F477275
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 244 | 719 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300049593|Ga0501077_0028442|Ga0501077_0028442_2423_2779 |
| Length | 118 |
| Sequence | VTSASIAAFSPTLSGVLRKRRFADLVNRQLDLFEEDERELLAEAAEADARWTHASAEESEELYGDYQLVVDAIAERLLDVRETYAASLDETTADQYRTTFDAAARKRFRRFASLLDGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 163 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 164 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 165 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 166 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 167 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 168 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.25 |
| Nodule | 0 |
| Rhizoplane | 4.03 |
| Rhizosphere | 94.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10020806 | 3300005327 | Bacteria | 5257 |
| 2 | Ga0070658_10125516 | 3300005327 | Bacteria | 2136 |
| 3 | Ga0070658_10741140 | 3300005327 | Bacteria | 853 |
| 4 | Ga0070676_10199609 | 3300005328 | Unclassified | 1311 |
| 5 | Ga0070683_100012761 | 3300005329 | Bacteria | 7308 |
| 6 | Ga0070683_100116559 | 3300005329 | Unclassified | 2522 |
| 7 | Ga0070683_100163196 | 3300005329 | Bacteria | 2114 |
| 8 | Ga0070683_100204920 | 3300005329 | Bacteria | 1873 |
| 9 | Ga0070683_100266500 | 3300005329 | Unclassified | 1629 |
| 10 | Ga0070683_101176794 | 3300005329 | Unclassified | 737 |
| 11 | Ga0070683_101284004 | 3300005329 | Unclassified | 704 |
| 12 | Ga0070683_101772363 | 3300005329 | Unclassified | 593 |
| 13 | Ga0070670_102072541 | 3300005331 | Bacteria | 524 |
| 14 | Ga0070677_10238963 | 3300005333 | Bacteria | 896 |
| 15 | Ga0068869_100109629 | 3300005334 | Unclassified | 2098 |
| 16 | Ga0070666_10172962 | 3300005335 | Bacteria | 1513 |
| 17 | Ga0070680_100013940 | 3300005336 | Bacteria | 6273 |
| 18 | Ga0070680_100044542 | 3300005336 | Bacteria | 3605 |
| 19 | Ga0070682_100001712 | 3300005337 | Bacteria | 12197 |
| 20 | Ga0070682_100202698 | 3300005337 | Unclassified | 1400 |
| 21 | Ga0070682_100230701 | 3300005337 | Bacteria | 1323 |
| 22 | Ga0070682_100376022 | 3300005337 | Unclassified | 1067 |
| 23 | Ga0070682_100778705 | 3300005337 | Unclassified | 775 |
| 24 | Ga0068868_100013592 | 3300005338 | Bacteria | 5977 |
| 25 | Ga0068868_100060980 | 3300005338 | Bacteria | 2987 |
| 26 | Ga0070660_100006223 | 3300005339 | Bacteria | 8263 |
| 27 | Ga0070660_100504565 | 3300005339 | Unclassified | 1006 |
| 28 | Ga0070691_10000781 | 3300005341 | Bacteria | 12645 |
| 29 | Ga0070691_10454999 | 3300005341 | Bacteria | 732 |
| 30 | Ga0070691_10671094 | 3300005341 | Bacteria | 619 |
| 31 | Ga0070687_100011765 | 3300005343 | Bacteria | 3840 |
| 32 | Ga0070687_100165662 | 3300005343 | Unclassified | 1311 |
| 33 | Ga0070661_100051608 | 3300005344 | Bacteria | 3010 |
| 34 | Ga0070661_100150713 | 3300005344 | Unclassified | 1758 |
| 35 | Ga0070692_10004463 | 3300005345 | Bacteria | 5850 |
| 36 | Ga0070668_100174976 | 3300005347 | Bacteria | 1749 |
| 37 | Ga0070668_101100576 | 3300005347 | Bacteria | 717 |
| 38 | Ga0070668_101394095 | 3300005347 | Unclassified | 639 |
| 39 | Ga0070668_101775827 | 3300005347 | Bacteria | 567 |
| 40 | Ga0070669_100128448 | 3300005353 | Bacteria | 1942 |
| 41 | Ga0070669_100669026 | 3300005353 | Bacteria | 875 |
| 42 | Ga0070675_100013253 | 3300005354 | Bacteria | 6478 |
| 43 | Ga0070675_100143919 | 3300005354 | Bacteria | 2039 |
| 44 | Ga0070675_100176508 | 3300005354 | Unclassified | 1845 |
| 45 | Ga0070675_100238849 | 3300005354 | Bacteria | 1587 |
| 46 | Ga0070675_100264615 | 3300005354 | Bacteria | 1508 |
| 47 | Ga0070671_100127913 | 3300005355 | Unclassified | 2139 |
| 48 | Ga0070671_100134573 | 3300005355 | Bacteria | 2083 |
| 49 | Ga0070671_100198696 | 3300005355 | Unclassified | 1700 |
| 50 | Ga0070671_100262053 | 3300005355 | Unclassified | 1469 |
| 51 | Ga0070671_100577024 | 3300005355 | Bacteria | 971 |
| 52 | Ga0070674_100024608 | 3300005356 | Bacteria | 3910 |
| 53 | Ga0070674_100026395 | 3300005356 | Bacteria | 3793 |
| 54 | Ga0070674_100035054 | 3300005356 | Unclassified | 3358 |
| 55 | Ga0070674_100164746 | 3300005356 | Bacteria | 1685 |
| 56 | Ga0070674_100175982 | 3300005356 | Bacteria | 1635 |
| 57 | Ga0070674_100215709 | 3300005356 | Bacteria | 1490 |
| 58 | Ga0070674_100343715 | 3300005356 | Unclassified | 1203 |
| 59 | Ga0070674_100741165 | 3300005356 | Bacteria | 843 |
| 60 | Ga0070673_100001958 | 3300005364 | Bacteria | 12419 |
| 61 | Ga0070673_100058421 | 3300005364 | Bacteria | 3049 |
| 62 | Ga0070673_100346818 | 3300005364 | Unclassified | 1317 |
| 63 | Ga0070659_100006531 | 3300005366 | Bacteria | 8420 |
| 64 | Ga0070659_100212870 | 3300005366 | Unclassified | 1593 |
| 65 | Ga0070659_100843002 | 3300005366 | Unclassified | 799 |
| 66 | Ga0070701_10005023 | 3300005438 | Bacteria | 5424 |
| 67 | Ga0070701_11072287 | 3300005438 | Bacteria | 566 |
| 68 | Ga0070705_100052487 | 3300005440 | Bacteria | 2382 |
| 69 | Ga0070700_100024808 | 3300005441 | Bacteria | 3526 |
| 70 | Ga0070700_100854187 | 3300005441 | Bacteria | 737 |
| 71 | Ga0070708_102090259 | 3300005445 | Bacteria | 524 |
| 72 | Ga0070663_100099721 | 3300005455 | Bacteria | 2166 |
| 73 | Ga0070663_100382113 | 3300005455 | Unclassified | 1147 |
| 74 | Ga0070663_100426144 | 3300005455 | Bacteria | 1089 |
| 75 | Ga0070678_100019284 | 3300005456 | Bacteria | 4443 |
| 76 | Ga0070678_100093811 | 3300005456 | Unclassified | 2309 |
| 77 | Ga0070678_101308050 | 3300005456 | Unclassified | 675 |
| 78 | Ga0070678_101409162 | 3300005456 | Bacteria | 651 |
| 79 | Ga0070678_102295950 | 3300005456 | Bacteria | 512 |
| 80 | Ga0070662_100008794 | 3300005457 | Bacteria | 6586 |
| 81 | Ga0070662_100464420 | 3300005457 | Unclassified | 1052 |
| 82 | Ga0070662_101359677 | 3300005457 | Bacteria | 612 |
| 83 | Ga0070681_10143620 | 3300005458 | Bacteria | 2316 |
| 84 | Ga0070681_10325545 | 3300005458 | Bacteria | 1446 |
| 85 | Ga0068867_100011666 | 3300005459 | Bacteria | 6206 |
| 86 | Ga0068867_100095123 | 3300005459 | Bacteria | 2266 |
| 87 | Ga0068867_100446742 | 3300005459 | Bacteria | 1101 |
| 88 | Ga0068867_100532640 | 3300005459 | Bacteria | 1015 |
| 89 | Ga0070685_10009536 | 3300005466 | Bacteria | 5020 |
| 90 | Ga0070685_10041854 | 3300005466 | Unclassified | 2612 |
| 91 | Ga0070698_100712639 | 3300005471 | Bacteria | 946 |
| 92 | Ga0070679_100027697 | 3300005530 | Bacteria | 5580 |
| 93 | Ga0070679_100924593 | 3300005530 | Bacteria | 816 |
| 94 | Ga0070684_100016734 | 3300005535 | Bacteria | 6002 |
| 95 | Ga0070684_100047370 | 3300005535 | Bacteria | 3725 |
| 96 | Ga0070684_100053101 | 3300005535 | Unclassified | 3526 |
| 97 | Ga0070684_100118958 | 3300005535 | Bacteria | 2375 |
| 98 | Ga0070684_100687447 | 3300005535 | Unclassified | 953 |
| 99 | Ga0068853_100002053 | 3300005539 | Bacteria | 14918 |
| 100 | Ga0070672_100012897 | 3300005543 | Bacteria | 5888 |
| 101 | Ga0070672_100019493 | 3300005543 | Bacteria | 4924 |
| 102 | Ga0070672_100112092 | 3300005543 | Unclassified | 2225 |
| 103 | Ga0070672_100491269 | 3300005543 | Unclassified | 1061 |
| 104 | Ga0070686_100116613 | 3300005544 | Unclassified | 1828 |
| 105 | Ga0070686_100943102 | 3300005544 | Bacteria | 704 |
| 106 | Ga0070696_100178383 | 3300005546 | Bacteria | 1575 |
| 107 | Ga0070696_101392235 | 3300005546 | Bacteria | 598 |
| 108 | Ga0070693_100046774 | 3300005547 | Bacteria | 2459 |
| 109 | Ga0070693_100609833 | 3300005547 | Bacteria | 789 |
| 110 | Ga0070665_100087089 | 3300005548 | Bacteria | 3128 |
| 111 | Ga0070665_100479102 | 3300005548 | Bacteria | 1255 |
| 112 | Ga0070665_101567738 | 3300005548 | Unclassified | 667 |
| 113 | Ga0068855_101222037 | 3300005563 | Bacteria | 781 |
| 114 | Ga0070664_100011913 | 3300005564 | Bacteria | 7058 |
| 115 | Ga0068857_100033412 | 3300005577 | Bacteria | 4549 |
| 116 | Ga0068857_100105667 | 3300005577 | Unclassified | 2528 |
| 117 | Ga0068857_100301716 | 3300005577 | Unclassified | 1477 |
| 118 | Ga0068857_100450002 | 3300005577 | Bacteria | 1204 |
| 119 | Ga0068854_100005835 | 3300005578 | Bacteria | 7796 |
| 120 | Ga0068854_100274199 | 3300005578 | Unclassified | 1355 |
| 121 | Ga0068856_100113518 | 3300005614 | Unclassified | 2707 |
| 122 | Ga0070702_100009253 | 3300005615 | Unclassified | 4814 |
| 123 | Ga0070702_100145435 | 3300005615 | Unclassified | 1515 |
| 124 | Ga0068852_100002371 | 3300005616 | Bacteria | 12983 |
| 125 | Ga0068859_100081776 | 3300005617 | Bacteria | 3272 |
| 126 | Ga0068859_100476956 | 3300005617 | Unclassified | 1343 |
| 127 | Ga0068864_100104963 | 3300005618 | Unclassified | 2511 |
| 128 | Ga0068864_100856098 | 3300005618 | Bacteria | 896 |
| 129 | Ga0068864_101261974 | 3300005618 | Bacteria | 738 |
| 130 | Ga0068866_10050031 | 3300005718 | Bacteria | 2120 |
| 131 | Ga0068866_10174499 | 3300005718 | Unclassified | 1264 |
| 132 | Ga0068866_10197785 | 3300005718 | Bacteria | 1199 |
| 133 | Ga0068866_10636179 | 3300005718 | Bacteria | 724 |
| 134 | Ga0068866_10699229 | 3300005718 | Bacteria | 695 |
| 135 | Ga0068866_10737600 | 3300005718 | Bacteria | 679 |
| 136 | Ga0068866_10758397 | 3300005718 | Bacteria | 671 |
| 137 | Ga0068861_100113603 | 3300005719 | Bacteria | 2173 |
| 138 | Ga0068861_101756336 | 3300005719 | Bacteria | 614 |
| 139 | Ga0068851_10134690 | 3300005834 | Bacteria | 1339 |
| 140 | Ga0068851_10216565 | 3300005834 | Bacteria | 1074 |
| 141 | Ga0068851_10493845 | 3300005834 | Bacteria | 733 |
| 142 | Ga0068870_10000685 | 3300005840 | Bacteria | 12965 |
| 143 | Ga0068870_10186527 | 3300005840 | Unclassified | 1249 |
| 144 | Ga0068870_10655382 | 3300005840 | Unclassified | 720 |
| 145 | Ga0068863_100098876 | 3300005841 | Bacteria | 2772 |
| 146 | Ga0068863_101914888 | 3300005841 | Bacteria | 603 |
| 147 | Ga0068858_100222261 | 3300005842 | Bacteria | 1789 |
| 148 | Ga0068858_100575290 | 3300005842 | Bacteria | 1091 |
| 149 | Ga0068860_100113669 | 3300005843 | Bacteria | 2589 |
| 150 | Ga0068860_100179105 | 3300005843 | Unclassified | 2049 |
| 151 | Ga0068860_100486778 | 3300005843 | Unclassified | 1230 |
| 152 | Ga0068862_101127921 | 3300005844 | Bacteria | 780 |
| 153 | Ga0081455_10011342 | 3300005937 | Bacteria | 8962 |
| 154 | Ga0081455_10064761 | 3300005937 | Bacteria | 3059 |
| 155 | Ga0081455_10071664 | 3300005937 | Bacteria | 2872 |
| 156 | Ga0081538_10001394 | 3300005981 | Bacteria | 24783 |
| 157 | Ga0081539_10001263 | 3300005985 | Bacteria | 44753 |
| 158 | Ga0075365_10202266 | 3300006038 | Bacteria | 1391 |
| 159 | Ga0075365_10760253 | 3300006038 | Bacteria | 684 |
| 160 | Ga0075364_10101016 | 3300006051 | Bacteria | 1920 |
| 161 | Ga0075364_11163294 | 3300006051 | Bacteria | 523 |
| 162 | Ga0075367_10945511 | 3300006178 | Unclassified | 550 |
| 163 | Ga0097621_100116158 | 3300006237 | Unclassified | 2266 |
| 164 | Ga0097621_100249430 | 3300006237 | Bacteria | 1554 |
| 165 | Ga0097621_100864649 | 3300006237 | Bacteria | 841 |
| 166 | Ga0097621_100986186 | 3300006237 | Unclassified | 788 |
| 167 | Ga0068871_100036187 | 3300006358 | Bacteria | 3929 |
| 168 | Ga0068871_100641381 | 3300006358 | Bacteria | 969 |
| 169 | Ga0075428_100188205 | 3300006844 | Bacteria | 2233 |
| 170 | Ga0075430_100186571 | 3300006846 | Bacteria | 1724 |
| 171 | Ga0075433_11707393 | 3300006852 | Unclassified | 542 |
| 172 | Ga0075434_101462697 | 3300006871 | Bacteria | 693 |
| 173 | Ga0075429_100633080 | 3300006880 | Bacteria | 937 |
| 174 | Ga0075429_101707060 | 3300006880 | Bacteria | 547 |
| 175 | Ga0068865_100014098 | 3300006881 | Bacteria | 5072 |
| 176 | Ga0068865_100018100 | 3300006881 | Bacteria | 4541 |
| 177 | Ga0068865_100212158 | 3300006881 | Bacteria | 1509 |
| 178 | Ga0068865_100438663 | 3300006881 | Bacteria | 1077 |
| 179 | Ga0068865_100823643 | 3300006881 | Bacteria | 802 |
| 180 | Ga0097620_100081781 | 3300006931 | Bacteria | 3272 |
| 181 | Ga0097620_100476918 | 3300006931 | Unclassified | 1343 |
| 182 | Ga0105240_11877604 | 3300009093 | Bacteria | 623 |
| 183 | Ga0105240_12621444 | 3300009093 | Bacteria | 521 |
| 184 | Ga0111539_10006960 | 3300009094 | Bacteria | 14514 |
| 185 | Ga0111539_10074007 | 3300009094 | Bacteria | 4015 |
| 186 | Ga0111539_10385516 | 3300009094 | Bacteria | 1632 |
| 187 | Ga0111539_11695879 | 3300009094 | Unclassified | 733 |
| 188 | Ga0111539_11797939 | 3300009094 | Unclassified | 711 |
