106
297 3300060353 Ga0501082_0665664 Ga0501082_0665664_58_384 106
298 3300060353 Ga0501082_1535340 Ga0501082_1535340_152_475 106
299 3300061734 Ga0530510_0059056 Ga0530510_0059056_664_987 106
300 3300061734 Ga0530510_1013162 Ga0530510_1013162_38_358 106
301 3300005327 Ga0070658_10020806 Ga0070658_100208062 107
302 3300005327 Ga0070658_10125516 Ga0070658_101255163 107
303 3300005328 Ga0070676_10199609 Ga0070676_101996093 107
304 3300005329 Ga0070683_100012761 Ga0070683_1000127613 107
305 3300005329 Ga0070683_100116559 Ga0070683_1001165593 107
306 3300005329 Ga0070683_100266500 Ga0070683_1002665003 107
307 3300005329 Ga0070683_101176794 Ga0070683_1011767942 107
308 3300005329 Ga0070683_101772363 Ga0070683_1017723632 107
309 3300005331 Ga0070670_102072541 Ga0070670_1020725411 107
310 3300005333 Ga0070677_10238963 Ga0070677_102389632 107
311 3300005334 Ga0068869_100109629 Ga0068869_1001096292 107
312 3300005335 Ga0070666_10172962 Ga0070666_101729622 107
313 3300005336 Ga0070680_100044542 Ga0070680_1000445424 107
314 3300005337 Ga0070682_100001712 Ga0070682_1000017129 107
315 3300005337 Ga0070682_100202698 Ga0070682_1002026983 107
316 3300005337 Ga0070682_100230701 Ga0070682_1002307012 107
317 3300005337 Ga0070682_100778705 Ga0070682_1007787052 107
318 3300005338 Ga0068868_100013592 Ga0068868_1000135923 107
319 3300005338 Ga0068868_100060980 Ga0068868_1000609802 107
320 3300005339 Ga0070660_100006223 Ga0070660_1000062235 107
321 3300005339 Ga0070660_100504565 Ga0070660_1005045652 107
322 3300005341 Ga0070691_10000781 Ga0070691_1000078110 107
323 3300005341 Ga0070691_10454999 Ga0070691_104549992 107
324 3300005343 Ga0070687_100011765 Ga0070687_1000117653 107
325 3300005343 Ga0070687_100165662 Ga0070687_1001656622 107
326 3300005344 Ga0070661_100051608 Ga0070661_1000516082 107
327 3300005344 Ga0070661_100150713 Ga0070661_1001507133 107
328 3300005345 Ga0070692_10004463 Ga0070692_100044633 107
329 3300005347 Ga0070668_100174976 Ga0070668_1001749762 107
330 3300005347 Ga0070668_101100576 Ga0070668_1011005762 107
331 3300005347 Ga0070668_101394095 Ga0070668_1013940952 107
332 3300005353 Ga0070669_100128448 Ga0070669_1001284481 107
333 3300005353 Ga0070669_100669026 Ga0070669_1006690261 107
334 3300005354 Ga0070675_100013253 Ga0070675_1000132538 107
335 3300005354 Ga0070675_100143919 Ga0070675_1001439191 107
336 3300005354 Ga0070675_100176508 Ga0070675_1001765082 107
337 3300005355 Ga0070671_100127913 Ga0070671_1001279132 107
338 3300005355 Ga0070671_100134573 Ga0070671_1001345732 107
339 3300005355 Ga0070671_100198696 Ga0070671_1001986962 107
340 3300005355 Ga0070671_100262053 Ga0070671_1002620533 107
341 3300005355 Ga0070671_100577024 Ga0070671_1005770241 107
342 3300005356 Ga0070674_100024608 Ga0070674_1000246084 107
343 3300005356 Ga0070674_100026395 Ga0070674_1000263953 107
344 3300005356 Ga0070674_100035054 Ga0070674_1000350543 107
345 3300005356 Ga0070674_100215709 Ga0070674_1002157092 107
346 3300005356 Ga0070674_100343715 Ga0070674_1003437152 107
347 3300005364 Ga0070673_100001958 Ga0070673_1000019587 107
348 3300005364 Ga0070673_100058421 Ga0070673_1000584213 107
349 3300005364 Ga0070673_100346818 Ga0070673_1003468182 107
350 3300005366 Ga0070659_100006531 Ga0070659_1000065317 107
351 3300005366 Ga0070659_100212870 Ga0070659_1002128702 107
352 3300005366 Ga0070659_100843002 Ga0070659_1008430022 107