| 189 | Ga0111539_12559193 | 3300009094 | Bacteria | 592 |
| 190 | Ga0105245_10008068 | 3300009098 | Bacteria | 9206 |
| 191 | Ga0105245_10068162 | 3300009098 | Unclassified | 3223 |
| 192 | Ga0105245_10193633 | 3300009098 | Bacteria | 1949 |
| 193 | Ga0105245_10265614 | 3300009098 | Unclassified | 1672 |
| 194 | Ga0105245_10288603 | 3300009098 | Bacteria | 1606 |
| 195 | Ga0105245_10364669 | 3300009098 | Unclassified | 1435 |
| 196 | Ga0105245_10751275 | 3300009098 | Bacteria | 1011 |
| 197 | Ga0105245_11863191 | 3300009098 | Bacteria | 654 |
| 198 | Ga0105247_10041631 | 3300009101 | Bacteria | 2812 |
| 199 | Ga0105247_10994977 | 3300009101 | Bacteria | 654 |
| 200 | Ga0114129_10353057 | 3300009147 | Bacteria | 1947 |
| 201 | Ga0114129_10451480 | 3300009147 | Bacteria | 1686 |
| 202 | Ga0114129_10692940 | 3300009147 | Bacteria | 1310 |
| 203 | Ga0114129_11077726 | 3300009147 | Bacteria | 1007 |
| 204 | Ga0114129_11447774 | 3300009147 | Bacteria | 846 |
| 205 | Ga0114129_11790774 | 3300009147 | Bacteria | 747 |
| 206 | Ga0105243_10004018 | 3300009148 | Bacteria | 11716 |
| 207 | Ga0105243_10007875 | 3300009148 | Bacteria | 8184 |
| 208 | Ga0105243_10137679 | 3300009148 | Bacteria | 2079 |
| 209 | Ga0105243_10372540 | 3300009148 | Bacteria | 1318 |
| 210 | Ga0105243_11704686 | 3300009148 | Unclassified | 659 |
| 211 | Ga0105243_12465050 | 3300009148 | Bacteria | 559 |
| 212 | Ga0105242_10067548 | 3300009176 | Unclassified | 2956 |
| 213 | Ga0105242_10142341 | 3300009176 | Bacteria | 2082 |
| 214 | Ga0105242_10461250 | 3300009176 | Bacteria | 1200 |
| 215 | Ga0105242_10791995 | 3300009176 | Bacteria | 937 |
| 216 | Ga0105248_10286384 | 3300009177 | Bacteria | 1855 |
| 217 | Ga0105248_10647613 | 3300009177 | Unclassified | 1192 |
| 218 | Ga0105248_11043744 | 3300009177 | Unclassified | 923 |
| 219 | Ga0105248_11414323 | 3300009177 | Unclassified | 787 |
| 220 | Ga0105248_13468566 | 3300009177 | Bacteria | 501 |
| 221 | Ga0105238_10021955 | 3300009551 | Bacteria | 6502 |
| 222 | Ga0105238_10223925 | 3300009551 | Bacteria | 1858 |
| 223 | Ga0105238_12682043 | 3300009551 | Bacteria | 535 |
| 224 | Ga0105249_10015358 | 3300009553 | Bacteria | 6776 |
| 225 | Ga0105249_10067152 | 3300009553 | Bacteria | 3303 |
| 226 | Ga0105249_10067633 | 3300009553 | Bacteria | 3292 |
| 227 | Ga0105239_10021141 | 3300010375 | Bacteria | 7178 |
| 228 | Ga0105239_10218530 | 3300010375 | Bacteria | 2137 |
| 229 | Ga0105239_10600201 | 3300010375 | Bacteria | 1256 |
| 230 | Ga0105239_10683993 | 3300010375 | Bacteria | 1173 |
| 231 | Ga0105246_10026274 | 3300011119 | Bacteria | 3802 |
| 232 | Ga0105246_10078279 | 3300011119 | Unclassified | 2348 |
| 233 | Ga0105246_10129824 | 3300011119 | Bacteria | 1880 |
| 234 | Ga0157326_1070366 | 3300012513 | Unclassified | 553 |
| 235 | Ga0157373_11393917 | 3300013100 | Bacteria | 533 |
| 236 | Ga0157371_10003237 | 3300013102 | Bacteria | 14944 |
| 237 | Ga0157369_10172235 | 3300013105 | Bacteria | 2280 |
| 238 | Ga0157374_11181696 | 3300013296 | Bacteria | 786 |
| 239 | Ga0157374_12227659 | 3300013296 | Bacteria | 575 |
| 240 | Ga0157378_11015008 | 3300013297 | Bacteria | 864 |
| 241 | Ga0157378_12537265 | 3300013297 | Bacteria | 565 |
| 242 | Ga0163162_10076833 | 3300013306 | Bacteria | 3402 |
| 243 | Ga0163162_10492366 | 3300013306 | Unclassified | 1357 |
| 244 | Ga0163162_11856261 | 3300013306 | Unclassified | 689 |
| 245 | Ga0157372_10008369 | 3300013307 | Bacteria | 10997 |
| 246 | Ga0157372_12590993 | 3300013307 | Unclassified | 582 |
| 247 | Ga0157375_10048535 | 3300013308 | Bacteria | 4153 |
| 248 | Ga0157375_10720262 | 3300013308 | Bacteria | 1150 |
| 249 | Ga0157375_11286039 | 3300013308 | Unclassified | 860 |
| 250 | Ga0157375_12083114 | 3300013308 | Bacteria | 675 |
| 251 | Ga0163163_10130751 | 3300014325 | Unclassified | 2551 |
| 252 | Ga0163163_10289425 | 3300014325 | Bacteria | 1690 |
| 253 | Ga0163163_10857583 | 3300014325 | Unclassified | 972 |
| 254 | Ga0163163_10964601 | 3300014325 | Bacteria | 916 |
| 255 | Ga0163163_11071496 | 3300014325 | Unclassified | 869 |
| 256 | Ga0163163_11541761 | 3300014325 | Bacteria | 726 |
| 257 | Ga0163163_11901115 | 3300014325 | Bacteria | 655 |
| 258 | Ga0163163_12057016 | 3300014325 | Bacteria | 631 |
| 259 | Ga0157380_10018392 | 3300014326 | Bacteria | 5186 |
| 260 | Ga0157380_10031987 | 3300014326 | Bacteria | 4042 |
| 261 | Ga0157380_10090420 | 3300014326 | Unclassified | 2525 |
| 262 | Ga0157380_10277994 | 3300014326 | Bacteria | 1530 |
| 263 | Ga0157380_11277449 | 3300014326 | Bacteria | 780 |
| 264 | Ga0157380_12438997 | 3300014326 | Bacteria | 588 |
| 265 | Ga0157380_12679987 | 3300014326 | Bacteria | 565 |
| 266 | Ga0157377_10005725 | 3300014745 | Bacteria | 5860 |
| 267 | Ga0157377_10046641 | 3300014745 | Bacteria | 2425 |
| 268 | Ga0157377_10192467 | 3300014745 | Bacteria | 1290 |
| 269 | Ga0157377_11492677 | 3300014745 | Unclassified | 537 |
| 270 | Ga0157379_10349401 | 3300014968 | Unclassified | 1354 |
| 271 | Ga0157379_11099008 | 3300014968 | Bacteria | 761 |
| 272 | Ga0157379_11608103 | 3300014968 | Unclassified | 635 |
| 273 | Ga0157376_10023873 | 3300014969 | Bacteria | 4794 |
| 274 | Ga0157376_10228217 | 3300014969 | Bacteria | 1728 |
| 275 | Ga0157376_10350635 | 3300014969 | Bacteria | 1412 |
| 276 | Ga0157376_10384221 | 3300014969 | Bacteria | 1353 |
| 277 | Ga0157376_10694176 | 3300014969 | Unclassified | 1022 |
| 278 | Ga0163161_10135225 | 3300017792 | Bacteria | 1863 |
| 279 | Ga0163161_10170556 | 3300017792 | Unclassified | 1663 |
| 280 | Ga0163161_10616943 | 3300017792 | Bacteria | 896 |
| 281 | Ga0207656_10288057 | 3300025321 | Bacteria | 811 |
| 282 | Ga0207656_10397228 | 3300025321 | Bacteria | 693 |
| 283 | Ga0207642_10034392 | 3300025899 | Unclassified | 2155 |
| 284 | Ga0207688_10012183 | 3300025901 | Bacteria | 4678 |
| 285 | Ga0207688_10014657 | 3300025901 | Bacteria | 4258 |
| 286 | Ga0207688_10849052 | 3300025901 | Bacteria | 578 |
| 287 | Ga0207680_10118518 | 3300025903 | Bacteria | 1728 |
| 288 | Ga0207680_10726080 | 3300025903 | Bacteria | 712 |
| 289 | Ga0207647_10084225 | 3300025904 | Bacteria | 1903 |
| 290 | Ga0207645_10192233 | 3300025907 | Unclassified | 1342 |
| 291 | Ga0207643_10002875 | 3300025908 | Bacteria | 9291 |
| 292 | Ga0207643_10020606 | 3300025908 | Bacteria | 3620 |
| 293 | Ga0207643_10131343 | 3300025908 | Unclassified | 1490 |
| 294 | Ga0207643_10149907 | 3300025908 | Unclassified | 1398 |
| 295 | Ga0207705_10142417 | 3300025909 | Bacteria | 1791 |
| 296 | Ga0207654_10988194 | 3300025911 | Bacteria | 612 |
| 297 | Ga0207707_10177704 | 3300025912 | Unclassified | 1859 |
| 298 | Ga0207660_10178798 | 3300025917 | Unclassified | 1647 |
| 299 | Ga0207662_10405667 | 3300025918 | Bacteria | 925 |
| 300 | Ga0207657_10005874 | 3300025919 | Bacteria | 12787 |
| 301 | Ga0207657_10115501 | 3300025919 | Bacteria | 2212 |
| 302 | Ga0207649_10235848 | 3300025920 | Unclassified | 1311 |
| 303 | Ga0207649_10477406 | 3300025920 | Bacteria | 945 |
| 304 | Ga0207652_10163111 | 3300025921 | Unclassified | 1998 |
| 305 | Ga0207652_10370220 | 3300025921 | Bacteria | 1293 |
| 306 | Ga0207652_11817084 | 3300025921 | Unclassified | 514 |
| 307 | Ga0207694_10085310 | 3300025924 | Bacteria | 2485 |
| 308 | Ga0207650_10010107 | 3300025925 | Bacteria | 6466 |
| 309 | Ga0207650_10336404 | 3300025925 | Bacteria | 1239 |
| 310 | Ga0207650_10391692 | 3300025925 | Unclassified | 1149 |
| 311 | Ga0207659_10125900 | 3300025926 | Bacteria | 1970 |
| 312 | Ga0207687_10014081 | 3300025927 | Bacteria | 5230 |
| 313 | Ga0207687_10095754 | 3300025927 | Bacteria | 2174 |
| 314 | Ga0207687_10182411 | 3300025927 | Bacteria | 1627 |
| 315 | Ga0207687_10675279 | 3300025927 | Unclassified | 875 |
| 316 | Ga0207687_11263785 | 3300025927 | Unclassified | 635 |
| 317 | Ga0207644_10107407 | 3300025931 | Bacteria | 2106 |
| 318 | Ga0207644_10486246 | 3300025931 | Bacteria | 1017 |
| 319 | Ga0207644_10761133 | 3300025931 | Bacteria | 809 |
| 320 | Ga0207644_10971200 | 3300025931 | Bacteria | 713 |
| 321 | Ga0207644_11483086 | 3300025931 | Bacteria | 569 |
| 322 | Ga0207690_10558569 | 3300025932 | Unclassified | 931 |
| 323 | Ga0207706_10006537 | 3300025933 | Bacteria | 10802 |
| 324 | Ga0207706_10119519 | 3300025933 | Bacteria | 2317 |
| 325 | Ga0207706_10330671 | 3300025933 | Bacteria | 1326 |
| 326 | Ga0207686_10166983 | 3300025934 | Bacteria | 1548 |
| 327 | Ga0207686_10251933 | 3300025934 | Unclassified | 1290 |
| 328 | Ga0207686_10466096 | 3300025934 | Bacteria | 974 |
| 329 | Ga0207686_10687048 | 3300025934 | Bacteria | 812 |
| 330 | Ga0207686_11041167 | 3300025934 | Bacteria | 665 |
| 331 | Ga0207709_10029522 | 3300025935 | Unclassified | 3182 |
| 332 | Ga0207709_10041070 | 3300025935 | Bacteria | 2774 |
| 333 | Ga0207709_10060410 | 3300025935 | Bacteria | 2363 |
| 334 | Ga0207709_11296535 | 3300025935 | Bacteria | 602 |
| 335 | Ga0207670_10012823 | 3300025936 | Bacteria | 4918 |
| 336 | Ga0207669_10158728 | 3300025937 | Bacteria | 1594 |
| 337 | Ga0207669_10208407 | 3300025937 | Bacteria | 1425 |
| 338 | Ga0207669_10301324 | 3300025937 | Unclassified | 1218 |
| 339 | Ga0207669_10511961 | 3300025937 | Bacteria | 962 |
| 340 | Ga0207669_10521426 | 3300025937 | Unclassified | 954 |
| 341 | Ga0207669_10897440 | 3300025937 | Bacteria | 740 |
| 342 | Ga0207669_11100086 | 3300025937 | Unclassified | 671 |
| 343 | Ga0207704_10061154 | 3300025938 | Bacteria | 2334 |
| 344 | Ga0207704_11009042 | 3300025938 | Bacteria | 704 |
| 345 | Ga0207704_11131668 | 3300025938 | Unclassified | 666 |
| 346 | Ga0207704_11640817 | 3300025938 | Bacteria | 552 |
| 347 | Ga0207691_10006369 | 3300025940 | Bacteria | 11405 |
| 348 | Ga0207691_10008449 | 3300025940 | Bacteria | 9887 |
| 349 | Ga0207691_10079394 | 3300025940 | Unclassified | 2953 |
| 350 | Ga0207691_11183076 | 3300025940 | Unclassified | 634 |
| 351 | Ga0207711_10158564 | 3300025941 | Bacteria | 2046 |
| 352 | Ga0207711_10171587 | 3300025941 | Bacteria | 1968 |
| 353 | Ga0207711_10216703 | 3300025941 | Unclassified | 1750 |
| 354 | Ga0207661_10014245 | 3300025944 | Bacteria | 5823 |
| 355 | Ga0207661_10035968 | 3300025944 | Bacteria | 3863 |
| 356 | Ga0207661_10070450 | 3300025944 | Bacteria | 2855 |
| 357 | Ga0207661_10389751 | 3300025944 | Unclassified | 1262 |
| 358 | Ga0207661_10530880 | 3300025944 | Bacteria | 1077 |
| 359 | Ga0207661_10960543 | 3300025944 | Bacteria | 787 |
| 360 | Ga0207661_11704536 | 3300025944 | Unclassified | 575 |
| 361 | Ga0207679_10335643 | 3300025945 | Bacteria | 1313 |
| 362 | Ga0207679_11117337 | 3300025945 | Unclassified | 723 |
| 363 | Ga0207667_10191644 | 3300025949 | Bacteria | 2098 |
| 364 | Ga0207651_10068544 | 3300025960 | Bacteria | 2501 |
| 365 | Ga0207651_10297401 | 3300025960 | Unclassified | 1341 |
| 366 | Ga0207651_10939350 | 3300025960 | Bacteria | 771 |
| 367 | Ga0207712_10052654 | 3300025961 | Bacteria | 2852 |
| 368 | Ga0207712_10312348 | 3300025961 | Bacteria | 1294 |
| 369 | Ga0207668_11681396 | 3300025972 | Bacteria | 573 |
| 370 | Ga0207640_10044988 | 3300025981 | Bacteria | 2832 |
| 371 | Ga0207640_11374061 | 3300025981 | Bacteria | 632 |
| 372 | Ga0207658_10251207 | 3300025986 | Bacteria | 1503 |
| 373 | Ga0207658_11069638 | 3300025986 | Bacteria | 737 |
| 374 | Ga0207677_10210254 | 3300026023 | Bacteria | 1553 |
| 375 | Ga0207677_10308783 | 3300026023 | Bacteria | 1310 |
| 376 | Ga0207677_11499192 | 3300026023 | Unclassified | 623 |
| 377 | Ga0207703_10080882 | 3300026035 | Bacteria | 2707 |
| 378 | Ga0207703_10127398 | 3300026035 | Unclassified | 2194 |
| 379 | Ga0207639_10184083 | 3300026041 | Bacteria | 1779 |
| 380 | Ga0207639_10520389 | 3300026041 | Bacteria | 1089 |
| 381 | Ga0207678_10046202 | 3300026067 | Bacteria | 3766 |
| 382 | Ga0207678_10093063 | 3300026067 | Bacteria | 2576 |
| 383 | Ga0207678_10418915 | 3300026067 | Unclassified | 1161 |
| 384 | Ga0207678_10430975 | 3300026067 | Bacteria | 1144 |
| 385 | Ga0207708_10038706 | 3300026075 | Bacteria | 3632 |
| 386 | Ga0207708_10453528 | 3300026075 | Unclassified | 1068 |
| 387 | Ga0207708_11101480 | 3300026075 | Archaea | 692 |
| 388 | Ga0207708_11641790 | 3300026075 | Bacteria | 565 |
| 389 | Ga0207702_10137847 | 3300026078 | Unclassified | 2204 |
| 390 | Ga0207702_10151131 | 3300026078 | Unclassified | 2112 |
| 391 | Ga0207641_10740567 | 3300026088 | Unclassified | 970 |
| 392 | Ga0207641_10874658 | 3300026088 | Unclassified | 892 |
| 393 | Ga0207641_12066872 | 3300026088 | Unclassified | 571 |
| 394 | Ga0207648_10009895 | 3300026089 | Bacteria | 9090 |
| 395 | Ga0207648_10092382 | 3300026089 | Unclassified | 2646 |
| 396 | Ga0207648_10173742 | 3300026089 | Unclassified | 1905 |
| 397 | Ga0207648_10658844 | 3300026089 | Bacteria | 968 |
| 398 | Ga0207648_10745147 | 3300026089 | Unclassified | 910 |
| 399 | Ga0207648_11187397 | 3300026089 | Unclassified | 717 |
| 400 | Ga0207676_10029132 | 3300026095 | Unclassified | 4131 |
| 401 | Ga0207676_10090067 | 3300026095 | Bacteria | 2516 |
| 402 | Ga0207676_10572265 | 3300026095 | Bacteria | 1082 |
| 403 | Ga0207674_10018022 | 3300026116 | Bacteria | 7691 |
| 404 | Ga0207674_10281330 | 3300026116 | Bacteria | 1611 |
| 405 | Ga0207674_10426357 | 3300026116 | Bacteria | 1282 |
| 406 | Ga0207675_100084663 | 3300026118 | Bacteria | 2975 |
| 407 | Ga0207675_100260370 | 3300026118 | Bacteria | 1681 |
| 408 | Ga0207675_100285492 | 3300026118 | Unclassified | 1604 |
| 409 | Ga0207683_10031736 | 3300026121 | Bacteria | 4586 |
| 410 | Ga0207683_10094502 | 3300026121 | Unclassified | 2665 |
| 411 | Ga0207683_10134886 | 3300026121 | Bacteria | 2222 |
| 412 | Ga0207683_10319832 | 3300026121 | Unclassified | 1421 |
| 413 | Ga0207683_10356898 | 3300026121 | Bacteria | 1342 |
| 414 | Ga0207683_12196911 | 3300026121 | Bacteria | 500 |
| 415 | Ga0207698_10028103 | 3300026142 | Bacteria | 4005 |
| 416 | Ga0207698_10095357 | 3300026142 | Bacteria | 2449 |
| 417 | Ga0207698_10518620 | 3300026142 | Unclassified | 1163 |
| 418 | Ga0207698_10611624 | 3300026142 | Unclassified | 1075 |
| 419 | Ga0268266_10409827 | 3300028379 | Unclassified | 1283 |
| 420 | Ga0268265_10225582 | 3300028380 | Unclassified | 1643 |
| 421 | Ga0268265_10327062 | 3300028380 | Bacteria | 1391 |
| 422 | Ga0268265_11038064 | 3300028380 | Bacteria | 811 |
| 423 | Ga0268264_10140205 | 3300028381 | Bacteria | 2155 |
| 424 | Ga0268264_10265222 | 3300028381 | Bacteria | 1602 |
| 425 | Ga0307408_100617055 | 3300031548 | Unclassified | 966 |
| 426 | Ga0307408_102453957 | 3300031548 | Bacteria | 507 |
| 427 | Ga0307409_102745913 | 3300031995 | Bacteria | 520 |
| 428 | Ga0307416_100454147 | 3300032002 | Bacteria | 1335 |
| 429 | Ga0373951_0137168 | 3300035091 | Bacteria | 677 |
| 430 | Ga0373942_0111994 | 3300035207 | Bacteria | 845 |
| 431 | Ga0451804_0721543 | 3300041463 | Unclassified | 1089 |
| 432 | Ga0451807_1895063 | 3300041486 | Bacteria | 581 |
| 433 | Ga0451853_2549579 | 3300041512 | Bacteria | 794 |
| 434 | Ga0451853_2874699 | 3300041512 | Bacteria | 781 |
| 435 | Ga0439463_013509 | 3300042016 | Unclassified | 2010 |
| 436 | Ga0450902_105809 | 3300042137 | Bacteria | 502 |
| 437 | Ga0450906_015068 | 3300042145 | Unclassified | 1408 |
| 438 | Ga0450907_007288 | 3300042146 | Bacteria | 1848 |
| 439 | Ga0450908_039235 | 3300042184 | Unclassified | 821 |
| 440 | Ga0450918_081047 | 3300042531 | Archaea | 619 |
| 441 | Ga0453683_0538970 | 3300044673 | Bacteria | 759 |
| 442 | Ga0495603_0007432 | 3300046455 | Bacteria | 6590 |
| 443 | Ga0495603_0146681 | 3300046455 | Bacteria | 1372 |
| 444 | Ga0495603_0867761 | 3300046455 | Bacteria | 513 |
| 445 | Ga0495641_0483541 | 3300046461 | Unclassified | 564 |
| 446 | Ga0495653_0922998 | 3300046463 | Bacteria | 519 |
| 447 | Ga0495582_0803114 | 3300046473 | Bacteria | 544 |
| 448 | Ga0495631_0205104 | 3300046518 | Bacteria | 843 |
| 449 | Ga0495631_0216032 | 3300046518 | Bacteria | 819 |
| 450 | Ga0495644_0098290 | 3300046523 | Bacteria | 1107 |
| 451 | Ga0495663_0265051 | 3300046525 | Bacteria | 613 |
| 452 | Ga0495587_0550245 | 3300046536 | Bacteria | 637 |
| 453 | Ga0495656_0016568 | 3300046615 | Bacteria | 2799 |
| 454 | Ga0495656_0159212 | 3300046615 | Bacteria | 1096 |
| 455 | Ga0495656_0262546 | 3300046615 | Bacteria | 875 |
| 456 | Ga0495656_0292269 | 3300046615 | Bacteria | 833 |
| 457 | Ga0495656_0569530 | 3300046615 | Bacteria | 605 |
| 458 | Ga0495611_0354771 | 3300046648 | Bacteria | 673 |
| 459 | Ga0495635_0169751 | 3300046663 | Bacteria | 1484 |
| 460 | Ga0495588_0326999 | 3300046674 | Unclassified | 806 |
| 461 | Ga0495588_0520010 | 3300046674 | Bacteria | 624 |
| 462 | Ga0495657_0076277 | 3300046675 | Bacteria | 2177 |
| 463 | Ga0495671_0170934 | 3300046692 | Bacteria | 1057 |
| 464 | Ga0495589_0216495 | 3300046794 | Bacteria | 901 |
| 465 | Ga0495589_0353498 | 3300046794 | Bacteria | 677 |
| 466 | Ga0495604_0381666 | 3300047317 | Bacteria | 931 |
| 467 | Ga0495674_0010972 | 3300047319 | Bacteria | 8560 |
| 468 | Ga0496100_0421230 | 3300048903 | Bacteria | 1020 |
| 469 | Ga0496100_0784341 | 3300048903 | Bacteria | 746 |
| 470 | Ga0496101_0373463 | 3300048904 | Bacteria | 1121 |
| 471 | Ga0496101_0719916 | 3300048904 | Bacteria | 788 |
| 472 | Ga0496102_0374508 | 3300048905 | Bacteria | 1340 |
| 473 | Ga0496102_1868497 | 3300048905 | Bacteria | 517 |
| 474 | Ga0496104_0160961 | 3300048907 | Unclassified | 2153 |
| 475 | Ga0496104_1450349 | 3300048907 | Bacteria | 589 |
| 476 | Ga0496105_0154420 | 3300048908 | Bacteria | 1886 |
| 477 | Ga0496105_0741211 | 3300048908 | Bacteria | 751 |
| 478 | Ga0496107_0207087 | 3300048910 | Unclassified | 1458 |
| 479 | Ga0496107_0311772 | 3300048910 | Bacteria | 1171 |
| 480 | Ga0496107_0424615 | 3300048910 | Bacteria | 988 |
| 481 | Ga0496108_0074930 | 3300048911 | Unclassified | 2858 |
| 482 | Ga0496108_0631214 | 3300048911 | Bacteria | 932 |
| 483 | Ga0496108_0640542 | 3300048911 | Unclassified | 924 |
| 484 | Ga0496108_1437587 | 3300048911 | Unclassified | 576 |
| 485 | Ga0496109_0246817 | 3300048912 | Unclassified | 1681 |
| 486 | Ga0496109_1537389 | 3300048912 | Unclassified | 600 |
| 487 | Ga0496110_0233407 | 3300048913 | Unclassified | 1673 |
| 488 | Ga0496111_0021052 | 3300048914 | Bacteria | 4548 |
| 489 | Ga0496111_0103492 | 3300048914 | Unclassified | 2094 |
| 490 | Ga0496111_1261095 | 3300048914 | Bacteria | 522 |
| 491 | Ga0496114_0048478 | 3300048917 | Bacteria | 3533 |
| 492 | Ga0496114_0101719 | 3300048917 | Bacteria | 2454 |
| 493 | Ga0496114_0544188 | 3300048917 | Bacteria | 1026 |
| 494 | Ga0496114_0658644 | 3300048917 | Bacteria | 920 |
| 495 | Ga0501031_0005742 | 3300049568 | Bacteria | 8085 |
| 496 | Ga0501031_0030821 | 3300049568 | Bacteria | 3498 |
| 497 | Ga0501031_0032813 | 3300049568 | Bacteria | 3386 |
| 498 | Ga0501031_0172835 | 3300049568 | Bacteria | 1412 |
| 499 | Ga0501031_0254597 | 3300049568 | Unclassified | 1141 |
| 500 | Ga0501031_0331320 | 3300049568 | Bacteria | 986 |
| 501 | Ga0501032_0294593 | 3300049569 | Unclassified | 1049 |
| 502 | Ga0501033_0023999 | 3300049570 | Bacteria | 4601 |
| 503 | Ga0501033_0223902 | 3300049570 | Bacteria | 1338 |
| 504 | Ga0501034_0302561 | 3300049571 | Bacteria | 1536 |
| 505 | Ga0501036_0015890 | 3300049572 | Bacteria | 6287 |
| 506 | Ga0501036_0016429 | 3300049572 | Bacteria | 6181 |
| 507 | Ga0501036_0019052 | 3300049572 | Bacteria | 5758 |
| 508 | Ga0501036_0022425 | 3300049572 | Bacteria | 5311 |
| 509 | Ga0501036_0126475 | 3300049572 | Unclassified | 2158 |
| 510 | Ga0501036_0186225 | 3300049572 | Unclassified | 1747 |
| 511 | Ga0501036_0490701 | 3300049572 | Unclassified | 1022 |
| 512 | Ga0501036_0527690 | 3300049572 | Bacteria | 982 |
| 513 | Ga0501037_0086920 | 3300049573 | Bacteria | 2263 |
| 514 | Ga0501037_0230640 | 3300049573 | Bacteria | 1300 |
| 515 | Ga0501038_0001233 | 3300049574 | Bacteria | 23205 |
| 516 | Ga0501038_0063079 | 3300049574 | Bacteria | 3164 |
| 517 | Ga0501038_0081404 | 3300049574 | Bacteria | 2728 |
| 518 | Ga0501038_0086589 | 3300049574 | Bacteria | 2632 |
| 519 | Ga0501038_0239779 | 3300049574 | Bacteria | 1440 |
| 520 | Ga0501039_0002571 | 3300049575 | Bacteria | 13554 |
| 521 | Ga0501039_0042951 | 3300049575 | Bacteria | 3492 |
| 522 | Ga0501039_0202075 | 3300049575 | Bacteria | 1562 |
| 523 | Ga0501039_0491962 | 3300049575 | Unclassified | 963 |
| 524 | Ga0501040_0021623 | 3300049576 | Bacteria | 4298 |
| 525 | Ga0501040_0057485 | 3300049576 | Bacteria | 2670 |
| 526 | Ga0501040_0064842 | 3300049576 | Bacteria | 2515 |
| 527 | Ga0501040_0177247 | 3300049576 | Bacteria | 1510 |
| 528 | Ga0501040_0201982 | 3300049576 | Bacteria | 1411 |
| 529 | Ga0501040_0216803 | 3300049576 | Bacteria | 1361 |
| 530 | Ga0501040_0298707 | 3300049576 | Unclassified | 1151 |
| 531 | Ga0501041_0016374 | 3300049577 | Bacteria | 4406 |
| 532 | Ga0501041_0067223 | 3300049577 | Bacteria | 2197 |
| 533 | Ga0501041_0084006 | 3300049577 | Bacteria | 1962 |
| 534 | Ga0501041_0457128 | 3300049577 | Bacteria | 811 |
| 535 | Ga0501041_0815030 | 3300049577 | Bacteria | 599 |
| 536 | Ga0501042_0001944 | 3300049578 | Bacteria | 12443 |
| 537 | Ga0501042_0013760 | 3300049578 | Bacteria | 5511 |
| 538 | Ga0501042_0023089 | 3300049578 | Bacteria | 4348 |
| 539 | Ga0501042_0029424 | 3300049578 | Bacteria | 3873 |
| 540 | Ga0501042_0029643 | 3300049578 | Bacteria | 3860 |
| 541 | Ga0501042_0066670 | 3300049578 | Bacteria | 2573 |
| 542 | Ga0501043_0038684 | 3300049579 | Bacteria | 3751 |
| 543 | Ga0501043_0060335 | 3300049579 | Bacteria | 2977 |
| 544 | Ga0501043_0081171 | 3300049579 | Bacteria | 2548 |
| 545 | Ga0501043_0128699 | 3300049579 | Bacteria | 1985 |
| 546 | Ga0501046_0002238 | 3300049580 | Bacteria | 18255 |
| 547 | Ga0501046_0046873 | 3300049580 | Bacteria | 3429 |
| 548 | Ga0501046_0126345 | 3300049580 | Unclassified | 1942 |
| 549 | Ga0501046_0287048 | 3300049580 | Bacteria | 1204 |
| 550 | Ga0501048_0010299 | 3300049582 | Bacteria | 6988 |
| 551 | Ga0501048_0022562 | 3300049582 | Bacteria | 4603 |
| 552 | Ga0501048_0069452 | 3300049582 | Bacteria | 2488 |
| 553 | Ga0501048_0079666 | 3300049582 | Unclassified | 2311 |
| 554 | Ga0501048_0123624 | 3300049582 | Bacteria | 1829 |
| 555 | Ga0501048_0835779 | 3300049582 | Bacteria | 662 |
| 556 | Ga0501067_0007721 | 3300049583 | Bacteria | 5983 |
| 557 | Ga0501067_0017547 | 3300049583 | Bacteria | 3961 |
| 558 | Ga0501067_0403022 | 3300049583 | Bacteria | 763 |
| 559 | Ga0501068_0032416 | 3300049584 | Bacteria | 3108 |
| 560 | Ga0501068_0041064 | 3300049584 | Bacteria | 2779 |
| 561 | Ga0501068_0340274 | 3300049584 | Unclassified | 963 |
| 562 | Ga0501068_0973970 | 3300049584 | Bacteria | 559 |
| 563 | Ga0501069_0007569 | 3300049585 | Bacteria | 5700 |
| 564 | Ga0501069_0029282 | 3300049585 | Bacteria | 3022 |
| 565 | Ga0501069_0056277 | 3300049585 | Bacteria | 2191 |
| 566 | Ga0501069_0188959 | 3300049585 | Bacteria | 1192 |
| 567 | Ga0501069_0383137 | 3300049585 | Bacteria | 831 |
| 568 | Ga0501069_0590548 | 3300049585 | Bacteria | 666 |
| 569 | Ga0501070_0021898 | 3300049586 | Bacteria | 5355 |
| 570 | Ga0501070_0056221 | 3300049586 | Bacteria | 3262 |
| 571 | Ga0501070_0078905 | 3300049586 | Bacteria | 2724 |
| 572 | Ga0501070_0481905 | 3300049586 | Archaea | 998 |
| 573 | Ga0501071_0015825 | 3300049587 | Bacteria | 5182 |
| 574 | Ga0501071_0026430 | 3300049587 | Bacteria | 4074 |
| 575 | Ga0501071_0041548 | 3300049587 | Bacteria | 3293 |
| 576 | Ga0501071_0062523 | 3300049587 | Bacteria | 2697 |
| 577 | Ga0501071_0081894 | 3300049587 | Bacteria | 2362 |
| 578 | Ga0501071_0207622 | 3300049587 | Bacteria | 1472 |
| 579 | Ga0501071_0249725 | 3300049587 | Bacteria | 1339 |
| 580 | Ga0501071_0468716 | 3300049587 | Bacteria | 965 |
| 581 | Ga0501071_0639434 | 3300049587 | Bacteria | 818 |
| 582 | Ga0501071_1025061 | 3300049587 | Bacteria | 637 |
| 583 | Ga0501072_0015977 | 3300049588 | Bacteria | 5755 |
| 584 | Ga0501072_0041305 | 3300049588 | Bacteria | 3622 |
| 585 | Ga0501072_0045386 | 3300049588 | Bacteria | 3455 |
| 586 | Ga0501072_0069967 | 3300049588 | Unclassified | 2771 |
| 587 | Ga0501072_0079048 | 3300049588 | Bacteria | 2604 |
| 588 | Ga0501072_0104506 | 3300049588 | Bacteria | 2252 |
| 589 | Ga0501072_0317278 | 3300049588 | Bacteria | 1238 |
| 590 | Ga0501073_0053563 | 3300049589 | Unclassified | 2824 |
| 591 | Ga0501073_0313037 | 3300049589 | Bacteria | 1083 |
| 592 | Ga0501074_0015498 | 3300049590 | Bacteria | 5541 |
| 593 | Ga0501074_0016179 | 3300049590 | Bacteria | 5420 |
| 594 | Ga0501074_0019682 | 3300049590 | Bacteria | 4900 |
| 595 | Ga0501074_0029712 | 3300049590 | Bacteria | 3959 |
| 596 | Ga0501074_0227394 | 3300049590 | Unclassified | 1328 |