353 3300005438 Ga0070701_10005023 Ga0070701_100050235 107
354 3300005438 Ga0070701_11072287 Ga0070701_110722872 107
355 3300005440 Ga0070705_100052487 Ga0070705_1000524872 107
356 3300005441 Ga0070700_100024808 Ga0070700_1000248084 107
357 3300005445 Ga0070708_102090259 Ga0070708_1020902592 107
358 3300005455 Ga0070663_100099721 Ga0070663_1000997212 107
359 3300005455 Ga0070663_100382113 Ga0070663_1003821133 107
360 3300005456 Ga0070678_100019284 Ga0070678_1000192843 107
361 3300005456 Ga0070678_100093811 Ga0070678_1000938112 107
362 3300005456 Ga0070678_101308050 Ga0070678_1013080501 107
363 3300005456 Ga0070678_102295950 Ga0070678_1022959502 107
364 3300005457 Ga0070662_100008794 Ga0070662_1000087943 107
365 3300005457 Ga0070662_100464420 Ga0070662_1004644201 107
366 3300005457 Ga0070662_101359677 Ga0070662_1013596772 107
367 3300005458 Ga0070681_10143620 Ga0070681_101436202 107
368 3300005458 Ga0070681_10325545 Ga0070681_103255452 107
369 3300005459 Ga0068867_100011666 Ga0068867_1000116664 107
370 3300005459 Ga0068867_100095123 Ga0068867_1000951232 107
371 3300005459 Ga0068867_100446742 Ga0068867_1004467421 107
372 3300005466 Ga0070685_10009536 Ga0070685_100095362 107
373 3300005466 Ga0070685_10041854 Ga0070685_100418543 107
374 3300005530 Ga0070679_100027697 Ga0070679_1000276976 107
375 3300005535 Ga0070684_100016734 Ga0070684_1000167346 107
376 3300005535 Ga0070684_100053101 Ga0070684_1000531012 107
377 3300005535 Ga0070684_100118958 Ga0070684_1001189582 107
378 3300005539 Ga0068853_100002053 Ga0068853_10000205314 107
379 3300005543 Ga0070672_100012897 Ga0070672_1000128974 107
380 3300005543 Ga0070672_100019493 Ga0070672_1000194935 107
381 3300005543 Ga0070672_100112092 Ga0070672_1001120922 107
382 3300005544 Ga0070686_100116613 Ga0070686_1001166133 107
383 3300005544 Ga0070686_100943102 Ga0070686_1009431021 107
384 3300005546 Ga0070696_100178383 Ga0070696_1001783833 107
385 3300005547 Ga0070693_100046774 Ga0070693_1000467742 107
386 3300005547 Ga0070693_100609833 Ga0070693_1006098332 107
387 3300005548 Ga0070665_100087089 Ga0070665_1000870893 107
388 3300005548 Ga0070665_100479102 Ga0070665_1004791022 107
389 3300005548 Ga0070665_101567738 Ga0070665_1015677382 107
390 3300005563 Ga0068855_101222037 Ga0068855_1012220372 107
391 3300005564 Ga0070664_100011913 Ga0070664_1000119137 107
392 3300005577 Ga0068857_100105667 Ga0068857_1001056672 107
393 3300005577 Ga0068857_100301716 Ga0068857_1003017163 107
394 3300005578 Ga0068854_100005835 Ga0068854_1000058354 107
395 3300005578 Ga0068854_100274199 Ga0068854_1002741992 107
396 3300005614 Ga0068856_100113518 Ga0068856_1001135184 107
397 3300005615 Ga0070702_100009253 Ga0070702_1000092536 107
398 3300005615 Ga0070702_100145435 Ga0070702_1001454353 107
399 3300005616 Ga0068852_100002371 Ga0068852_1000023718 107
400 3300005617 Ga0068859_100081776 Ga0068859_1000817763 107
401 3300005617 Ga0068859_100476956 Ga0068859_1004769562 107
402 3300005618 Ga0068864_100104963 Ga0068864_1001049633 107
403 3300005618 Ga0068864_100856098 Ga0068864_1008560982 107
404 3300005618 Ga0068864_101261974 Ga0068864_1012619742 107
405 3300005718 Ga0068866_10050031 Ga0068866_100500313 107
406 3300005718 Ga0068866_10174499 Ga0068866_101744992 107
407 3300005718 Ga0068866_10197785 Ga0068866_101977852 107
408 3300005718 Ga0068866_10636179 Ga0068866_106361792 107