| 597 | Ga0501074_0513004 | 3300049590 | Bacteria | 849 |
| 598 | Ga0501074_0616857 | 3300049590 | Bacteria | 767 |
| 599 | Ga0501075_0020640 | 3300049591 | Bacteria | 4794 |
| 600 | Ga0501075_0029430 | 3300049591 | Bacteria | 4062 |
| 601 | Ga0501075_0042558 | 3300049591 | Unclassified | 3405 |
| 602 | Ga0501075_0072840 | 3300049591 | Bacteria | 2597 |
| 603 | Ga0501075_0091945 | 3300049591 | Bacteria | 2302 |
| 604 | Ga0501075_0101065 | 3300049591 | Bacteria | 2190 |
| 605 | Ga0501075_0260162 | 3300049591 | Unclassified | 1323 |
| 606 | Ga0501075_1055731 | 3300049591 | Bacteria | 617 |
| 607 | Ga0501076_0017170 | 3300049592 | Bacteria | 5497 |
| 608 | Ga0501076_0041066 | 3300049592 | Bacteria | 3637 |
| 609 | Ga0501076_0042002 | 3300049592 | Bacteria | 3600 |
| 610 | Ga0501076_0044689 | 3300049592 | Bacteria | 3493 |
| 611 | Ga0501076_0069701 | 3300049592 | Bacteria | 2810 |
| 612 | Ga0501076_0080631 | 3300049592 | Unclassified | 2613 |
| 613 | Ga0501076_0108028 | 3300049592 | Bacteria | 2247 |
| 614 | Ga0501076_0365248 | 3300049592 | Unclassified | 1186 |
| 615 | Ga0501076_0392689 | 3300049592 | Unclassified | 1141 |
| 616 | Ga0501076_0976121 | 3300049592 | Bacteria | 698 |
| 617 | Ga0501076_1783658 | 3300049592 | Bacteria | 504 |
| 618 | Ga0501077_0008860 | 3300049593 | Bacteria | 6243 |
| 619 | Ga0501077_0015815 | 3300049593 | Bacteria | 4752 |
| 620 | Ga0501077_0020119 | 3300049593 | Bacteria | 4224 |
| 621 | Ga0501077_0028442 | 3300049593 | Bacteria | 3552 |
| 622 | Ga0501077_0036010 | 3300049593 | Bacteria | 3152 |
| 623 | Ga0501077_0048282 | 3300049593 | Bacteria | 2704 |
| 624 | Ga0501077_0299344 | 3300049593 | Bacteria | 1025 |
| 625 | Ga0501077_0539338 | 3300049593 | Unclassified | 748 |
| 626 | Ga0501077_0688714 | 3300049593 | Archaea | 657 |
| 627 | Ga0501079_0042134 | 3300049741 | Bacteria | 3526 |
| 628 | Ga0501079_0052745 | 3300049741 | Bacteria | 3138 |
| 629 | Ga0501079_0069293 | 3300049741 | Bacteria | 2722 |
| 630 | Ga0501079_0086551 | 3300049741 | Bacteria | 2425 |
| 631 | Ga0501079_0229335 | 3300049741 | Bacteria | 1451 |
| 632 | Ga0501079_0366321 | 3300049741 | Bacteria | 1130 |
| 633 | Ga0501080_0032915 | 3300049742 | Bacteria | 4837 |
| 634 | Ga0501080_0033295 | 3300049742 | Bacteria | 4809 |
| 635 | Ga0501080_0037636 | 3300049742 | Bacteria | 4518 |
| 636 | Ga0501080_0056973 | 3300049742 | Bacteria | 3639 |
| 637 | Ga0501080_0076337 | 3300049742 | Bacteria | 3117 |
| 638 | Ga0501080_0097529 | 3300049742 | Bacteria | 2729 |
| 639 | Ga0501080_0478851 | 3300049742 | Bacteria | 1114 |
| 640 | Ga0501080_0610216 | 3300049742 | Bacteria | 968 |
| 641 | Ga0501080_0783550 | 3300049742 | Bacteria | 837 |
| 642 | Ga0501080_1268085 | 3300049742 | Archaea | 632 |
| 643 | Ga0501081_0005337 | 3300049743 | Bacteria | 8292 |
| 644 | Ga0501081_0017215 | 3300049743 | Bacteria | 4781 |
| 645 | Ga0501081_0070783 | 3300049743 | Bacteria | 2430 |
| 646 | Ga0501081_0096120 | 3300049743 | Bacteria | 2089 |
| 647 | Ga0501081_0097930 | 3300049743 | Bacteria | 2070 |
| 648 | Ga0501081_0150992 | 3300049743 | Bacteria | 1669 |
| 649 | Ga0501081_0210410 | 3300049743 | Bacteria | 1412 |
| 650 | Ga0501081_0218427 | 3300049743 | Bacteria | 1386 |
| 651 | Ga0501083_0001237 | 3300049744 | Bacteria | 17325 |
| 652 | Ga0501083_0019007 | 3300049744 | Bacteria | 4783 |
| 653 | Ga0501083_0070801 | 3300049744 | Bacteria | 2319 |
| 654 | Ga0501083_0078168 | 3300049744 | Bacteria | 2195 |
| 655 | Ga0501083_0194040 | 3300049744 | Unclassified | 1325 |
| 656 | Ga0501083_1112286 | 3300049744 | Bacteria | 514 |
| 657 | Ga0501035_0006912 | 3300049822 | Bacteria | 10599 |
| 658 | Ga0501035_0092494 | 3300049822 | Bacteria | 2661 |
| 659 | Ga0501035_0242379 | 3300049822 | Unclassified | 1533 |
| 660 | Ga0501035_0551313 | 3300049822 | Bacteria | 944 |
| 661 | Ga0501044_0194459 | 3300049823 | Bacteria | 1989 |
| 662 | Ga0501044_0317303 | 3300049823 | Bacteria | 1484 |
| 663 | Ga0501045_0021740 | 3300049824 | Bacteria | 4593 |
| 664 | Ga0501045_0026671 | 3300049824 | Bacteria | 4157 |
| 665 | Ga0501045_0037507 | 3300049824 | Bacteria | 3523 |
| 666 | Ga0501045_0046832 | 3300049824 | Unclassified | 3148 |
| 667 | Ga0501045_0095884 | 3300049824 | Bacteria | 2194 |
| 668 | Ga0501045_0154153 | 3300049824 | Unclassified | 1709 |
| 669 | Ga0501045_0309378 | 3300049824 | Bacteria | 1176 |
| 670 | Ga0501045_0371313 | 3300049824 | Bacteria | 1065 |
| 671 | Ga0501045_0436225 | 3300049824 | Bacteria | 974 |
| 672 | Ga0501045_0531236 | 3300049824 | Bacteria | 873 |
| 673 | nmdc:mga00v17_167978_c1 | 3300050491 | Bacteria | 1414 |
| 674 | nmdc:mga0yw44_15657_c1 | 3300050492 | Bacteria | 4070 |
| 675 | nmdc:mga0yw44_707987_c1 | 3300050492 | Bacteria | 684 |
| 676 | nmdc:mga06z11_392600_c1 | 3300050494 | Bacteria | 834 |
| 677 | nmdc:mga05p37_1057987_c1 | 3300050507 | Bacteria | 855 |
| 678 | nmdc:mga05p37_1712565_c1 | 3300050507 | Bacteria | 612 |
| 679 | nmdc:mga05p37_2019990_c1 | 3300050507 | Bacteria | 544 |
| 680 | nmdc:mga05p37_212203_c1 | 3300050507 | Bacteria | 2340 |
| 681 | nmdc:mga05p37_265010_c1 | 3300050507 | Bacteria | 2055 |
| 682 | nmdc:mga05p37_445176_c1 | 3300050507 | Bacteria | 1501 |
| 683 | nmdc:mga09592_1144571_c1 | 3300050508 | Bacteria | 645 |
| 684 | nmdc:mga0qj67_80648_c1 | 3300050509 | Bacteria | 2607 |
| 685 | nmdc:mga06r32_73161_c1 | 3300050510 | Bacteria | 3319 |
| 686 | nmdc:mga08y16_10062_c1 | 3300050511 | Bacteria | 9926 |
| 687 | nmdc:mga08y16_258391_c1 | 3300050511 | Bacteria | 1799 |
| 688 | nmdc:mga0n895_1869818_c1 | 3300050512 | Unclassified | 560 |
| 689 | nmdc:mga0rr50_443861_c1 | 3300050513 | Bacteria | 1099 |
| 690 | nmdc:mga08x19_1166353_c1 | 3300050514 | Unclassified | 546 |
| 691 | nmdc:mga0a205_1344455_c1 | 3300050515 | Bacteria | 562 |
| 692 | Ga0495619_0011342 | 3300053085 | Bacteria | 5611 |
| 693 | Ga0501084_0006937 | 3300054114 | Bacteria | 9329 |
| 694 | Ga0501084_0008276 | 3300054114 | Bacteria | 8580 |
| 695 | Ga0501084_0038942 | 3300054114 | Bacteria | 3975 |
| 696 | Ga0501084_0049123 | 3300054114 | Bacteria | 3531 |
| 697 | Ga0501084_0104713 | 3300054114 | Bacteria | 2376 |
| 698 | Ga0501084_0105788 | 3300054114 | Bacteria | 2363 |
| 699 | Ga0501084_0427384 | 3300054114 | Bacteria | 1120 |
| 700 | Ga0501084_0820090 | 3300054114 | Unclassified | 783 |
| 701 | Ga0501082_0016449 | 3300060353 | Bacteria | 6367 |
| 702 | Ga0501082_0017102 | 3300060353 | Bacteria | 6247 |
| 703 | Ga0501082_0061060 | 3300060353 | Bacteria | 3245 |
| 704 | Ga0501082_0119332 | 3300060353 | Bacteria | 2285 |
| 705 | Ga0501082_0123555 | 3300060353 | Bacteria | 2244 |
| 706 | Ga0501082_0188650 | 3300060353 | Unclassified | 1794 |
| 707 | Ga0501082_0278193 | 3300060353 | Bacteria | 1457 |
| 708 | Ga0501082_0357918 | 3300060353 | Bacteria | 1273 |
| 709 | Ga0501082_0363187 | 3300060353 | Bacteria | 1263 |
| 710 | Ga0501082_0518156 | 3300060353 | Bacteria | 1042 |
| 711 | Ga0501082_0665664 | 3300060353 | Unclassified | 911 |
| 712 | Ga0501082_1535340 | 3300060353 | Bacteria | 581 |
| 713 | Ga0501082_1700359 | 3300060353 | Bacteria | 551 |
| 714 | Ga0530510_0003037 | 3300061734 | Bacteria | 11528 |
| 715 | Ga0530510_0059056 | 3300061734 | Bacteria | 2774 |
| 716 | Ga0530510_0140380 | 3300061734 | Bacteria | 1780 |
| 717 | Ga0530510_0642681 | 3300061734 | Bacteria | 808 |
| 718 | Ga0530510_1013162 | 3300061734 | Bacteria | 636 |
| 719 | Ga0530510_1194546 | 3300061734 | Bacteria | 583 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025931 | Ga0207644_10971200 | Ga0207644_109712002 | 81 |
| 2 | 3300026121 | Ga0207683_12196911 | Ga0207683_121969111 | 88 |
| 3 | 3300046463 | Ga0495653_0922998 | Ga0495653_0922998_12_335 | 88 |
| 4 | 3300046518 | Ga0495631_0205104 | Ga0495631_0205104_271_597 | 88 |
| 5 | 3300046536 | Ga0495587_0550245 | Ga0495587_0550245_64_387 | 88 |
| 6 | 3300046663 | Ga0495635_0169751 | Ga0495635_0169751_544_867 | 88 |
| 7 | 3300046675 | Ga0495657_0076277 | Ga0495657_0076277_223_546 | 88 |
| 8 | 3300047317 | Ga0495604_0381666 | Ga0495604_0381666_165_488 | 88 |
| 9 | 3300047319 | Ga0495674_0010972 | Ga0495674_0010972_2808_3131 | 88 |
| 10 | 3300053085 | Ga0495619_0011342 | Ga0495619_0011342_3392_3715 | 88 |
| 11 | 3300014325 | Ga0163163_10964601 | Ga0163163_109646012 | 89 |
| 12 | 3300014326 | Ga0157380_12679987 | Ga0157380_126799872 | 89 |
| 13 | 3300046455 | Ga0495603_0867761 | Ga0495603_0867761_19_345 | 89 |
| 14 | 3300046518 | Ga0495631_0216032 | Ga0495631_0216032_466_792 | 89 |
| 15 | 3300046674 | Ga0495588_0326999 | Ga0495588_0326999_365_691 | 89 |
| 16 | 3300048911 | Ga0496108_1437587 | Ga0496108_1437587_137_463 | 89 |
| 17 | 3300048912 | Ga0496109_1537389 | Ga0496109_1537389_119_445 | 89 |
| 18 | 3300049576 | Ga0501040_0177247 | Ga0501040_0177247_760_1074 | 95 |
| 19 | 3300049587 | Ga0501071_1025061 | Ga0501071_1025061_184_498 | 95 |
| 20 | 3300049741 | Ga0501079_0229335 | Ga0501079_0229335_189_503 | 95 |
| 21 | 3300049742 | Ga0501080_0783550 | Ga0501080_0783550_310_624 | 95 |
| 22 | 3300054114 | Ga0501084_0820090 | Ga0501084_0820090_29_343 | 95 |
| 23 | 3300005543 | Ga0070672_100491269 | Ga0070672_1004912693 | 96 |
| 24 | 3300005937 | Ga0081455_10011342 | Ga0081455_100113426 | 97 |
| 25 | 3300005981 | Ga0081538_10001394 | Ga0081538_1000139411 | 100 |
| 26 | 3300005354 | Ga0070675_100238849 | Ga0070675_1002388492 | 101 |
| 27 | 3300006237 | Ga0097621_100249430 | Ga0097621_1002494302 | 101 |
| 28 | 3300009098 | Ga0105245_10288603 | Ga0105245_102886032 | 101 |
| 29 | 3300009176 | Ga0105242_10142341 | Ga0105242_101423412 | 101 |
| 30 | 3300025927 | Ga0207687_10182411 | Ga0207687_101824112 | 101 |
| 31 | 3300025938 | Ga0207704_11640817 | Ga0207704_116408172 | 101 |
| 32 | 3300025940 | Ga0207691_11183076 | Ga0207691_111830762 | 101 |
| 33 | 3300046525 | Ga0495663_0265051 | Ga0495663_0265051_222_527 | 101 |
| 34 | 3300046674 | Ga0495588_0520010 | Ga0495588_0520010_83_388 | 101 |
| 35 | 3300005356 | Ga0070674_100164746 | Ga0070674_1001647462 | 102 |
| 36 | 3300005441 | Ga0070700_100854187 | Ga0070700_1008541871 | 102 |
| 37 | 3300006881 | Ga0068865_100823643 | Ga0068865_1008236432 | 102 |
| 38 | 3300009148 | Ga0105243_10372540 | Ga0105243_103725403 | 102 |
| 39 | 3300014326 | Ga0157380_11277449 | Ga0157380_112774492 | 102 |
| 40 | 3300025937 | Ga0207669_10897440 | Ga0207669_108974401 | 102 |
| 41 | 3300026075 | Ga0207708_11641790 | Ga0207708_116417902 | 102 |
| 42 | 3300048905 | Ga0496102_1868497 | Ga0496102_1868497_156_467 | 102 |
| 43 | 3300049583 | Ga0501067_0017547 | Ga0501067_0017547_2056_2367 | 102 |
| 44 | 3300049592 | Ga0501076_0392689 | Ga0501076_0392689_25_333 | 102 |
| 45 | 3300061734 | Ga0530510_0642681 | Ga0530510_0642681_364_675 | 102 |
| 46 | 3300005341 | Ga0070691_10671094 | Ga0070691_106710942 | 103 |
| 47 | 3300005356 | Ga0070674_100175982 | Ga0070674_1001759822 | 103 |
| 48 | 3300012513 | Ga0157326_1070366 | Ga0157326_10703662 | 103 |
| 49 | 3300014326 | Ga0157380_12438997 | Ga0157380_124389972 | 103 |
| 50 | 3300025937 | Ga0207669_10511961 | Ga0207669_105119611 | 103 |
| 51 | 3300049568 | Ga0501031_0172835 | Ga0501031_0172835_889_1200 | 103 |
| 52 | 3300049570 | Ga0501033_0223902 | Ga0501033_0223902_223_534 | 103 |
| 53 | 3300049572 | Ga0501036_0019052 | Ga0501036_0019052_3699_4010 | 103 |
| 54 | 3300049574 | Ga0501038_0086589 | Ga0501038_0086589_208_519 | 103 |
| 55 | 3300049574 | Ga0501038_0239779 | Ga0501038_0239779_532_843 | 103 |
| 56 | 3300049575 | Ga0501039_0202075 | Ga0501039_0202075_939_1250 | 103 |
| 57 | 3300049576 | Ga0501040_0057485 | Ga0501040_0057485_1733_2044 | 103 |
| 58 | 3300049578 | Ga0501042_0013760 | Ga0501042_0013760_4394_4705 | 103 |
| 59 | 3300049582 | Ga0501048_0123624 | Ga0501048_0123624_603_914 | 103 |
| 60 | 3300049584 | Ga0501068_0973970 | Ga0501068_0973970_122_433 | 103 |
| 61 | 3300049585 | Ga0501069_0188959 | Ga0501069_0188959_525_836 | 103 |
| 62 | 3300049587 | Ga0501071_0062523 | Ga0501071_0062523_1421_1732 | 103 |
| 63 | 3300049587 | Ga0501071_0639434 | Ga0501071_0639434_379_690 | 103 |
| 64 | 3300049588 | Ga0501072_0079048 | Ga0501072_0079048_647_958 | 103 |
| 65 | 3300049588 | Ga0501072_0104506 | Ga0501072_0104506_248_559 | 103 |
| 66 | 3300049588 | Ga0501072_0317278 | Ga0501072_0317278_619_930 | 103 |
| 67 | 3300049591 | Ga0501075_0072840 | Ga0501075_0072840_1587_1898 | 103 |