409 3300005718 Ga0068866_10758397 Ga0068866_107583972 107
410 3300005719 Ga0068861_100113603 Ga0068861_1001136032 107
411 3300005719 Ga0068861_101756336 Ga0068861_1017563361 107
412 3300005834 Ga0068851_10134690 Ga0068851_101346903 107
413 3300005834 Ga0068851_10216565 Ga0068851_102165653 107
414 3300005834 Ga0068851_10493845 Ga0068851_104938452 107
415 3300005840 Ga0068870_10186527 Ga0068870_101865272 107
416 3300005840 Ga0068870_10655382 Ga0068870_106553822 107
417 3300005841 Ga0068863_100098876 Ga0068863_1000988762 107
418 3300005841 Ga0068863_101914888 Ga0068863_1019148882 107
419 3300005842 Ga0068858_100222261 Ga0068858_1002222612 107
420 3300005842 Ga0068858_100575290 Ga0068858_1005752903 107
421 3300005843 Ga0068860_100113669 Ga0068860_1001136692 107
422 3300005843 Ga0068860_100179105 Ga0068860_1001791052 107
423 3300005843 Ga0068860_100486778 Ga0068860_1004867782 107
424 3300005844 Ga0068862_101127921 Ga0068862_1011279212 107
425 3300005985 Ga0081539_10001263 Ga0081539_1000126329 107
426 3300006237 Ga0097621_100116158 Ga0097621_1001161583 107
427 3300006237 Ga0097621_100864649 Ga0097621_1008646491 107
428 3300006237 Ga0097621_100986186 Ga0097621_1009861862 107
429 3300006358 Ga0068871_100036187 Ga0068871_1000361873 107
430 3300006358 Ga0068871_100641381 Ga0068871_1006413812 107
431 3300006881 Ga0068865_100014098 Ga0068865_1000140985 107
432 3300006881 Ga0068865_100018100 Ga0068865_1000181002 107
433 3300006881 Ga0068865_100212158 Ga0068865_1002121582 107
434 3300006931 Ga0097620_100081781 Ga0097620_1000817812 107
435 3300006931 Ga0097620_100476918 Ga0097620_1004769182 107
436 3300009093 Ga0105240_11877604 Ga0105240_118776042 107
437 3300009093 Ga0105240_12621444 Ga0105240_126214441 107
438 3300009094 Ga0111539_10006960 Ga0111539_1000696012 107
439 3300009094 Ga0111539_10385516 Ga0111539_103855162 107
440 3300009094 Ga0111539_11695879 Ga0111539_116958792 107
441 3300009094 Ga0111539_11797939 Ga0111539_117979392 107
442 3300009094 Ga0111539_12559193 Ga0111539_125591932 107
443 3300009098 Ga0105245_10008068 Ga0105245_100080687 107
444 3300009098 Ga0105245_10068162 Ga0105245_100681623 107
445 3300009098 Ga0105245_10193633 Ga0105245_101936333 107
446 3300009098 Ga0105245_10265614 Ga0105245_102656142 107
447 3300009098 Ga0105245_10364669 Ga0105245_103646693 107
448 3300009098 Ga0105245_11863191 Ga0105245_118631912 107
449 3300009101 Ga0105247_10041631 Ga0105247_100416312 107
450 3300009101 Ga0105247_10994977 Ga0105247_109949772 107
451 3300009147 Ga0114129_11077726 Ga0114129_110777262 107
452 3300009148 Ga0105243_10004018 Ga0105243_1000401816 107
453 3300009148 Ga0105243_10007875 Ga0105243_100078758 107
454 3300009148 Ga0105243_10137679 Ga0105243_101376792 107
455 3300009148 Ga0105243_11704686 Ga0105243_117046862 107
456 3300009176 Ga0105242_10067548 Ga0105242_100675483 107
457 3300009176 Ga0105242_10461250 Ga0105242_104612502 107
458 3300009177 Ga0105248_10286384 Ga0105248_102863843 107
459 3300009177 Ga0105248_10647613 Ga0105248_106476133 107
460 3300009177 Ga0105248_11043744 Ga0105248_110437442 107
461 3300009177 Ga0105248_11414323 Ga0105248_114143232 107
462 3300009551 Ga0105238_10021955 Ga0105238_100219557 107
463 3300009551 Ga0105238_10223925 Ga0105238_102239253 107
464 3300009551 Ga0105238_12682043 Ga0105238_126820431 107
465 3300009553 Ga0105249_10015358 Ga0105249_100153584 107
466 3300009553 Ga0105249_10067152 Ga0105249_100671523 107
467 3300010375 Ga0105239_10021141 Ga0105239_100211414 107
468 3300010375 Ga0105239_10218530 Ga0105239_102185302 107
469 3300010375 Ga0105239_10683993 Ga0105239_106839932 107
470 3300011119 Ga0105246_10026274 Ga0105246_100262743 107
471 3300011119 Ga0105246_10078279 Ga0105246_100782793 107
472 3300013100 Ga0157373_11393917 Ga0157373_113939171 107
473 3300013102 Ga0157371_10003237 Ga0157371_100032378 107
474 3300013105 Ga0157369_10172235 Ga0157369_101722352 107
475 3300013296 Ga0157374_11181696 Ga0157374_111816962 107
476 3300013296 Ga0157374_12227659 Ga0157374_122276591 107
477 3300013297 Ga0157378_11015008 Ga0157378_110150081 107
478 3300013306 Ga0163162_10076833 Ga0163162_100768335 107
479 3300013306 Ga0163162_10492366 Ga0163162_104923662 107
480 3300013306 Ga0163162_11856261 Ga0163162_118562611 107
481 3300013307 Ga0157372_10008369 Ga0157372_100083698 107
482 3300013307 Ga0157372_12590993 Ga0157372_125909932 107
483 3300013308 Ga0157375_10048535 Ga0157375_100485353 107
484 3300013308 Ga0157375_11286039 Ga0157375_112860392 107
485 3300013308 Ga0157375_12083114 Ga0157375_120831142 107
486 3300014325 Ga0163163_10130751 Ga0163163_101307513 107
487 3300014325 Ga0163163_10289425 Ga0163163_102894253 107
488 3300014325 Ga0163163_10857583 Ga0163163_108575831 107
489 3300014325 Ga0163163_11071496 Ga0163163_110714962 107
490 3300014325 Ga0163163_11541761 Ga0163163_115417611 107
491 3300014325 Ga0163163_11901115 Ga0163163_119011151 107
492 3300014326 Ga0157380_10031987 Ga0157380_100319873 107
493 3300014326 Ga0157380_10090420 Ga0157380_100904204 107
494 3300014745 Ga0157377_10005725 Ga0157377_100057252 107
495 3300014745 Ga0157377_11492677 Ga0157377_114926771 107
496 3300014968 Ga0157379_10349401 Ga0157379_103494013 107
497 3300014968 Ga0157379_11099008 Ga0157379_110990082 107
498 3300014968 Ga0157379_11608103 Ga0157379_116081032 107
499 3300014969 Ga0157376_10023873 Ga0157376_100238736 107
500 3300014969 Ga0157376_10228217 Ga0157376_102282172 107
501 3300014969 Ga0157376_10350635 Ga0157376_103506352 107
502 3300014969 Ga0157376_10384221 Ga0157376_103842212 107
503 3300014969 Ga0157376_10694176 Ga0157376_106941763 107
504 3300017792 Ga0163161_10135225 Ga0163161_101352252 107
505 3300017792 Ga0163161_10170556 Ga0163161_101705562 107
506 3300017792 Ga0163161_10616943 Ga0163161_106169433 107
507 3300025321 Ga0207656_10288057 Ga0207656_102880572 107
508 3300025321 Ga0207656_10397228 Ga0207656_103972282 107
509 3300025899 Ga0207642_10034392 Ga0207642_100343923 107
510 3300025901 Ga0207688_10012183 Ga0207688_100121833 107
511 3300025901 Ga0207688_10014657 Ga0207688_100146573 107
512 3300025901 Ga0207688_10849052 Ga0207688_108490522 107
513 3300025903 Ga0207680_10118518 Ga0207680_101185182 107
514 3300025903 Ga0207680_10726080 Ga0207680_107260802 107
515 3300025904 Ga0207647_10084225 Ga0207647_100842253 107
516 3300025907 Ga0207645_10192233 Ga0207645_101922333 107
517 3300025908 Ga0207643_10020606 Ga0207643_100206062 107
518 3300025908 Ga0207643_10131343 Ga0207643_101313432 107
519 3300025908 Ga0207643_10149907 Ga0207643_101499072 107
520 3300025909 Ga0207705_10142417 Ga0207705_101424173 107
521 3300025911 Ga0207654_10988194 Ga0207654_109881941 107
522 3300025912 Ga0207707_10177704 Ga0207707_101777042 107