| 68 | 3300049591 | Ga0501075_1055731 | Ga0501075_1055731_134_445 | 103 |
| 69 | 3300049592 | Ga0501076_0042002 | Ga0501076_0042002_2428_2739 | 103 |
| 70 | 3300049592 | Ga0501076_0069701 | Ga0501076_0069701_2039_2350 | 103 |
| 71 | 3300049592 | Ga0501076_0365248 | Ga0501076_0365248_157_468 | 103 |
| 72 | 3300049592 | Ga0501076_0976121 | Ga0501076_0976121_17_331 | 103 |
| 73 | 3300049592 | Ga0501076_1783658 | Ga0501076_1783658_98_409 | 103 |
| 74 | 3300049593 | Ga0501077_0048282 | Ga0501077_0048282_979_1290 | 103 |
| 75 | 3300049593 | Ga0501077_0299344 | Ga0501077_0299344_625_939 | 103 |
| 76 | 3300049593 | Ga0501077_0688714 | Ga0501077_0688714_97_408 | 103 |
| 77 | 3300049742 | Ga0501080_0032915 | Ga0501080_0032915_4419_4730 | 103 |
| 78 | 3300049742 | Ga0501080_0478851 | Ga0501080_0478851_787_1098 | 103 |
| 79 | 3300049743 | Ga0501081_0096120 | Ga0501081_0096120_532_843 | 103 |
| 80 | 3300049743 | Ga0501081_0210410 | Ga0501081_0210410_415_726 | 103 |
| 81 | 3300049744 | Ga0501083_0078168 | Ga0501083_0078168_1716_2027 | 103 |
| 82 | 3300049822 | Ga0501035_0242379 | Ga0501035_0242379_475_786 | 103 |
| 83 | 3300049822 | Ga0501035_0551313 | Ga0501035_0551313_473_784 | 103 |
| 84 | 3300049824 | Ga0501045_0037507 | Ga0501045_0037507_599_910 | 103 |
| 85 | 3300050513 | nmdc:mga0rr50_443861_c1 | nmdc:mga0rr50_443861_c1_458_772 | 103 |
| 86 | 3300054114 | Ga0501084_0049123 | Ga0501084_0049123_2120_2431 | 103 |
| 87 | 3300054114 | Ga0501084_0104713 | Ga0501084_0104713_1431_1742 | 103 |
| 88 | 3300060353 | Ga0501082_0016449 | Ga0501082_0016449_2847_3158 | 103 |
| 89 | 3300060353 | Ga0501082_0188650 | Ga0501082_0188650_554_865 | 103 |
| 90 | 3300060353 | Ga0501082_0518156 | Ga0501082_0518156_699_1010 | 103 |
| 91 | 3300061734 | Ga0530510_1194546 | Ga0530510_1194546_101_412 | 103 |
| 92 | 3300005471 | Ga0070698_100712639 | Ga0070698_1007126392 | 104 |
| 93 | 3300005577 | Ga0068857_100033412 | Ga0068857_1000334123 | 104 |
| 94 | 3300005840 | Ga0068870_10000685 | Ga0068870_1000068511 | 104 |
| 95 | 3300006038 | Ga0075365_10760253 | Ga0075365_107602532 | 104 |
| 96 | 3300006051 | Ga0075364_11163294 | Ga0075364_111632942 | 104 |
| 97 | 3300006844 | Ga0075428_100188205 | Ga0075428_1001882053 | 104 |
| 98 | 3300006846 | Ga0075430_100186571 | Ga0075430_1001865712 | 104 |
| 99 | 3300006880 | Ga0075429_100633080 | Ga0075429_1006330802 | 104 |
| 100 | 3300006880 | Ga0075429_101707060 | Ga0075429_1017070602 | 104 |
| 101 | 3300006881 | Ga0068865_100438663 | Ga0068865_1004386632 | 104 |
| 102 | 3300009147 | Ga0114129_10353057 | Ga0114129_103530572 | 104 |
| 103 | 3300009147 | Ga0114129_10451480 | Ga0114129_104514802 | 104 |
| 104 | 3300009147 | Ga0114129_10692940 | Ga0114129_106929402 | 104 |
| 105 | 3300013297 | Ga0157378_12537265 | Ga0157378_125372652 | 104 |
| 106 | 3300025908 | Ga0207643_10002875 | Ga0207643_100028757 | 104 |
| 107 | 3300025925 | Ga0207650_10010107 | Ga0207650_100101074 | 104 |
| 108 | 3300025937 | Ga0207669_11100086 | Ga0207669_111000862 | 104 |
| 109 | 3300026095 | Ga0207676_10572265 | Ga0207676_105722651 | 104 |
| 110 | 3300042146 | Ga0450907_007288 | Ga0450907_007288_212_526 | 104 |
| 111 | 3300042531 | Ga0450918_081047 | Ga0450918_081047_23_337 | 104 |
| 112 | 3300046615 | Ga0495656_0159212 | Ga0495656_0159212_577_894 | 104 |
| 113 | 3300046615 | Ga0495656_0569530 | Ga0495656_0569530_209_523 | 104 |
| 114 | 3300049568 | Ga0501031_0005742 | Ga0501031_0005742_7736_8050 | 104 |
| 115 | 3300049571 | Ga0501034_0302561 | Ga0501034_0302561_498_812 | 104 |
| 116 | 3300049572 | Ga0501036_0022425 | Ga0501036_0022425_2020_2334 | 104 |
| 117 | 3300049574 | Ga0501038_0001233 | Ga0501038_0001233_10064_10378 | 104 |
| 118 | 3300049575 | Ga0501039_0002571 | Ga0501039_0002571_13130_13444 | 104 |
| 119 | 3300049577 | Ga0501041_0016374 | Ga0501041_0016374_2951_3265 | 104 |
| 120 | 3300049578 | Ga0501042_0001944 | Ga0501042_0001944_7569_7883 | 104 |
| 121 | 3300049579 | Ga0501043_0038684 | Ga0501043_0038684_1479_1793 | 104 |
| 122 | 3300049580 | Ga0501046_0002238 | Ga0501046_0002238_16935_17249 | 104 |
| 123 | 3300049582 | Ga0501048_0010299 | Ga0501048_0010299_812_1126 | 104 |
| 124 | 3300049583 | Ga0501067_0007721 | Ga0501067_0007721_1766_2080 | 104 |
| 125 | 3300049583 | Ga0501067_0403022 | Ga0501067_0403022_82_396 | 104 |
| 126 | 3300049585 | Ga0501069_0029282 | Ga0501069_0029282_299_613 | 104 |
| 127 | 3300049585 | Ga0501069_0056277 | Ga0501069_0056277_1115_1429 | 104 |
| 128 | 3300049585 | Ga0501069_0383137 | Ga0501069_0383137_341_655 | 104 |
| 129 | 3300049586 | Ga0501070_0021898 | Ga0501070_0021898_4836_5150 | 104 |
| 130 | 3300049587 | Ga0501071_0026430 | Ga0501071_0026430_2823_3137 | 104 |
| 131 | 3300049588 | Ga0501072_0015977 | Ga0501072_0015977_1195_1509 | 104 |
| 132 | 3300049589 | Ga0501073_0313037 | Ga0501073_0313037_675_989 | 104 |
| 133 | 3300049590 | Ga0501074_0015498 | Ga0501074_0015498_2136_2450 | 104 |
| 134 | 3300049591 | Ga0501075_0029430 | Ga0501075_0029430_643_957 | 104 |
| 135 | 3300049591 | Ga0501075_0260162 | Ga0501075_0260162_59_376 | 104 |
| 136 | 3300049592 | Ga0501076_0017170 | Ga0501076_0017170_2994_3308 | 104 |
| 137 | 3300049593 | Ga0501077_0015815 | Ga0501077_0015815_2868_3182 | 104 |
| 138 | 3300049593 | Ga0501077_0028442 | Ga0501077_0028442_2423_2779 | 104 |
| 139 | 3300049741 | Ga0501079_0086551 | Ga0501079_0086551_1089_1403 | 104 |
| 140 | 3300049742 | Ga0501080_0037636 | Ga0501080_0037636_1221_1535 | 104 |
| 141 | 3300049743 | Ga0501081_0017215 | Ga0501081_0017215_3323_3637 | 104 |
| 142 | 3300049744 | Ga0501083_0001237 | Ga0501083_0001237_13502_13816 | 104 |
| 143 | 3300049822 | Ga0501035_0006912 | Ga0501035_0006912_2984_3298 | 104 |
| 144 | 3300049823 | Ga0501044_0317303 | Ga0501044_0317303_331_645 | 104 |
| 145 | 3300049824 | Ga0501045_0095884 | Ga0501045_0095884_896_1210 | 104 |
| 146 | 3300049824 | Ga0501045_0371313 | Ga0501045_0371313_685_999 | 104 |
| 147 | 3300049824 | Ga0501045_0436225 | Ga0501045_0436225_398_712 | 104 |
| 148 | 3300050492 | nmdc:mga0yw44_707987_c1 | nmdc:mga0yw44_707987_c1_31_345 | 104 |
| 149 | 3300050507 | nmdc:mga05p37_1057987_c1 | nmdc:mga05p37_1057987_c1_527_841 | 104 |
| 150 | 3300050507 | nmdc:mga05p37_1712565_c1 | nmdc:mga05p37_1712565_c1_78_392 | 104 |
| 151 | 3300050507 | nmdc:mga05p37_212203_c1 | nmdc:mga05p37_212203_c1_1172_1486 | 104 |
| 152 | 3300050507 | nmdc:mga05p37_265010_c1 | nmdc:mga05p37_265010_c1_1242_1556 | 104 |
| 153 | 3300050508 | nmdc:mga09592_1144571_c1 | nmdc:mga09592_1144571_c1_234_548 | 104 |
| 154 | 3300050509 | nmdc:mga0qj67_80648_c1 | nmdc:mga0qj67_80648_c1_463_777 | 104 |
| 155 | 3300050510 | nmdc:mga06r32_73161_c1 | nmdc:mga06r32_73161_c1_2396_2710 | 104 |
| 156 | 3300054114 | Ga0501084_0008276 | Ga0501084_0008276_764_1078 | 104 |
| 157 | 3300060353 | Ga0501082_0017102 | Ga0501082_0017102_813_1127 | 104 |
| 158 | 3300060353 | Ga0501082_0357918 | Ga0501082_0357918_376_693 | 104 |
| 159 | 3300005577 | Ga0068857_100450002 | Ga0068857_1004500022 | 105 |
| 160 | 3300009094 | Ga0111539_10074007 | Ga0111539_100740072 | 105 |
| 161 | 3300009147 | Ga0114129_11790774 | Ga0114129_117907742 | 105 |
| 162 | 3300009148 | Ga0105243_12465050 | Ga0105243_124650501 | 105 |
| 163 | 3300014326 | Ga0157380_10277994 | Ga0157380_102779942 | 105 |
| 164 | 3300025937 | Ga0207669_10208407 | Ga0207669_102084072 | 105 |
| 165 | 3300026089 | Ga0207648_10658844 | Ga0207648_106588442 | 105 |
| 166 | 3300026116 | Ga0207674_10018022 | Ga0207674_100180225 | 105 |
| 167 | 3300026118 | Ga0207675_100260370 | Ga0207675_1002603702 | 105 |
| 168 | 3300046615 | Ga0495656_0262546 | Ga0495656_0262546_317_634 | 105 |
| 169 | 3300049568 | Ga0501031_0331320 | Ga0501031_0331320_603_920 | 105 |
| 170 | 3300049577 | Ga0501041_0815030 | Ga0501041_0815030_143_460 | 105 |
| 171 | 3300049590 | Ga0501074_0513004 | Ga0501074_0513004_474_791 | 105 |
| 172 | 3300049742 | Ga0501080_0610216 | Ga0501080_0610216_31_348 | 105 |
| 173 | 3300049824 | Ga0501045_0309378 | Ga0501045_0309378_654_971 | 105 |
| 174 | 3300050511 | nmdc:mga08y16_258391_c1 | nmdc:mga08y16_258391_c1_479_802 | 105 |
| 175 | 3300060353 | Ga0501082_1700359 | Ga0501082_1700359_65_382 | 105 |
| 176 | 3300005327 | Ga0070658_10741140 | Ga0070658_107411402 | 106 |
| 177 | 3300005329 | Ga0070683_100163196 | Ga0070683_1001631963 | 106 |
| 178 | 3300005329 | Ga0070683_100204920 | Ga0070683_1002049203 | 106 |
| 179 | 3300005329 | Ga0070683_101284004 | Ga0070683_1012840042 | 106 |
| 180 | 3300005336 | Ga0070680_100013940 | Ga0070680_1000139402 | 106 |
| 181 | 3300005337 | Ga0070682_100376022 | Ga0070682_1003760221 | 106 |
| 182 | 3300005347 | Ga0070668_101775827 | Ga0070668_1017758272 | 106 |
| 183 | 3300005354 | Ga0070675_100264615 | Ga0070675_1002646152 | 106 |
| 184 | 3300005356 | Ga0070674_100741165 | Ga0070674_1007411652 | 106 |
| 185 | 3300005455 | Ga0070663_100426144 | Ga0070663_1004261442 | 106 |
| 186 | 3300005456 | Ga0070678_101409162 | Ga0070678_1014091621 | 106 |
| 187 | 3300005459 | Ga0068867_100532640 | Ga0068867_1005326402 | 106 |
| 188 | 3300005530 | Ga0070679_100924593 | Ga0070679_1009245932 | 106 |
| 189 | 3300005535 | Ga0070684_100047370 | Ga0070684_1000473702 | 106 |
| 190 | 3300005535 | Ga0070684_100687447 | Ga0070684_1006874472 | 106 |
| 191 | 3300005546 | Ga0070696_101392235 | Ga0070696_1013922352 | 106 |
| 192 | 3300005718 | Ga0068866_10699229 | Ga0068866_106992292 | 106 |
| 193 | 3300005718 | Ga0068866_10737600 | Ga0068866_107376002 | 106 |
| 194 | 3300005937 | Ga0081455_10064761 | Ga0081455_100647613 | 106 |
| 195 | 3300005937 | Ga0081455_10071664 | Ga0081455_100716643 | 106 |
| 196 | 3300006038 | Ga0075365_10202266 | Ga0075365_102022663 | 106 |
| 197 | 3300006051 | Ga0075364_10101016 | Ga0075364_101010162 | 106 |
| 198 | 3300006178 | Ga0075367_10945511 | Ga0075367_109455111 | 106 |
| 199 | 3300006852 | Ga0075433_11707393 | Ga0075433_117073932 | 106 |
| 200 | 3300006871 | Ga0075434_101462697 | Ga0075434_1014626972 | 106 |
| 201 | 3300009098 | Ga0105245_10751275 | Ga0105245_107512752 | 106 |
| 202 | 3300009147 | Ga0114129_11447774 | Ga0114129_114477742 | 106 |
| 203 | 3300009176 | Ga0105242_10791995 | Ga0105242_107919952 | 106 |
| 204 | 3300009177 | Ga0105248_13468566 | Ga0105248_134685661 | 106 |
| 205 | 3300009553 | Ga0105249_10067633 | Ga0105249_100676333 | 106 |
| 206 | 3300010375 | Ga0105239_10600201 | Ga0105239_106002013 | 106 |
| 207 | 3300011119 | Ga0105246_10129824 | Ga0105246_101298243 | 106 |
| 208 | 3300013308 | Ga0157375_10720262 | Ga0157375_107202623 | 106 |
| 209 | 3300014325 | Ga0163163_12057016 | Ga0163163_120570162 | 106 |
| 210 | 3300014326 | Ga0157380_10018392 | Ga0157380_100183923 | 106 |
| 211 | 3300014745 | Ga0157377_10046641 | Ga0157377_100466412 | 106 |
| 212 | 3300014745 | Ga0157377_10192467 | Ga0157377_101924672 | 106 |
| 213 | 3300025921 | Ga0207652_11817084 | Ga0207652_118170842 | 106 |
| 214 | 3300025933 | Ga0207706_10330671 | Ga0207706_103306711 | 106 |
| 215 | 3300025934 | Ga0207686_11041167 | Ga0207686_110411672 | 106 |
| 216 | 3300025935 | Ga0207709_11296535 | Ga0207709_112965352 | 106 |
| 217 | 3300025937 | Ga0207669_10158728 | Ga0207669_101587282 | 106 |
| 218 | 3300025938 | Ga0207704_11009042 | Ga0207704_110090422 | 106 |
| 219 | 3300025944 | Ga0207661_10014245 | Ga0207661_100142455 | 106 |
| 220 | 3300025944 | Ga0207661_10530880 | Ga0207661_105308801 | 106 |
| 221 | 3300025945 | Ga0207679_11117337 | Ga0207679_111173372 | 106 |
| 222 | 3300025986 | Ga0207658_11069638 | Ga0207658_110696382 | 106 |
| 223 | 3300026041 | Ga0207639_10520389 | Ga0207639_105203892 | 106 |
| 224 | 3300026067 | Ga0207678_10430975 | Ga0207678_104309752 | 106 |
| 225 | 3300026075 | Ga0207708_11101480 | Ga0207708_111014802 | 106 |
| 226 | 3300026089 | Ga0207648_10745147 | Ga0207648_107451472 | 106 |
| 227 | 3300026121 | Ga0207683_10356898 | Ga0207683_103568983 | 106 |
| 228 | 3300026142 | Ga0207698_10095357 | Ga0207698_100953573 | 106 |
| 229 | 3300031548 | Ga0307408_102453957 | Ga0307408_1024539571 | 106 |
| 230 | 3300031995 | Ga0307409_102745913 | Ga0307409_1027459132 | 106 |
| 231 | 3300032002 | Ga0307416_100454147 | Ga0307416_1004541472 | 106 |
| 232 | 3300042137 | Ga0450902_105809 | Ga0450902_105809_131_454 | 106 |
| 233 | 3300042145 | Ga0450906_015068 | Ga0450906_015068_697_1020 | 106 |
| 234 | 3300042184 | Ga0450908_039235 | Ga0450908_039235_12_335 | 106 |
| 235 | 3300044673 | Ga0453683_0538970 | Ga0453683_0538970_120_440 | 106 |
| 236 | 3300048907 | Ga0496104_1450349 | Ga0496104_1450349_181_504 | 106 |
| 237 | 3300048908 | Ga0496105_0154420 | Ga0496105_0154420_32_355 | 106 |
| 238 | 3300048911 | Ga0496108_0640542 | Ga0496108_0640542_290_613 | 106 |
| 239 | 3300048917 | Ga0496114_0544188 | Ga0496114_0544188_383_706 | 106 |
| 240 | 3300049568 | Ga0501031_0254597 | Ga0501031_0254597_68_388 | 106 |
| 241 | 3300049572 | Ga0501036_0016429 | Ga0501036_0016429_587_910 | 106 |
| 242 | 3300049572 | Ga0501036_0186225 | Ga0501036_0186225_981_1301 | 106 |
| 243 | 3300049572 | Ga0501036_0490701 | Ga0501036_0490701_437_760 | 106 |
| 244 | 3300049572 | Ga0501036_0527690 | Ga0501036_0527690_592_912 | 106 |
| 245 | 3300049575 | Ga0501039_0491962 | Ga0501039_0491962_61_384 | 106 |
| 246 | 3300049576 | Ga0501040_0064842 | Ga0501040_0064842_782_1105 | 106 |
| 247 | 3300049576 | Ga0501040_0216803 | Ga0501040_0216803_499_819 | 106 |
| 248 | 3300049576 | Ga0501040_0298707 | Ga0501040_0298707_760_1083 | 106 |
| 249 | 3300049577 | Ga0501041_0457128 | Ga0501041_0457128_111_434 | 106 |
| 250 | 3300049578 | Ga0501042_0023089 | Ga0501042_0023089_2478_2801 | 106 |
| 251 | 3300049578 | Ga0501042_0029643 | Ga0501042_0029643_2882_3205 | 106 |
| 252 | 3300049579 | Ga0501043_0128699 | Ga0501043_0128699_1312_1635 | 106 |
| 253 | 3300049580 | Ga0501046_0046873 | Ga0501046_0046873_3003_3326 | 106 |
| 254 | 3300049582 | Ga0501048_0022562 | Ga0501048_0022562_649_972 | 106 |
| 255 | 3300049584 | Ga0501068_0032416 | Ga0501068_0032416_2746_3069 | 106 |
| 256 | 3300049584 | Ga0501068_0340274 | Ga0501068_0340274_466_789 | 106 |
| 257 | 3300049585 | Ga0501069_0590548 | Ga0501069_0590548_284_607 | 106 |
| 258 | 3300049586 | Ga0501070_0056221 | Ga0501070_0056221_2395_2718 | 106 |
| 259 | 3300049587 | Ga0501071_0015825 | Ga0501071_0015825_3989_4312 | 106 |
| 260 | 3300049587 | Ga0501071_0041548 | Ga0501071_0041548_598_921 | 106 |
| 261 | 3300049587 | Ga0501071_0249725 | Ga0501071_0249725_760_1080 | 106 |
| 262 | 3300049587 | Ga0501071_0468716 | Ga0501071_0468716_224_547 | 106 |
| 263 | 3300049588 | Ga0501072_0045386 | Ga0501072_0045386_2479_2802 | 106 |
| 264 | 3300049588 | Ga0501072_0069967 | Ga0501072_0069967_1667_1990 | 106 |
| 265 | 3300049590 | Ga0501074_0029712 | Ga0501074_0029712_2199_2522 | 106 |
| 266 | 3300049590 | Ga0501074_0227394 | Ga0501074_0227394_199_522 | 106 |
| 267 | 3300049590 | Ga0501074_0616857 | Ga0501074_0616857_159_479 | 106 |
| 268 | 3300049591 | Ga0501075_0091945 | Ga0501075_0091945_1432_1755 | 106 |
| 269 | 3300049591 | Ga0501075_0101065 | Ga0501075_0101065_688_1011 | 106 |
| 270 | 3300049592 | Ga0501076_0080631 | Ga0501076_0080631_710_1033 | 106 |
| 271 | 3300049592 | Ga0501076_0108028 | Ga0501076_0108028_178_498 | 106 |
| 272 | 3300049593 | Ga0501077_0008860 | Ga0501077_0008860_5421_5744 | 106 |
| 273 | 3300049593 | Ga0501077_0036010 | Ga0501077_0036010_1477_1800 | 106 |
| 274 | 3300049741 | Ga0501079_0042134 | Ga0501079_0042134_2624_2947 | 106 |
| 275 | 3300049741 | Ga0501079_0366321 | Ga0501079_0366321_525_845 | 106 |
| 276 | 3300049742 | Ga0501080_0056973 | Ga0501080_0056973_564_887 | 106 |
| 277 | 3300049742 | Ga0501080_0076337 | Ga0501080_0076337_2690_3013 | 106 |
| 278 | 3300049742 | Ga0501080_1268085 | Ga0501080_1268085_287_607 | 106 |
| 279 | 3300049743 | Ga0501081_0005337 | Ga0501081_0005337_455_778 | 106 |
| 280 | 3300049743 | Ga0501081_0150992 | Ga0501081_0150992_513_833 | 106 |
| 281 | 3300049743 | Ga0501081_0218427 | Ga0501081_0218427_882_1208 | 106 |
| 282 | 3300049744 | Ga0501083_0019007 | Ga0501083_0019007_2625_2948 | 106 |
| 283 | 3300049744 | Ga0501083_1112286 | Ga0501083_1112286_109_432 | 106 |
| 284 | 3300049824 | Ga0501045_0021740 | Ga0501045_0021740_1993_2316 | 106 |
| 285 | 3300049824 | Ga0501045_0154153 | Ga0501045_0154153_778_1101 | 106 |
| 286 | 3300049824 | Ga0501045_0531236 | Ga0501045_0531236_92_412 | 106 |
| 287 | 3300050491 | nmdc:mga00v17_167978_c1 | nmdc:mga00v17_167978_c1_137_460 | 106 |
| 288 | 3300050492 | nmdc:mga0yw44_15657_c1 | nmdc:mga0yw44_15657_c1_2810_3133 | 106 |
| 289 | 3300050494 | nmdc:mga06z11_392600_c1 | nmdc:mga06z11_392600_c1_481_804 | 106 |
| 290 | 3300050507 | nmdc:mga05p37_2019990_c1 | nmdc:mga05p37_2019990_c1_145_468 | 106 |
| 291 | 3300050512 | nmdc:mga0n895_1869818_c1 | nmdc:mga0n895_1869818_c1_62_385 | 106 |
| 292 | 3300054114 | Ga0501084_0006937 | Ga0501084_0006937_8376_8699 | 106 |
| 293 | 3300054114 | Ga0501084_0427384 | Ga0501084_0427384_508_831 | 106 |
| 294 | 3300060353 | Ga0501082_0061060 | Ga0501082_0061060_2630_2953 | 106 |
| 295 | 3300060353 | Ga0501082_0278193 | Ga0501082_0278193_742_1065 | 106 |
| 296 | 3300060353 | Ga0501082_0363187 | Ga0501082_0363187_453_773 | 106 |
| 297 | 3300060353 | Ga0501082_0665664 | Ga0501082_0665664_58_384 | 106 |
| 298 | 3300060353 | Ga0501082_1535340 | Ga0501082_1535340_152_475 | 106 |
| 299 | 3300061734 | Ga0530510_0059056 | Ga0530510_0059056_664_987 | 106 |
| 300 | 3300061734 | Ga0530510_1013162 | Ga0530510_1013162_38_358 | 106 |
| 301 | 3300005327 | Ga0070658_10020806 | Ga0070658_100208062 | 107 |
| 302 | 3300005327 | Ga0070658_10125516 | Ga0070658_101255163 | 107 |
| 303 | 3300005328 | Ga0070676_10199609 | Ga0070676_101996093 | 107 |
| 304 | 3300005329 | Ga0070683_100012761 | Ga0070683_1000127613 | 107 |
| 305 | 3300005329 | Ga0070683_100116559 | Ga0070683_1001165593 | 107 |
| 306 | 3300005329 | Ga0070683_100266500 | Ga0070683_1002665003 | 107 |
| 307 | 3300005329 | Ga0070683_101176794 | Ga0070683_1011767942 | 107 |
| 308 | 3300005329 | Ga0070683_101772363 | Ga0070683_1017723632 | 107 |
| 309 | 3300005331 | Ga0070670_102072541 | Ga0070670_1020725411 | 107 |
| 310 | 3300005333 | Ga0070677_10238963 | Ga0070677_102389632 | 107 |
| 311 | 3300005334 | Ga0068869_100109629 | Ga0068869_1001096292 | 107 |
| 312 | 3300005335 | Ga0070666_10172962 | Ga0070666_101729622 | 107 |
| 313 | 3300005336 | Ga0070680_100044542 | Ga0070680_1000445424 | 107 |
| 314 | 3300005337 | Ga0070682_100001712 | Ga0070682_1000017129 | 107 |
| 315 | 3300005337 | Ga0070682_100202698 | Ga0070682_1002026983 | 107 |
| 316 | 3300005337 | Ga0070682_100230701 | Ga0070682_1002307012 | 107 |
| 317 | 3300005337 | Ga0070682_100778705 | Ga0070682_1007787052 | 107 |
| 318 | 3300005338 | Ga0068868_100013592 | Ga0068868_1000135923 | 107 |
| 319 | 3300005338 | Ga0068868_100060980 | Ga0068868_1000609802 | 107 |
| 320 | 3300005339 | Ga0070660_100006223 | Ga0070660_1000062235 | 107 |
| 321 | 3300005339 | Ga0070660_100504565 | Ga0070660_1005045652 | 107 |
| 322 | 3300005341 | Ga0070691_10000781 | Ga0070691_1000078110 | 107 |
| 323 | 3300005341 | Ga0070691_10454999 | Ga0070691_104549992 | 107 |
| 324 | 3300005343 | Ga0070687_100011765 | Ga0070687_1000117653 | 107 |
| 325 | 3300005343 | Ga0070687_100165662 | Ga0070687_1001656622 | 107 |
| 326 | 3300005344 | Ga0070661_100051608 | Ga0070661_1000516082 | 107 |
| 327 | 3300005344 | Ga0070661_100150713 | Ga0070661_1001507133 | 107 |
| 328 | 3300005345 | Ga0070692_10004463 | Ga0070692_100044633 | 107 |
| 329 | 3300005347 | Ga0070668_100174976 | Ga0070668_1001749762 | 107 |
| 330 | 3300005347 | Ga0070668_101100576 | Ga0070668_1011005762 | 107 |
| 331 | 3300005347 | Ga0070668_101394095 | Ga0070668_1013940952 | 107 |
| 332 | 3300005353 | Ga0070669_100128448 | Ga0070669_1001284481 | 107 |
| 333 | 3300005353 | Ga0070669_100669026 | Ga0070669_1006690261 | 107 |
| 334 | 3300005354 | Ga0070675_100013253 | Ga0070675_1000132538 | 107 |
| 335 | 3300005354 | Ga0070675_100143919 | Ga0070675_1001439191 | 107 |
| 336 | 3300005354 | Ga0070675_100176508 | Ga0070675_1001765082 | 107 |
| 337 | 3300005355 | Ga0070671_100127913 | Ga0070671_1001279132 | 107 |
| 338 | 3300005355 | Ga0070671_100134573 | Ga0070671_1001345732 | 107 |
| 339 | 3300005355 | Ga0070671_100198696 | Ga0070671_1001986962 | 107 |
| 340 | 3300005355 | Ga0070671_100262053 | Ga0070671_1002620533 | 107 |
| 341 | 3300005355 | Ga0070671_100577024 | Ga0070671_1005770241 | 107 |
| 342 | 3300005356 | Ga0070674_100024608 | Ga0070674_1000246084 | 107 |
| 343 | 3300005356 | Ga0070674_100026395 | Ga0070674_1000263953 | 107 |
| 344 | 3300005356 | Ga0070674_100035054 | Ga0070674_1000350543 | 107 |
| 345 | 3300005356 | Ga0070674_100215709 | Ga0070674_1002157092 | 107 |
| 346 | 3300005356 | Ga0070674_100343715 | Ga0070674_1003437152 | 107 |
| 347 | 3300005364 | Ga0070673_100001958 | Ga0070673_1000019587 | 107 |
| 348 | 3300005364 | Ga0070673_100058421 | Ga0070673_1000584213 | 107 |
| 349 | 3300005364 | Ga0070673_100346818 | Ga0070673_1003468182 | 107 |
| 350 | 3300005366 | Ga0070659_100006531 | Ga0070659_1000065317 | 107 |
| 351 | 3300005366 | Ga0070659_100212870 | Ga0070659_1002128702 | 107 |
| 352 | 3300005366 | Ga0070659_100843002 | Ga0070659_1008430022 | 107 |
| 353 | 3300005438 | Ga0070701_10005023 | Ga0070701_100050235 | 107 |
| 354 | 3300005438 | Ga0070701_11072287 | Ga0070701_110722872 | 107 |
| 355 | 3300005440 | Ga0070705_100052487 | Ga0070705_1000524872 | 107 |
| 356 | 3300005441 | Ga0070700_100024808 | Ga0070700_1000248084 | 107 |
| 357 | 3300005445 | Ga0070708_102090259 | Ga0070708_1020902592 | 107 |
| 358 | 3300005455 | Ga0070663_100099721 | Ga0070663_1000997212 | 107 |
| 359 | 3300005455 | Ga0070663_100382113 | Ga0070663_1003821133 | 107 |
| 360 | 3300005456 | Ga0070678_100019284 | Ga0070678_1000192843 | 107 |
| 361 | 3300005456 | Ga0070678_100093811 | Ga0070678_1000938112 | 107 |
| 362 | 3300005456 | Ga0070678_101308050 | Ga0070678_1013080501 | 107 |
| 363 | 3300005456 | Ga0070678_102295950 | Ga0070678_1022959502 | 107 |
| 364 | 3300005457 | Ga0070662_100008794 | Ga0070662_1000087943 | 107 |
| 365 | 3300005457 | Ga0070662_100464420 | Ga0070662_1004644201 | 107 |
| 366 | 3300005457 | Ga0070662_101359677 | Ga0070662_1013596772 | 107 |
| 367 | 3300005458 | Ga0070681_10143620 | Ga0070681_101436202 | 107 |
| 368 | 3300005458 | Ga0070681_10325545 | Ga0070681_103255452 | 107 |
| 369 | 3300005459 | Ga0068867_100011666 | Ga0068867_1000116664 | 107 |
| 370 | 3300005459 | Ga0068867_100095123 | Ga0068867_1000951232 | 107 |
| 371 | 3300005459 | Ga0068867_100446742 | Ga0068867_1004467421 | 107 |
| 372 | 3300005466 | Ga0070685_10009536 | Ga0070685_100095362 | 107 |
| 373 | 3300005466 | Ga0070685_10041854 | Ga0070685_100418543 | 107 |
| 374 | 3300005530 | Ga0070679_100027697 | Ga0070679_1000276976 | 107 |
| 375 | 3300005535 | Ga0070684_100016734 | Ga0070684_1000167346 | 107 |
| 376 | 3300005535 | Ga0070684_100053101 | Ga0070684_1000531012 | 107 |
| 377 | 3300005535 | Ga0070684_100118958 | Ga0070684_1001189582 | 107 |
| 378 | 3300005539 | Ga0068853_100002053 | Ga0068853_10000205314 | 107 |
| 379 | 3300005543 | Ga0070672_100012897 | Ga0070672_1000128974 | 107 |
| 380 | 3300005543 | Ga0070672_100019493 | Ga0070672_1000194935 | 107 |
| 381 | 3300005543 | Ga0070672_100112092 | Ga0070672_1001120922 | 107 |
| 382 | 3300005544 | Ga0070686_100116613 | Ga0070686_1001166133 | 107 |
| 383 | 3300005544 | Ga0070686_100943102 | Ga0070686_1009431021 | 107 |
| 384 | 3300005546 | Ga0070696_100178383 | Ga0070696_1001783833 | 107 |
| 385 | 3300005547 | Ga0070693_100046774 | Ga0070693_1000467742 | 107 |
| 386 | 3300005547 | Ga0070693_100609833 | Ga0070693_1006098332 | 107 |
| 387 | 3300005548 | Ga0070665_100087089 | Ga0070665_1000870893 | 107 |
| 388 | 3300005548 | Ga0070665_100479102 | Ga0070665_1004791022 | 107 |
| 389 | 3300005548 | Ga0070665_101567738 | Ga0070665_1015677382 | 107 |
| 390 | 3300005563 | Ga0068855_101222037 | Ga0068855_1012220372 | 107 |
| 391 | 3300005564 | Ga0070664_100011913 | Ga0070664_1000119137 | 107 |
| 392 | 3300005577 | Ga0068857_100105667 | Ga0068857_1001056672 | 107 |
| 393 | 3300005577 | Ga0068857_100301716 | Ga0068857_1003017163 | 107 |
| 394 | 3300005578 | Ga0068854_100005835 | Ga0068854_1000058354 | 107 |
| 395 | 3300005578 | Ga0068854_100274199 | Ga0068854_1002741992 | 107 |
| 396 | 3300005614 | Ga0068856_100113518 | Ga0068856_1001135184 | 107 |
| 397 | 3300005615 | Ga0070702_100009253 | Ga0070702_1000092536 | 107 |
| 398 | 3300005615 | Ga0070702_100145435 | Ga0070702_1001454353 | 107 |
| 399 | 3300005616 | Ga0068852_100002371 | Ga0068852_1000023718 | 107 |
| 400 | 3300005617 | Ga0068859_100081776 | Ga0068859_1000817763 | 107 |