523 3300025917 Ga0207660_10178798 Ga0207660_101787983 107
524 3300025918 Ga0207662_10405667 Ga0207662_104056672 107
525 3300025919 Ga0207657_10005874 Ga0207657_100058749 107
526 3300025919 Ga0207657_10115501 Ga0207657_101155012 107
527 3300025920 Ga0207649_10235848 Ga0207649_102358483 107
528 3300025920 Ga0207649_10477406 Ga0207649_104774062 107
529 3300025921 Ga0207652_10163111 Ga0207652_101631113 107
530 3300025921 Ga0207652_10370220 Ga0207652_103702203 107
531 3300025924 Ga0207694_10085310 Ga0207694_100853103 107
532 3300025925 Ga0207650_10336404 Ga0207650_103364042 107
533 3300025925 Ga0207650_10391692 Ga0207650_103916922 107
534 3300025926 Ga0207659_10125900 Ga0207659_101259002 107
535 3300025927 Ga0207687_10014081 Ga0207687_100140811 107
536 3300025927 Ga0207687_10095754 Ga0207687_100957544 107
537 3300025927 Ga0207687_10675279 Ga0207687_106752792 107
538 3300025927 Ga0207687_11263785 Ga0207687_112637852 107
539 3300025931 Ga0207644_10107407 Ga0207644_101074072 107
540 3300025931 Ga0207644_10486246 Ga0207644_104862463 107
541 3300025931 Ga0207644_10761133 Ga0207644_107611332 107
542 3300025931 Ga0207644_11483086 Ga0207644_114830862 107
543 3300025932 Ga0207690_10558569 Ga0207690_105585691 107
544 3300025933 Ga0207706_10006537 Ga0207706_100065377 107
545 3300025933 Ga0207706_10119519 Ga0207706_101195192 107
546 3300025934 Ga0207686_10166983 Ga0207686_101669833 107
547 3300025934 Ga0207686_10251933 Ga0207686_102519332 107
548 3300025934 Ga0207686_10466096 Ga0207686_104660961 107
549 3300025934 Ga0207686_10687048 Ga0207686_106870481 107
550 3300025935 Ga0207709_10029522 Ga0207709_100295223 107
551 3300025935 Ga0207709_10041070 Ga0207709_100410701 107
552 3300025935 Ga0207709_10060410 Ga0207709_100604102 107
553 3300025936 Ga0207670_10012823 Ga0207670_100128235 107
554 3300025937 Ga0207669_10301324 Ga0207669_103013243 107
555 3300025937 Ga0207669_10521426 Ga0207669_105214262 107
556 3300025938 Ga0207704_10061154 Ga0207704_100611542 107
557 3300025938 Ga0207704_11131668 Ga0207704_111316681 107
558 3300025940 Ga0207691_10006369 Ga0207691_100063696 107
559 3300025940 Ga0207691_10008449 Ga0207691_100084497 107
560 3300025940 Ga0207691_10079394 Ga0207691_100793944 107
561 3300025941 Ga0207711_10158564 Ga0207711_101585642 107
562 3300025941 Ga0207711_10171587 Ga0207711_101715873 107
563 3300025941 Ga0207711_10216703 Ga0207711_102167033 107
564 3300025944 Ga0207661_10035968 Ga0207661_100359683 107
565 3300025944 Ga0207661_10070450 Ga0207661_100704504 107
566 3300025944 Ga0207661_10389751 Ga0207661_103897512 107
567 3300025944 Ga0207661_10960543 Ga0207661_109605432 107
568 3300025944 Ga0207661_11704536 Ga0207661_117045361 107
569 3300025945 Ga0207679_10335643 Ga0207679_103356433 107
570 3300025949 Ga0207667_10191644 Ga0207667_101916442 107
571 3300025960 Ga0207651_10068544 Ga0207651_100685443 107
572 3300025960 Ga0207651_10297401 Ga0207651_102974013 107
573 3300025960 Ga0207651_10939350 Ga0207651_109393502 107
574 3300025961 Ga0207712_10052654 Ga0207712_100526542 107
575 3300025961 Ga0207712_10312348 Ga0207712_103123482 107
576 3300025972 Ga0207668_11681396 Ga0207668_116813962 107
577 3300025981 Ga0207640_10044988 Ga0207640_100449883 107
578 3300025981 Ga0207640_11374061 Ga0207640_113740611 107
579 3300025986 Ga0207658_10251207 Ga0207658_102512073 107
580 3300026023 Ga0207677_10210254 Ga0207677_102102543 107
581 3300026023 Ga0207677_10308783 Ga0207677_103087832 107
582 3300026023 Ga0207677_11499192 Ga0207677_114991922 107
583 3300026035 Ga0207703_10080882 Ga0207703_100808822 107
584 3300026035 Ga0207703_10127398 Ga0207703_101273982 107
585 3300026041 Ga0207639_10184083 Ga0207639_101840833 107
586 3300026067 Ga0207678_10046202 Ga0207678_100462024 107
587 3300026067 Ga0207678_10093063 Ga0207678_100930633 107
588 3300026067 Ga0207678_10418915 Ga0207678_104189152 107
589 3300026075 Ga0207708_10038706 Ga0207708_100387062 107
590 3300026075 Ga0207708_10453528 Ga0207708_104535282 107
591 3300026078 Ga0207702_10137847 Ga0207702_101378473 107
592 3300026078 Ga0207702_10151131 Ga0207702_101511312 107
593 3300026088 Ga0207641_10740567 Ga0207641_107405672 107
594 3300026088 Ga0207641_10874658 Ga0207641_108746581 107
595 3300026088 Ga0207641_12066872 Ga0207641_120668722 107
596 3300026089 Ga0207648_10009895 Ga0207648_100098955 107
597 3300026089 Ga0207648_10092382 Ga0207648_100923824 107
598 3300026089 Ga0207648_10173742 Ga0207648_101737422 107
599 3300026089 Ga0207648_11187397 Ga0207648_111873972 107
600 3300026095 Ga0207676_10029132 Ga0207676_100291323 107
601 3300026095 Ga0207676_10090067 Ga0207676_100900673 107
602 3300026116 Ga0207674_10281330 Ga0207674_102813302 107
603 3300026116 Ga0207674_10426357 Ga0207674_104263572 107
604 3300026118 Ga0207675_100084663 Ga0207675_1000846633 107
605 3300026118 Ga0207675_100285492 Ga0207675_1002854922 107
606 3300026121 Ga0207683_10031736 Ga0207683_100317364 107
607 3300026121 Ga0207683_10094502 Ga0207683_100945023 107
608 3300026121 Ga0207683_10134886 Ga0207683_101348863 107
609 3300026121 Ga0207683_10319832 Ga0207683_103198322 107
610 3300026142 Ga0207698_10028103 Ga0207698_100281034 107
611 3300026142 Ga0207698_10518620 Ga0207698_105186203 107
612 3300026142 Ga0207698_10611624 Ga0207698_106116242 107
613 3300028379 Ga0268266_10409827 Ga0268266_104098271 107
614 3300028380 Ga0268265_10225582 Ga0268265_102255822 107
615 3300028380 Ga0268265_10327062 Ga0268265_103270623 107
616 3300028380 Ga0268265_11038064 Ga0268265_110380642 107
617 3300028381 Ga0268264_10140205 Ga0268264_101402052 107
618 3300028381 Ga0268264_10265222 Ga0268264_102652223 107
619 3300031548 Ga0307408_100617055 Ga0307408_1006170552 107
620 3300035091 Ga0373951_0137168 Ga0373951_0137168_229_552 107
621 3300035207 Ga0373942_0111994 Ga0373942_0111994_130_453 107
622 3300041463 Ga0451804_0721543 Ga0451804_0721543_701_1033 107
623 3300041486 Ga0451807_1895063 Ga0451807_1895063_155_487 107
624 3300041512 Ga0451853_2549579 Ga0451853_2549579_168_500 107
625 3300041512 Ga0451853_2874699 Ga0451853_2874699_23_349 107
626 3300042016 Ga0439463_013509 Ga0439463_013509_1468_1794 107
627 3300046455 Ga0495603_0007432 Ga0495603_0007432_606_932 107
628 3300046455 Ga0495603_0146681 Ga0495603_0146681_461_784 107
629 3300046461 Ga0495641_0483541 Ga0495641_0483541_197_520 107
630 3300046473 Ga0495582_0803114 Ga0495582_0803114_126_452 107
631 3300046523 Ga0495644_0098290 Ga0495644_0098290_703_1029 107
632 3300046615 Ga0495656_0016568 Ga0495656_0016568_2256_2582 107
633 3300046615 Ga0495656_0292269 Ga0495656_0292269_184_510 107
634 3300046648 Ga0495611_0354771 Ga0495611_0354771_324_650 107
635 3300046692 Ga0495671_0170934 Ga0495671_0170934_427_756 107
636 3300046794 Ga0495589_0216495 Ga0495589_0216495_55_381 107