| 401 | 3300005617 | Ga0068859_100476956 | Ga0068859_1004769562 | 107 |
| 402 | 3300005618 | Ga0068864_100104963 | Ga0068864_1001049633 | 107 |
| 403 | 3300005618 | Ga0068864_100856098 | Ga0068864_1008560982 | 107 |
| 404 | 3300005618 | Ga0068864_101261974 | Ga0068864_1012619742 | 107 |
| 405 | 3300005718 | Ga0068866_10050031 | Ga0068866_100500313 | 107 |
| 406 | 3300005718 | Ga0068866_10174499 | Ga0068866_101744992 | 107 |
| 407 | 3300005718 | Ga0068866_10197785 | Ga0068866_101977852 | 107 |
| 408 | 3300005718 | Ga0068866_10636179 | Ga0068866_106361792 | 107 |
| 409 | 3300005718 | Ga0068866_10758397 | Ga0068866_107583972 | 107 |
| 410 | 3300005719 | Ga0068861_100113603 | Ga0068861_1001136032 | 107 |
| 411 | 3300005719 | Ga0068861_101756336 | Ga0068861_1017563361 | 107 |
| 412 | 3300005834 | Ga0068851_10134690 | Ga0068851_101346903 | 107 |
| 413 | 3300005834 | Ga0068851_10216565 | Ga0068851_102165653 | 107 |
| 414 | 3300005834 | Ga0068851_10493845 | Ga0068851_104938452 | 107 |
| 415 | 3300005840 | Ga0068870_10186527 | Ga0068870_101865272 | 107 |
| 416 | 3300005840 | Ga0068870_10655382 | Ga0068870_106553822 | 107 |
| 417 | 3300005841 | Ga0068863_100098876 | Ga0068863_1000988762 | 107 |
| 418 | 3300005841 | Ga0068863_101914888 | Ga0068863_1019148882 | 107 |
| 419 | 3300005842 | Ga0068858_100222261 | Ga0068858_1002222612 | 107 |
| 420 | 3300005842 | Ga0068858_100575290 | Ga0068858_1005752903 | 107 |
| 421 | 3300005843 | Ga0068860_100113669 | Ga0068860_1001136692 | 107 |
| 422 | 3300005843 | Ga0068860_100179105 | Ga0068860_1001791052 | 107 |
| 423 | 3300005843 | Ga0068860_100486778 | Ga0068860_1004867782 | 107 |
| 424 | 3300005844 | Ga0068862_101127921 | Ga0068862_1011279212 | 107 |
| 425 | 3300005985 | Ga0081539_10001263 | Ga0081539_1000126329 | 107 |
| 426 | 3300006237 | Ga0097621_100116158 | Ga0097621_1001161583 | 107 |
| 427 | 3300006237 | Ga0097621_100864649 | Ga0097621_1008646491 | 107 |
| 428 | 3300006237 | Ga0097621_100986186 | Ga0097621_1009861862 | 107 |
| 429 | 3300006358 | Ga0068871_100036187 | Ga0068871_1000361873 | 107 |
| 430 | 3300006358 | Ga0068871_100641381 | Ga0068871_1006413812 | 107 |
| 431 | 3300006881 | Ga0068865_100014098 | Ga0068865_1000140985 | 107 |
| 432 | 3300006881 | Ga0068865_100018100 | Ga0068865_1000181002 | 107 |
| 433 | 3300006881 | Ga0068865_100212158 | Ga0068865_1002121582 | 107 |
| 434 | 3300006931 | Ga0097620_100081781 | Ga0097620_1000817812 | 107 |
| 435 | 3300006931 | Ga0097620_100476918 | Ga0097620_1004769182 | 107 |
| 436 | 3300009093 | Ga0105240_11877604 | Ga0105240_118776042 | 107 |
| 437 | 3300009093 | Ga0105240_12621444 | Ga0105240_126214441 | 107 |
| 438 | 3300009094 | Ga0111539_10006960 | Ga0111539_1000696012 | 107 |
| 439 | 3300009094 | Ga0111539_10385516 | Ga0111539_103855162 | 107 |
| 440 | 3300009094 | Ga0111539_11695879 | Ga0111539_116958792 | 107 |
| 441 | 3300009094 | Ga0111539_11797939 | Ga0111539_117979392 | 107 |
| 442 | 3300009094 | Ga0111539_12559193 | Ga0111539_125591932 | 107 |
| 443 | 3300009098 | Ga0105245_10008068 | Ga0105245_100080687 | 107 |
| 444 | 3300009098 | Ga0105245_10068162 | Ga0105245_100681623 | 107 |
| 445 | 3300009098 | Ga0105245_10193633 | Ga0105245_101936333 | 107 |
| 446 | 3300009098 | Ga0105245_10265614 | Ga0105245_102656142 | 107 |
| 447 | 3300009098 | Ga0105245_10364669 | Ga0105245_103646693 | 107 |
| 448 | 3300009098 | Ga0105245_11863191 | Ga0105245_118631912 | 107 |
| 449 | 3300009101 | Ga0105247_10041631 | Ga0105247_100416312 | 107 |
| 450 | 3300009101 | Ga0105247_10994977 | Ga0105247_109949772 | 107 |
| 451 | 3300009147 | Ga0114129_11077726 | Ga0114129_110777262 | 107 |
| 452 | 3300009148 | Ga0105243_10004018 | Ga0105243_1000401816 | 107 |
| 453 | 3300009148 | Ga0105243_10007875 | Ga0105243_100078758 | 107 |
| 454 | 3300009148 | Ga0105243_10137679 | Ga0105243_101376792 | 107 |
| 455 | 3300009148 | Ga0105243_11704686 | Ga0105243_117046862 | 107 |
| 456 | 3300009176 | Ga0105242_10067548 | Ga0105242_100675483 | 107 |
| 457 | 3300009176 | Ga0105242_10461250 | Ga0105242_104612502 | 107 |
| 458 | 3300009177 | Ga0105248_10286384 | Ga0105248_102863843 | 107 |
| 459 | 3300009177 | Ga0105248_10647613 | Ga0105248_106476133 | 107 |
| 460 | 3300009177 | Ga0105248_11043744 | Ga0105248_110437442 | 107 |
| 461 | 3300009177 | Ga0105248_11414323 | Ga0105248_114143232 | 107 |
| 462 | 3300009551 | Ga0105238_10021955 | Ga0105238_100219557 | 107 |
| 463 | 3300009551 | Ga0105238_10223925 | Ga0105238_102239253 | 107 |
| 464 | 3300009551 | Ga0105238_12682043 | Ga0105238_126820431 | 107 |
| 465 | 3300009553 | Ga0105249_10015358 | Ga0105249_100153584 | 107 |
| 466 | 3300009553 | Ga0105249_10067152 | Ga0105249_100671523 | 107 |
| 467 | 3300010375 | Ga0105239_10021141 | Ga0105239_100211414 | 107 |
| 468 | 3300010375 | Ga0105239_10218530 | Ga0105239_102185302 | 107 |
| 469 | 3300010375 | Ga0105239_10683993 | Ga0105239_106839932 | 107 |
| 470 | 3300011119 | Ga0105246_10026274 | Ga0105246_100262743 | 107 |
| 471 | 3300011119 | Ga0105246_10078279 | Ga0105246_100782793 | 107 |
| 472 | 3300013100 | Ga0157373_11393917 | Ga0157373_113939171 | 107 |
| 473 | 3300013102 | Ga0157371_10003237 | Ga0157371_100032378 | 107 |
| 474 | 3300013105 | Ga0157369_10172235 | Ga0157369_101722352 | 107 |
| 475 | 3300013296 | Ga0157374_11181696 | Ga0157374_111816962 | 107 |
| 476 | 3300013296 | Ga0157374_12227659 | Ga0157374_122276591 | 107 |
| 477 | 3300013297 | Ga0157378_11015008 | Ga0157378_110150081 | 107 |
| 478 | 3300013306 | Ga0163162_10076833 | Ga0163162_100768335 | 107 |
| 479 | 3300013306 | Ga0163162_10492366 | Ga0163162_104923662 | 107 |
| 480 | 3300013306 | Ga0163162_11856261 | Ga0163162_118562611 | 107 |
| 481 | 3300013307 | Ga0157372_10008369 | Ga0157372_100083698 | 107 |
| 482 | 3300013307 | Ga0157372_12590993 | Ga0157372_125909932 | 107 |
| 483 | 3300013308 | Ga0157375_10048535 | Ga0157375_100485353 | 107 |
| 484 | 3300013308 | Ga0157375_11286039 | Ga0157375_112860392 | 107 |
| 485 | 3300013308 | Ga0157375_12083114 | Ga0157375_120831142 | 107 |
| 486 | 3300014325 | Ga0163163_10130751 | Ga0163163_101307513 | 107 |
| 487 | 3300014325 | Ga0163163_10289425 | Ga0163163_102894253 | 107 |
| 488 | 3300014325 | Ga0163163_10857583 | Ga0163163_108575831 | 107 |
| 489 | 3300014325 | Ga0163163_11071496 | Ga0163163_110714962 | 107 |
| 490 | 3300014325 | Ga0163163_11541761 | Ga0163163_115417611 | 107 |
| 491 | 3300014325 | Ga0163163_11901115 | Ga0163163_119011151 | 107 |
| 492 | 3300014326 | Ga0157380_10031987 | Ga0157380_100319873 | 107 |
| 493 | 3300014326 | Ga0157380_10090420 | Ga0157380_100904204 | 107 |
| 494 | 3300014745 | Ga0157377_10005725 | Ga0157377_100057252 | 107 |
| 495 | 3300014745 | Ga0157377_11492677 | Ga0157377_114926771 | 107 |
| 496 | 3300014968 | Ga0157379_10349401 | Ga0157379_103494013 | 107 |
| 497 | 3300014968 | Ga0157379_11099008 | Ga0157379_110990082 | 107 |
| 498 | 3300014968 | Ga0157379_11608103 | Ga0157379_116081032 | 107 |
| 499 | 3300014969 | Ga0157376_10023873 | Ga0157376_100238736 | 107 |
| 500 | 3300014969 | Ga0157376_10228217 | Ga0157376_102282172 | 107 |
| 501 | 3300014969 | Ga0157376_10350635 | Ga0157376_103506352 | 107 |
| 502 | 3300014969 | Ga0157376_10384221 | Ga0157376_103842212 | 107 |
| 503 | 3300014969 | Ga0157376_10694176 | Ga0157376_106941763 | 107 |
| 504 | 3300017792 | Ga0163161_10135225 | Ga0163161_101352252 | 107 |
| 505 | 3300017792 | Ga0163161_10170556 | Ga0163161_101705562 | 107 |
| 506 | 3300017792 | Ga0163161_10616943 | Ga0163161_106169433 | 107 |
| 507 | 3300025321 | Ga0207656_10288057 | Ga0207656_102880572 | 107 |
| 508 | 3300025321 | Ga0207656_10397228 | Ga0207656_103972282 | 107 |
| 509 | 3300025899 | Ga0207642_10034392 | Ga0207642_100343923 | 107 |
| 510 | 3300025901 | Ga0207688_10012183 | Ga0207688_100121833 | 107 |
| 511 | 3300025901 | Ga0207688_10014657 | Ga0207688_100146573 | 107 |
| 512 | 3300025901 | Ga0207688_10849052 | Ga0207688_108490522 | 107 |
| 513 | 3300025903 | Ga0207680_10118518 | Ga0207680_101185182 | 107 |
| 514 | 3300025903 | Ga0207680_10726080 | Ga0207680_107260802 | 107 |
| 515 | 3300025904 | Ga0207647_10084225 | Ga0207647_100842253 | 107 |
| 516 | 3300025907 | Ga0207645_10192233 | Ga0207645_101922333 | 107 |
| 517 | 3300025908 | Ga0207643_10020606 | Ga0207643_100206062 | 107 |
| 518 | 3300025908 | Ga0207643_10131343 | Ga0207643_101313432 | 107 |
| 519 | 3300025908 | Ga0207643_10149907 | Ga0207643_101499072 | 107 |
| 520 | 3300025909 | Ga0207705_10142417 | Ga0207705_101424173 | 107 |
| 521 | 3300025911 | Ga0207654_10988194 | Ga0207654_109881941 | 107 |
| 522 | 3300025912 | Ga0207707_10177704 | Ga0207707_101777042 | 107 |
| 523 | 3300025917 | Ga0207660_10178798 | Ga0207660_101787983 | 107 |
| 524 | 3300025918 | Ga0207662_10405667 | Ga0207662_104056672 | 107 |
| 525 | 3300025919 | Ga0207657_10005874 | Ga0207657_100058749 | 107 |
| 526 | 3300025919 | Ga0207657_10115501 | Ga0207657_101155012 | 107 |
| 527 | 3300025920 | Ga0207649_10235848 | Ga0207649_102358483 | 107 |
| 528 | 3300025920 | Ga0207649_10477406 | Ga0207649_104774062 | 107 |
| 529 | 3300025921 | Ga0207652_10163111 | Ga0207652_101631113 | 107 |
| 530 | 3300025921 | Ga0207652_10370220 | Ga0207652_103702203 | 107 |
| 531 | 3300025924 | Ga0207694_10085310 | Ga0207694_100853103 | 107 |
| 532 | 3300025925 | Ga0207650_10336404 | Ga0207650_103364042 | 107 |
| 533 | 3300025925 | Ga0207650_10391692 | Ga0207650_103916922 | 107 |
| 534 | 3300025926 | Ga0207659_10125900 | Ga0207659_101259002 | 107 |
| 535 | 3300025927 | Ga0207687_10014081 | Ga0207687_100140811 | 107 |
| 536 | 3300025927 | Ga0207687_10095754 | Ga0207687_100957544 | 107 |
| 537 | 3300025927 | Ga0207687_10675279 | Ga0207687_106752792 | 107 |
| 538 | 3300025927 | Ga0207687_11263785 | Ga0207687_112637852 | 107 |
| 539 | 3300025931 | Ga0207644_10107407 | Ga0207644_101074072 | 107 |
| 540 | 3300025931 | Ga0207644_10486246 | Ga0207644_104862463 | 107 |
| 541 | 3300025931 | Ga0207644_10761133 | Ga0207644_107611332 | 107 |
| 542 | 3300025931 | Ga0207644_11483086 | Ga0207644_114830862 | 107 |
| 543 | 3300025932 | Ga0207690_10558569 | Ga0207690_105585691 | 107 |
| 544 | 3300025933 | Ga0207706_10006537 | Ga0207706_100065377 | 107 |
| 545 | 3300025933 | Ga0207706_10119519 | Ga0207706_101195192 | 107 |
| 546 | 3300025934 | Ga0207686_10166983 | Ga0207686_101669833 | 107 |
| 547 | 3300025934 | Ga0207686_10251933 | Ga0207686_102519332 | 107 |
| 548 | 3300025934 | Ga0207686_10466096 | Ga0207686_104660961 | 107 |
| 549 | 3300025934 | Ga0207686_10687048 | Ga0207686_106870481 | 107 |
| 550 | 3300025935 | Ga0207709_10029522 | Ga0207709_100295223 | 107 |
| 551 | 3300025935 | Ga0207709_10041070 | Ga0207709_100410701 | 107 |
| 552 | 3300025935 | Ga0207709_10060410 | Ga0207709_100604102 | 107 |
| 553 | 3300025936 | Ga0207670_10012823 | Ga0207670_100128235 | 107 |
| 554 | 3300025937 | Ga0207669_10301324 | Ga0207669_103013243 | 107 |
| 555 | 3300025937 | Ga0207669_10521426 | Ga0207669_105214262 | 107 |
| 556 | 3300025938 | Ga0207704_10061154 | Ga0207704_100611542 | 107 |
| 557 | 3300025938 | Ga0207704_11131668 | Ga0207704_111316681 | 107 |
| 558 | 3300025940 | Ga0207691_10006369 | Ga0207691_100063696 | 107 |
| 559 | 3300025940 | Ga0207691_10008449 | Ga0207691_100084497 | 107 |
| 560 | 3300025940 | Ga0207691_10079394 | Ga0207691_100793944 | 107 |
| 561 | 3300025941 | Ga0207711_10158564 | Ga0207711_101585642 | 107 |
| 562 | 3300025941 | Ga0207711_10171587 | Ga0207711_101715873 | 107 |
| 563 | 3300025941 | Ga0207711_10216703 | Ga0207711_102167033 | 107 |
| 564 | 3300025944 | Ga0207661_10035968 | Ga0207661_100359683 | 107 |
| 565 | 3300025944 | Ga0207661_10070450 | Ga0207661_100704504 | 107 |
| 566 | 3300025944 | Ga0207661_10389751 | Ga0207661_103897512 | 107 |
| 567 | 3300025944 | Ga0207661_10960543 | Ga0207661_109605432 | 107 |
| 568 | 3300025944 | Ga0207661_11704536 | Ga0207661_117045361 | 107 |
| 569 | 3300025945 | Ga0207679_10335643 | Ga0207679_103356433 | 107 |
| 570 | 3300025949 | Ga0207667_10191644 | Ga0207667_101916442 | 107 |
| 571 | 3300025960 | Ga0207651_10068544 | Ga0207651_100685443 | 107 |
| 572 | 3300025960 | Ga0207651_10297401 | Ga0207651_102974013 | 107 |
| 573 | 3300025960 | Ga0207651_10939350 | Ga0207651_109393502 | 107 |
| 574 | 3300025961 | Ga0207712_10052654 | Ga0207712_100526542 | 107 |
| 575 | 3300025961 | Ga0207712_10312348 | Ga0207712_103123482 | 107 |