637 3300046794 Ga0495589_0353498 Ga0495589_0353498_47_385 107
638 3300048903 Ga0496100_0421230 Ga0496100_0421230_224_565 107
639 3300048903 Ga0496100_0784341 Ga0496100_0784341_392_718 107
640 3300048904 Ga0496101_0373463 Ga0496101_0373463_124_447 107
641 3300048904 Ga0496101_0719916 Ga0496101_0719916_144_485 107
642 3300048905 Ga0496102_0374508 Ga0496102_0374508_530_871 107
643 3300048907 Ga0496104_0160961 Ga0496104_0160961_1736_2062 107
644 3300048908 Ga0496105_0741211 Ga0496105_0741211_265_591 107
645 3300048910 Ga0496107_0207087 Ga0496107_0207087_756_1079 107
646 3300048910 Ga0496107_0311772 Ga0496107_0311772_148_471 107
647 3300048910 Ga0496107_0424615 Ga0496107_0424615_428_769 107
648 3300048911 Ga0496108_0074930 Ga0496108_0074930_498_821 107
649 3300048911 Ga0496108_0631214 Ga0496108_0631214_304_645 107
650 3300048912 Ga0496109_0246817 Ga0496109_0246817_564_890 107
651 3300048913 Ga0496110_0233407 Ga0496110_0233407_219_542 107
652 3300048914 Ga0496111_0021052 Ga0496111_0021052_3795_4118 107
653 3300048914 Ga0496111_0103492 Ga0496111_0103492_174_497 107
654 3300048914 Ga0496111_1261095 Ga0496111_1261095_56_382 107
655 3300048917 Ga0496114_0048478 Ga0496114_0048478_1704_2027 107
656 3300048917 Ga0496114_0101719 Ga0496114_0101719_1087_1413 107
657 3300048917 Ga0496114_0658644 Ga0496114_0658644_362_688 107
658 3300049568 Ga0501031_0030821 Ga0501031_0030821_2683_3009 107
659 3300049568 Ga0501031_0032813 Ga0501031_0032813_3006_3332 107
660 3300049569 Ga0501032_0294593 Ga0501032_0294593_245_571 107
661 3300049570 Ga0501033_0023999 Ga0501033_0023999_2687_3013 107
662 3300049572 Ga0501036_0015890 Ga0501036_0015890_4382_4708 107
663 3300049572 Ga0501036_0126475 Ga0501036_0126475_161_487 107
664 3300049573 Ga0501037_0086920 Ga0501037_0086920_880_1206 107
665 3300049573 Ga0501037_0230640 Ga0501037_0230640_390_716 107
666 3300049574 Ga0501038_0063079 Ga0501038_0063079_2041_2367 107
667 3300049574 Ga0501038_0081404 Ga0501038_0081404_831_1157 107
668 3300049575 Ga0501039_0042951 Ga0501039_0042951_94_420 107
669 3300049576 Ga0501040_0021623 Ga0501040_0021623_745_1071 107
670 3300049576 Ga0501040_0201982 Ga0501040_0201982_219_545 107
671 3300049577 Ga0501041_0067223 Ga0501041_0067223_946_1272 107
672 3300049577 Ga0501041_0084006 Ga0501041_0084006_728_1054 107
673 3300049578 Ga0501042_0029424 Ga0501042_0029424_2345_2671 107
674 3300049578 Ga0501042_0066670 Ga0501042_0066670_2219_2545 107
675 3300049579 Ga0501043_0060335 Ga0501043_0060335_1887_2213 107
676 3300049579 Ga0501043_0081171 Ga0501043_0081171_895_1221 107
677 3300049580 Ga0501046_0126345 Ga0501046_0126345_49_375 107
678 3300049580 Ga0501046_0287048 Ga0501046_0287048_463_789 107
679 3300049582 Ga0501048_0069452 Ga0501048_0069452_1840_2166 107
680 3300049582 Ga0501048_0079666 Ga0501048_0079666_1544_1870 107
681 3300049582 Ga0501048_0835779 Ga0501048_0835779_42_368 107
682 3300049584 Ga0501068_0041064 Ga0501068_0041064_1175_1501 107
683 3300049585 Ga0501069_0007569 Ga0501069_0007569_3767_4093 107
684 3300049586 Ga0501070_0078905 Ga0501070_0078905_2104_2430 107
685 3300049586 Ga0501070_0481905 Ga0501070_0481905_136_462 107
686 3300049587 Ga0501071_0081894 Ga0501071_0081894_886_1212 107
687 3300049587 Ga0501071_0207622 Ga0501071_0207622_184_510 107
688 3300049588 Ga0501072_0041305 Ga0501072_0041305_1708_2034 107
689 3300049589 Ga0501073_0053563 Ga0501073_0053563_58_384 107
690 3300049590 Ga0501074_0016179 Ga0501074_0016179_2236_2562 107
691 3300049590 Ga0501074_0019682 Ga0501074_0019682_436_762 107
692 3300049591 Ga0501075_0020640 Ga0501075_0020640_2832_3158 107
693 3300049591 Ga0501075_0042558 Ga0501075_0042558_367_693 107
694 3300049592 Ga0501076_0041066 Ga0501076_0041066_2766_3092 107
695 3300049592 Ga0501076_0044689 Ga0501076_0044689_818_1144 107
696 3300049593 Ga0501077_0020119 Ga0501077_0020119_2998_3324 107
697 3300049593 Ga0501077_0539338 Ga0501077_0539338_162_488 107
698 3300049741 Ga0501079_0052745 Ga0501079_0052745_2716_3042 107
699 3300049741 Ga0501079_0069293 Ga0501079_0069293_974_1300 107
700 3300049742 Ga0501080_0033295 Ga0501080_0033295_2872_3198 107
701 3300049742 Ga0501080_0097529 Ga0501080_0097529_996_1322 107
702 3300049743 Ga0501081_0070783 Ga0501081_0070783_954_1280 107
703 3300049743 Ga0501081_0097930 Ga0501081_0097930_196_522 107
704 3300049744 Ga0501083_0070801 Ga0501083_0070801_843_1169 107
705 3300049744 Ga0501083_0194040 Ga0501083_0194040_931_1257 107
706 3300049822 Ga0501035_0092494 Ga0501035_0092494_582_908 107
707 3300049823 Ga0501044_0194459 Ga0501044_0194459_359_685 107
708 3300049824 Ga0501045_0026671 Ga0501045_0026671_1663_1989 107
709 3300049824 Ga0501045_0046832 Ga0501045_0046832_2729_3055 107
710 3300050507 nmdc:mga05p37_445176_c1 nmdc:mga05p37_445176_c1_551_874 107
711 3300050511 nmdc:mga08y16_10062_c1 nmdc:mga08y16_10062_c1_3303_3626 107
712 3300050514 nmdc:mga08x19_1166353_c1 nmdc:mga08x19_1166353_c1_116_439 107
713 3300050515 nmdc:mga0a205_1344455_c1 nmdc:mga0a205_1344455_c1_101_424 107
714 3300054114 Ga0501084_0038942 Ga0501084_0038942_3358_3684 107
715 3300054114 Ga0501084_0105788 Ga0501084_0105788_996_1322 107
716 3300060353 Ga0501082_0119332 Ga0501082_0119332_976_1302 107
717 3300060353 Ga0501082_0123555 Ga0501082_0123555_32_358 107
718 3300061734 Ga0530510_0003037 Ga0530510_0003037_2233_2559 107
719 3300061734 Ga0530510_0140380 Ga0530510_0140380_63_389 107

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.8617 23 69
1gsq-assembly1.cif.gz_A three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods 0.8067 21 64
4djg-assembly1.cif.gz_B crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 0.7845 22 64
4djg-assembly1.cif.gz_B crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 0.703 22 64
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.6462 23 69
ID Description Score Start End Superfamily
4djgB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.7845 22 64 1.20.5.440
4djgB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.703 22 64 1.20.5.440
1serB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.6995 12 69 1.10.287.40
2y3dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6944 11 87 1.20.120.1490
1sesB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.6852 12 69 1.10.287.40
ID Description Score Start End GO Terms
AF-A0A538MB04-F1-model_v4 Uncharacterized protein 0.995 3 87
AF-A0A7V9FXW7-F1-model_v4 Uncharacterized protein 0.9842 3 96
AF-A0A537TPC9-F1-model_v4 Uncharacterized protein 0.9816 11 98
AF-A0A7V9I497-F1-model_v4 Uncharacterized protein 0.9767 4 99
AF-A0A538HSN3-F1-model_v4 Uncharacterized protein 0.9511 1 102

Feature Viewer

pLDDT pTM Quality
93.14 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map