| 576 | 3300025972 | Ga0207668_11681396 | Ga0207668_116813962 | 107 |
| 577 | 3300025981 | Ga0207640_10044988 | Ga0207640_100449883 | 107 |
| 578 | 3300025981 | Ga0207640_11374061 | Ga0207640_113740611 | 107 |
| 579 | 3300025986 | Ga0207658_10251207 | Ga0207658_102512073 | 107 |
| 580 | 3300026023 | Ga0207677_10210254 | Ga0207677_102102543 | 107 |
| 581 | 3300026023 | Ga0207677_10308783 | Ga0207677_103087832 | 107 |
| 582 | 3300026023 | Ga0207677_11499192 | Ga0207677_114991922 | 107 |
| 583 | 3300026035 | Ga0207703_10080882 | Ga0207703_100808822 | 107 |
| 584 | 3300026035 | Ga0207703_10127398 | Ga0207703_101273982 | 107 |
| 585 | 3300026041 | Ga0207639_10184083 | Ga0207639_101840833 | 107 |
| 586 | 3300026067 | Ga0207678_10046202 | Ga0207678_100462024 | 107 |
| 587 | 3300026067 | Ga0207678_10093063 | Ga0207678_100930633 | 107 |
| 588 | 3300026067 | Ga0207678_10418915 | Ga0207678_104189152 | 107 |
| 589 | 3300026075 | Ga0207708_10038706 | Ga0207708_100387062 | 107 |
| 590 | 3300026075 | Ga0207708_10453528 | Ga0207708_104535282 | 107 |
| 591 | 3300026078 | Ga0207702_10137847 | Ga0207702_101378473 | 107 |
| 592 | 3300026078 | Ga0207702_10151131 | Ga0207702_101511312 | 107 |
| 593 | 3300026088 | Ga0207641_10740567 | Ga0207641_107405672 | 107 |
| 594 | 3300026088 | Ga0207641_10874658 | Ga0207641_108746581 | 107 |
| 595 | 3300026088 | Ga0207641_12066872 | Ga0207641_120668722 | 107 |
| 596 | 3300026089 | Ga0207648_10009895 | Ga0207648_100098955 | 107 |
| 597 | 3300026089 | Ga0207648_10092382 | Ga0207648_100923824 | 107 |
| 598 | 3300026089 | Ga0207648_10173742 | Ga0207648_101737422 | 107 |
| 599 | 3300026089 | Ga0207648_11187397 | Ga0207648_111873972 | 107 |
| 600 | 3300026095 | Ga0207676_10029132 | Ga0207676_100291323 | 107 |
| 601 | 3300026095 | Ga0207676_10090067 | Ga0207676_100900673 | 107 |
| 602 | 3300026116 | Ga0207674_10281330 | Ga0207674_102813302 | 107 |
| 603 | 3300026116 | Ga0207674_10426357 | Ga0207674_104263572 | 107 |
| 604 | 3300026118 | Ga0207675_100084663 | Ga0207675_1000846633 | 107 |
| 605 | 3300026118 | Ga0207675_100285492 | Ga0207675_1002854922 | 107 |
| 606 | 3300026121 | Ga0207683_10031736 | Ga0207683_100317364 | 107 |
| 607 | 3300026121 | Ga0207683_10094502 | Ga0207683_100945023 | 107 |
| 608 | 3300026121 | Ga0207683_10134886 | Ga0207683_101348863 | 107 |
| 609 | 3300026121 | Ga0207683_10319832 | Ga0207683_103198322 | 107 |
| 610 | 3300026142 | Ga0207698_10028103 | Ga0207698_100281034 | 107 |
| 611 | 3300026142 | Ga0207698_10518620 | Ga0207698_105186203 | 107 |
| 612 | 3300026142 | Ga0207698_10611624 | Ga0207698_106116242 | 107 |
| 613 | 3300028379 | Ga0268266_10409827 | Ga0268266_104098271 | 107 |
| 614 | 3300028380 | Ga0268265_10225582 | Ga0268265_102255822 | 107 |
| 615 | 3300028380 | Ga0268265_10327062 | Ga0268265_103270623 | 107 |
| 616 | 3300028380 | Ga0268265_11038064 | Ga0268265_110380642 | 107 |
| 617 | 3300028381 | Ga0268264_10140205 | Ga0268264_101402052 | 107 |
| 618 | 3300028381 | Ga0268264_10265222 | Ga0268264_102652223 | 107 |
| 619 | 3300031548 | Ga0307408_100617055 | Ga0307408_1006170552 | 107 |
| 620 | 3300035091 | Ga0373951_0137168 | Ga0373951_0137168_229_552 | 107 |
| 621 | 3300035207 | Ga0373942_0111994 | Ga0373942_0111994_130_453 | 107 |
| 622 | 3300041463 | Ga0451804_0721543 | Ga0451804_0721543_701_1033 | 107 |
| 623 | 3300041486 | Ga0451807_1895063 | Ga0451807_1895063_155_487 | 107 |
| 624 | 3300041512 | Ga0451853_2549579 | Ga0451853_2549579_168_500 | 107 |
| 625 | 3300041512 | Ga0451853_2874699 | Ga0451853_2874699_23_349 | 107 |
| 626 | 3300042016 | Ga0439463_013509 | Ga0439463_013509_1468_1794 | 107 |
| 627 | 3300046455 | Ga0495603_0007432 | Ga0495603_0007432_606_932 | 107 |
| 628 | 3300046455 | Ga0495603_0146681 | Ga0495603_0146681_461_784 | 107 |
| 629 | 3300046461 | Ga0495641_0483541 | Ga0495641_0483541_197_520 | 107 |
| 630 | 3300046473 | Ga0495582_0803114 | Ga0495582_0803114_126_452 | 107 |
| 631 | 3300046523 | Ga0495644_0098290 | Ga0495644_0098290_703_1029 | 107 |
| 632 | 3300046615 | Ga0495656_0016568 | Ga0495656_0016568_2256_2582 | 107 |
| 633 | 3300046615 | Ga0495656_0292269 | Ga0495656_0292269_184_510 | 107 |
| 634 | 3300046648 | Ga0495611_0354771 | Ga0495611_0354771_324_650 | 107 |
| 635 | 3300046692 | Ga0495671_0170934 | Ga0495671_0170934_427_756 | 107 |
| 636 | 3300046794 | Ga0495589_0216495 | Ga0495589_0216495_55_381 | 107 |
| 637 | 3300046794 | Ga0495589_0353498 | Ga0495589_0353498_47_385 | 107 |
| 638 | 3300048903 | Ga0496100_0421230 | Ga0496100_0421230_224_565 | 107 |
| 639 | 3300048903 | Ga0496100_0784341 | Ga0496100_0784341_392_718 | 107 |
| 640 | 3300048904 | Ga0496101_0373463 | Ga0496101_0373463_124_447 | 107 |
| 641 | 3300048904 | Ga0496101_0719916 | Ga0496101_0719916_144_485 | 107 |
| 642 | 3300048905 | Ga0496102_0374508 | Ga0496102_0374508_530_871 | 107 |
| 643 | 3300048907 | Ga0496104_0160961 | Ga0496104_0160961_1736_2062 | 107 |
| 644 | 3300048908 | Ga0496105_0741211 | Ga0496105_0741211_265_591 | 107 |
| 645 | 3300048910 | Ga0496107_0207087 | Ga0496107_0207087_756_1079 | 107 |
| 646 | 3300048910 | Ga0496107_0311772 | Ga0496107_0311772_148_471 | 107 |
| 647 | 3300048910 | Ga0496107_0424615 | Ga0496107_0424615_428_769 | 107 |
| 648 | 3300048911 | Ga0496108_0074930 | Ga0496108_0074930_498_821 | 107 |
| 649 | 3300048911 | Ga0496108_0631214 | Ga0496108_0631214_304_645 | 107 |
| 650 | 3300048912 | Ga0496109_0246817 | Ga0496109_0246817_564_890 | 107 |
| 651 | 3300048913 | Ga0496110_0233407 | Ga0496110_0233407_219_542 | 107 |
| 652 | 3300048914 | Ga0496111_0021052 | Ga0496111_0021052_3795_4118 | 107 |
| 653 | 3300048914 | Ga0496111_0103492 | Ga0496111_0103492_174_497 | 107 |
| 654 | 3300048914 | Ga0496111_1261095 | Ga0496111_1261095_56_382 | 107 |
| 655 | 3300048917 | Ga0496114_0048478 | Ga0496114_0048478_1704_2027 | 107 |
| 656 | 3300048917 | Ga0496114_0101719 | Ga0496114_0101719_1087_1413 | 107 |
| 657 | 3300048917 | Ga0496114_0658644 | Ga0496114_0658644_362_688 | 107 |
| 658 | 3300049568 | Ga0501031_0030821 | Ga0501031_0030821_2683_3009 | 107 |
| 659 | 3300049568 | Ga0501031_0032813 | Ga0501031_0032813_3006_3332 | 107 |
| 660 | 3300049569 | Ga0501032_0294593 | Ga0501032_0294593_245_571 | 107 |
| 661 | 3300049570 | Ga0501033_0023999 | Ga0501033_0023999_2687_3013 | 107 |
| 662 | 3300049572 | Ga0501036_0015890 | Ga0501036_0015890_4382_4708 | 107 |
| 663 | 3300049572 | Ga0501036_0126475 | Ga0501036_0126475_161_487 | 107 |
| 664 | 3300049573 | Ga0501037_0086920 | Ga0501037_0086920_880_1206 | 107 |
| 665 | 3300049573 | Ga0501037_0230640 | Ga0501037_0230640_390_716 | 107 |
| 666 | 3300049574 | Ga0501038_0063079 | Ga0501038_0063079_2041_2367 | 107 |
| 667 | 3300049574 | Ga0501038_0081404 | Ga0501038_0081404_831_1157 | 107 |
| 668 | 3300049575 | Ga0501039_0042951 | Ga0501039_0042951_94_420 | 107 |
| 669 | 3300049576 | Ga0501040_0021623 | Ga0501040_0021623_745_1071 | 107 |
| 670 | 3300049576 | Ga0501040_0201982 | Ga0501040_0201982_219_545 | 107 |
| 671 | 3300049577 | Ga0501041_0067223 | Ga0501041_0067223_946_1272 | 107 |
| 672 | 3300049577 | Ga0501041_0084006 | Ga0501041_0084006_728_1054 | 107 |
| 673 | 3300049578 | Ga0501042_0029424 | Ga0501042_0029424_2345_2671 | 107 |
| 674 | 3300049578 | Ga0501042_0066670 | Ga0501042_0066670_2219_2545 | 107 |
| 675 | 3300049579 | Ga0501043_0060335 | Ga0501043_0060335_1887_2213 | 107 |
| 676 | 3300049579 | Ga0501043_0081171 | Ga0501043_0081171_895_1221 | 107 |
| 677 | 3300049580 | Ga0501046_0126345 | Ga0501046_0126345_49_375 | 107 |
| 678 | 3300049580 | Ga0501046_0287048 | Ga0501046_0287048_463_789 | 107 |
| 679 | 3300049582 | Ga0501048_0069452 | Ga0501048_0069452_1840_2166 | 107 |
| 680 | 3300049582 | Ga0501048_0079666 | Ga0501048_0079666_1544_1870 | 107 |
| 681 | 3300049582 | Ga0501048_0835779 | Ga0501048_0835779_42_368 | 107 |
| 682 | 3300049584 | Ga0501068_0041064 | Ga0501068_0041064_1175_1501 | 107 |
| 683 | 3300049585 | Ga0501069_0007569 | Ga0501069_0007569_3767_4093 | 107 |
| 684 | 3300049586 | Ga0501070_0078905 | Ga0501070_0078905_2104_2430 | 107 |
| 685 | 3300049586 | Ga0501070_0481905 | Ga0501070_0481905_136_462 | 107 |
| 686 | 3300049587 | Ga0501071_0081894 | Ga0501071_0081894_886_1212 | 107 |
| 687 | 3300049587 | Ga0501071_0207622 | Ga0501071_0207622_184_510 | 107 |
| 688 | 3300049588 | Ga0501072_0041305 | Ga0501072_0041305_1708_2034 | 107 |
| 689 | 3300049589 | Ga0501073_0053563 | Ga0501073_0053563_58_384 | 107 |
| 690 | 3300049590 | Ga0501074_0016179 | Ga0501074_0016179_2236_2562 | 107 |
| 691 | 3300049590 | Ga0501074_0019682 | Ga0501074_0019682_436_762 | 107 |
| 692 | 3300049591 | Ga0501075_0020640 | Ga0501075_0020640_2832_3158 | 107 |
| 693 | 3300049591 | Ga0501075_0042558 | Ga0501075_0042558_367_693 | 107 |
| 694 | 3300049592 | Ga0501076_0041066 | Ga0501076_0041066_2766_3092 | 107 |
| 695 | 3300049592 | Ga0501076_0044689 | Ga0501076_0044689_818_1144 | 107 |
| 696 | 3300049593 | Ga0501077_0020119 | Ga0501077_0020119_2998_3324 | 107 |
| 697 | 3300049593 | Ga0501077_0539338 | Ga0501077_0539338_162_488 | 107 |
| 698 | 3300049741 | Ga0501079_0052745 | Ga0501079_0052745_2716_3042 | 107 |
| 699 | 3300049741 | Ga0501079_0069293 | Ga0501079_0069293_974_1300 | 107 |
| 700 | 3300049742 | Ga0501080_0033295 | Ga0501080_0033295_2872_3198 | 107 |
| 701 | 3300049742 | Ga0501080_0097529 | Ga0501080_0097529_996_1322 | 107 |
| 702 | 3300049743 | Ga0501081_0070783 | Ga0501081_0070783_954_1280 | 107 |
| 703 | 3300049743 | Ga0501081_0097930 | Ga0501081_0097930_196_522 | 107 |
| 704 | 3300049744 | Ga0501083_0070801 | Ga0501083_0070801_843_1169 | 107 |
| 705 | 3300049744 | Ga0501083_0194040 | Ga0501083_0194040_931_1257 | 107 |
| 706 | 3300049822 | Ga0501035_0092494 | Ga0501035_0092494_582_908 | 107 |
| 707 | 3300049823 | Ga0501044_0194459 | Ga0501044_0194459_359_685 | 107 |
| 708 | 3300049824 | Ga0501045_0026671 | Ga0501045_0026671_1663_1989 | 107 |
| 709 | 3300049824 | Ga0501045_0046832 | Ga0501045_0046832_2729_3055 | 107 |
| 710 | 3300050507 | nmdc:mga05p37_445176_c1 | nmdc:mga05p37_445176_c1_551_874 | 107 |
| 711 | 3300050511 | nmdc:mga08y16_10062_c1 | nmdc:mga08y16_10062_c1_3303_3626 | 107 |
| 712 | 3300050514 | nmdc:mga08x19_1166353_c1 | nmdc:mga08x19_1166353_c1_116_439 | 107 |
| 713 | 3300050515 | nmdc:mga0a205_1344455_c1 | nmdc:mga0a205_1344455_c1_101_424 | 107 |
| 714 | 3300054114 | Ga0501084_0038942 | Ga0501084_0038942_3358_3684 | 107 |
| 715 | 3300054114 | Ga0501084_0105788 | Ga0501084_0105788_996_1322 | 107 |
| 716 | 3300060353 | Ga0501082_0119332 | Ga0501082_0119332_976_1302 | 107 |
| 717 | 3300060353 | Ga0501082_0123555 | Ga0501082_0123555_32_358 | 107 |
| 718 | 3300061734 | Ga0530510_0003037 | Ga0530510_0003037_2233_2559 | 107 |
| 719 | 3300061734 | Ga0530510_0140380 | Ga0530510_0140380_63_389 | 107 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6v7u-assembly1.cif.gz_A | structure of a phage-encoded quorum sensing anti-activator, aqs1 | 0.8617 | 23 | 69 |
| 1gsq-assembly1.cif.gz_A | three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods | 0.8067 | 21 | 64 |
| 4djg-assembly1.cif.gz_B | crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 | 0.7845 | 22 | 64 |
| 4djg-assembly1.cif.gz_B | crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 | 0.703 | 22 | 64 |
| 6v7u-assembly1.cif.gz_A | structure of a phage-encoded quorum sensing anti-activator, aqs1 | 0.6462 | 23 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4djgB00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain | 0.7845 | 22 | 64 | 1.20.5.440 |
| 4djgB00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain | 0.703 | 22 | 64 | 1.20.5.440 |
| 1serB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain | 0.6995 | 12 | 69 | 1.10.287.40 |
| 2y3dA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6944 | 11 | 87 | 1.20.120.1490 |
| 1sesB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain | 0.6852 | 12 | 69 | 1.10.287.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538MB04-F1-model_v4 | Uncharacterized protein | 0.995 | 3 | 87 |
|
| AF-A0A7V9FXW7-F1-model_v4 | Uncharacterized protein | 0.9842 | 3 | 96 |
|
| AF-A0A537TPC9-F1-model_v4 | Uncharacterized protein | 0.9816 | 11 | 98 |
|
| AF-A0A7V9I497-F1-model_v4 | Uncharacterized protein | 0.9767 | 4 | 99 |
|
| AF-A0A538HSN3-F1-model_v4 | Uncharacterized protein | 0.9511 | 1 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar