F477287

General Info

Members Datasets Scaffolds Average Seq Length
720 390 1440 309

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10015198|JGI25406J46586_100151983
Length 312
Sequence MAKSQKVIITCAVTGSIHTPSMSPHLPITASEIADAAIGAAEAGAAIVHLHARDPKDGRPDQSPEAFAPFLKVIKQRSKAVINITTGGAPTMAIEERVRPAATFKPEVASLNMGSMNFGLYPMLARFKGKLKHDWEEPYLEGSRDRIFKNTFTDIEYILKTCAENGTRFEIECYDIGHLYTLTHFLERQIVKPPVFVQSVFGILGGIGPHPEDVMHMRRTADRLLGRENYHWSVLGAGRNQMPIAAMAAAMGGNVRVGLEDSLWLGAGKLAESNAAQVTKVRQIIEGLGLEIASPDEAREILVLKGGDKVNF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
197 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
337 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
342 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
346 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
347 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
348 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
349 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
350 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
351 2643221580 Devosia sp. Root635 Isolate Unclassified
352 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
353 2643221674 Devosia sp. Root436 Isolate Unclassified
354 2643221733 Bosea sp. Root381 Isolate Unclassified
355 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
356 2738543024 Aminobacter sp. AP02 Isolate Unclassified
357 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
358 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
359 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
360 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
361 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
362 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
363 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
364 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
365 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
366 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
367 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
368 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
369 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
370 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
371 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
372 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
373 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
374 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
375 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
376 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
377 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
378 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
379 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
380 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
381 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
382 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
383 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
384 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
385 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
386 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
387 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
388 641522639 Methylobacterium sp. 4-46 Isolate Nodule
389 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
390 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.61
Metatranscriptomes 0
Isolates 6.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 3.89
Rhizoplane 6.81
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015198 3300003203 Bacteria 3251
2 Ga0055526_1000351 3300003771 Bacteria 37413
3 Ga0055526_1000616 3300003771 Bacteria 27616
4 Ga0055540_1001787 3300003792 Bacteria 12225
5 Ga0055531_10001782 3300003794 Bacteria 15294
6 Ga0065712_10151782 3300005290 Bacteria 1364
7 Ga0065715_10027859 3300005293 Bacteria 1541
8 Ga0070658_10004623 3300005327 Bacteria 11192
9 Ga0070658_10074423 3300005327 Bacteria 2785
10 Ga0070658_10084592 3300005327 Bacteria 2608
11 Ga0070658_10172416 3300005327 Bacteria 1818
12 Ga0070676_10310642 3300005328 Bacteria 1072
13 Ga0070683_100020032 3300005329 Bacteria 5948
14 Ga0070670_100385781 3300005331 Bacteria 1235
15 Ga0068869_100062713 3300005334 Bacteria 2729
16 Ga0068869_100214627 3300005334 Bacteria 1523
17 Ga0070680_100016831 3300005336 Bacteria 5753
18 Ga0070680_100046413 3300005336 Bacteria 3534
19 Ga0070680_100417884 3300005336 Bacteria 1144
20 Ga0070660_100000662 3300005339 Bacteria 22750
21 Ga0070660_100016666 3300005339 Bacteria 5340
22 Ga0070689_100047940 3300005340 Bacteria 3294
23 Ga0070691_10025872 3300005341 Bacteria 2735
24 Ga0070691_10028012 3300005341 Bacteria 2630
25 Ga0070661_100017770 3300005344 Bacteria 5048
26 Ga0070668_100163645 3300005347 Bacteria 1807
27 Ga0070668_100353901 3300005347 Bacteria 1243
28 Ga0070669_100116364 3300005353 Bacteria 2034
29 Ga0070675_100163387 3300005354 Bacteria 1916
30 Ga0070671_100190391 3300005355 Bacteria 1739
31 Ga0070674_100094998 3300005356 Bacteria 2160
32 Ga0070674_100301687 3300005356 Bacteria 1277
33 Ga0070688_100013163 3300005365 Bacteria 4658
34 Ga0070667_100048996 3300005367 Bacteria 3558
35 Ga0070714_100005060 3300005435 Bacteria 10030
36 Ga0070714_100292270 3300005435 Bacteria 1517
37 Ga0070710_10061572 3300005437 Bacteria 2138
38 Ga0070705_100001612 3300005440 Bacteria 11832
39 Ga0070705_100031692 3300005440 Bacteria 2930
40 Ga0070705_100222195 3300005440 Bacteria 1309
41 Ga0070700_100018834 3300005441 Bacteria 3975
42 Ga0070700_100047868 3300005441 Bacteria 2648
43 Ga0070694_100002314 3300005444 Bacteria 11259
44 Ga0070694_100026326 3300005444 Bacteria 3768
45 Ga0070694_100041950 3300005444 Bacteria 3054
46 Ga0070708_100117687 3300005445 Bacteria 2447
47 Ga0070663_100041671 3300005455 Bacteria 3223
48 Ga0070678_100025693 3300005456 Bacteria 3968
49 Ga0070662_100133646 3300005457 Bacteria 1916
50 Ga0070681_10009772 3300005458 Bacteria 9439
51 Ga0070681_10228340 3300005458 Bacteria 1776
52 Ga0068867_100164107 3300005459 Bacteria 1754
53 Ga0070699_100001776 3300005518 Bacteria 19647
54 Ga0070699_100018725 3300005518 Bacteria 5946
55 Ga0070699_100143041 3300005518 Bacteria 2113
56 Ga0070679_100003357 3300005530 Bacteria 14669
57 Ga0070684_100003240 3300005535 Bacteria 12175
58 Ga0070697_100003270 3300005536 Bacteria 12442
59 Ga0070697_100034198 3300005536 Bacteria 4097
60 Ga0070697_100062513 3300005536 Bacteria 3039
61 Ga0068853_100150444 3300005539 Bacteria 2095
62 Ga0070672_100077983 3300005543 Bacteria 2650
63 Ga0070672_100238900 3300005543 Bacteria 1528
64 Ga0070686_100134720 3300005544 Bacteria 1712
65 Ga0070695_100000478 3300005545 Bacteria 20811
66 Ga0070695_100001540 3300005545 Bacteria 12838
67 Ga0070695_100007921 3300005545 Bacteria 6291
68 Ga0070695_100021490 3300005545 Bacteria 3950
69 Ga0070695_100170289 3300005545 Bacteria 1536
70 Ga0070695_100230841 3300005545 Bacteria 1338
71 Ga0070696_100000872 3300005546 Bacteria 19510
72 Ga0070696_100021109 3300005546 Bacteria 4414
73 Ga0070696_100083943 3300005546 Bacteria 2260
74 Ga0070693_100321950 3300005547 Bacteria 1049
75 Ga0070665_100000737 3300005548 Bacteria 43602
76 Ga0070665_100244289 3300005548 Bacteria 1796
77 Ga0070704_100006437 3300005549 Bacteria 6920
78 Ga0070704_100029072 3300005549 Bacteria 3685
79 Ga0068855_100007162 3300005563 Bacteria 13532
80 Ga0068855_100488262 3300005563 Bacteria 1340
81 Ga0070664_100042761 3300005564 Bacteria 3824
82 Ga0068857_100002495 3300005577 Bacteria 15043
83 Ga0068857_100046400 3300005577 Bacteria 3856
84 Ga0068857_100050735 3300005577 Bacteria 3680
85 Ga0068857_100319804 3300005577 Bacteria 1433
86 Ga0068854_100001185 3300005578 Bacteria 15636
87 Ga0068856_100012853 3300005614 Bacteria 8102
88 Ga0068856_100059132 3300005614 Bacteria 3786
89 Ga0068852_100000367 3300005616 Bacteria 30429
90 Ga0068859_100005145 3300005617 Bacteria 13278
91 Ga0068859_100353813 3300005617 Bacteria 1564
92 Ga0068864_100210627 3300005618 Bacteria 1789
93 Ga0068864_100341663 3300005618 Bacteria 1411
94 Ga0068866_10214259 3300005718 Bacteria 1158
95 Ga0068861_100007079 3300005719 Bacteria 7675
96 Ga0068861_100059155 3300005719 Bacteria 2933
97 Ga0068863_100152926 3300005841 Bacteria 2208
98 Ga0068860_100006129 3300005843 Bacteria 12092
99 Ga0068862_100006164 3300005844 Bacteria 9983
100 Ga0068862_100051377 3300005844 Bacteria 3525
101 Ga0081455_10000015 3300005937 Bacteria 189655
102 Ga0081455_10050275 3300005937 Bacteria 3586
103 Ga0081538_10025816 3300005981 Bacteria 4130
104 Ga0081540_1000034 3300005983 Bacteria 142197
105 Ga0081539_10000308 3300005985 Bacteria 109598
106 Ga0081539_10000522 3300005985 Bacteria 79973
107 Ga0081539_10027324 3300005985 Bacteria 3617
108 Ga0075365_10044325 3300006038 Bacteria 2914
109 Ga0075365_10126619 3300006038 Bacteria 1765
110 Ga0075368_10001099 3300006042 Bacteria 8509
111 Ga0075368_10024861 3300006042 Bacteria 2296
112 Ga0075363_100005801 3300006048 Bacteria 5545
113 Ga0075363_100007586 3300006048 Bacteria 4997
114 Ga0075364_10148450 3300006051 Bacteria 1579
115 Ga0075432_10014608 3300006058 Bacteria 2674
116 Ga0070716_100095654 3300006173 Bacteria 1809
117 Ga0070712_100067872 3300006175 Bacteria 2539
118 Ga0075362_10021662 3300006177 Bacteria 2701
119 Ga0075367_10012300 3300006178 Bacteria 4558
120 Ga0075367_10035202 3300006178 Bacteria 2897
121 Ga0075369_10073397 3300006186 Bacteria 1509
122 Ga0097621_100009732 3300006237 Bacteria 6995
123 Ga0097621_100028250 3300006237 Bacteria 4421
124 Ga0068871_100013721 3300006358 Bacteria 6024
125 Ga0068871_100440172 3300006358 Bacteria 1167
126 Ga0075428_100000800 3300006844 Bacteria 32816
127 Ga0075428_100001436 3300006844 Bacteria 25443
128 Ga0075428_100126562 3300006844 Bacteria 2780
129 Ga0075430_100046497 3300006846 Bacteria 3666
130 Ga0075430_100077220 3300006846 Bacteria 2791
131 Ga0075430_100137855 3300006846 Bacteria 2032
132 Ga0075430_100171962 3300006846 Bacteria 1802
133 Ga0075431_100001164 3300006847 Bacteria 23683
134 Ga0075431_100038116 3300006847 Bacteria 4949
135 Ga0075431_100129353 3300006847 Bacteria 2605
136 Ga0075431_100425600 3300006847 Bacteria 1326
137 Ga0075433_10000760 3300006852 Bacteria 22134
138 Ga0075434_100000159 3300006871 Bacteria 42604
139 Ga0075434_100001640 3300006871 Bacteria 19031
140 Ga0075434_100015709 3300006871 Bacteria 7265
141 Ga0075434_100304726 3300006871 Bacteria 1613
142 Ga0075429_100001322 3300006880 Bacteria 20223
143 Ga0075429_100035476 3300006880 Bacteria 4337
144 Ga0075429_100107208 3300006880 Bacteria 2441
145 Ga0075436_100001167 3300006914 Bacteria 17790
146 Ga0075436_100007018 3300006914 Bacteria 7713
147 Ga0075436_100018084 3300006914 Bacteria 4827
148 Ga0075436_100037416 3300006914 Bacteria 3350
149 Ga0097620_100005145 3300006931 Bacteria 13278
150 Ga0097620_100353819 3300006931 Bacteria 1564
151 Ga0075435_100000197 3300007076 Bacteria 36483
152 Ga0075435_100005969 3300007076 Bacteria 8569
153 Ga0075435_100220308 3300007076 Bacteria 1611
154 Ga0099795_10011497 3300007788 Bacteria 2649
155 Ga0105240_10000955 3300009093 Bacteria 51574
156 Ga0105240_10036727 3300009093 Bacteria 6300
157 Ga0105240_10051545 3300009093 Bacteria 5176
158 Ga0105240_10053106 3300009093 Bacteria 5090
159 Ga0105240_10270130 3300009093 Bacteria 1958
160 Ga0105240_10367517 3300009093 Bacteria 1627
161 Ga0105240_10446335 3300009093 Bacteria 1448
162 Ga0111539_10000123 3300009094 Bacteria 87000
163 Ga0111539_10000178 3300009094 Bacteria 73928
164 Ga0111539_10036631 3300009094 Bacteria 5929
165 Ga0111539_10051083 3300009094 Bacteria 4925
166 Ga0111539_10174922 3300009094 Bacteria 2508
167 Ga0111539_10248610 3300009094 Bacteria 2071
168 Ga0111539_10345914 3300009094 Bacteria 1731
169 Ga0105245_10475233 3300009098 Bacteria 1262
170 Ga0105245_10787717 3300009098 Bacteria 988
171 Ga0114129_10000702 3300009147 Bacteria 42161
172 Ga0114129_10001064 3300009147 Bacteria 36035
173 Ga0114129_10201481 3300009147 Bacteria 2695
174 Ga0114129_10248345 3300009147 Bacteria 2389
175 Ga0114129_10301144 3300009147 Bacteria 2137
176 Ga0105243_10077669 3300009148 Bacteria 2701
177 Ga0105243_10124766 3300009148 Bacteria 2176
178 Ga0105241_10028352 3300009174 Bacteria 4173
179 Ga0105241_10272812 3300009174 Bacteria 1442
180 Ga0105248_10057854 3300009177 Bacteria 4352
181 Ga0105248_10433252 3300009177 Bacteria 1481
182 Ga0105237_10319047 3300009545 Bacteria 1557
183 Ga0105237_10368936 3300009545 Bacteria 1440
184 Ga0105237_10444186 3300009545 Bacteria 1303
185 Ga0105238_10004584 3300009551 Bacteria 13665
186 Ga0105238_10015970 3300009551 Bacteria 7597
187 Ga0105238_10498093 3300009551 Bacteria 1219
188 Ga0105249_10351194 3300009553 Bacteria 1494
189 Ga0105249_10520112 3300009553 Bacteria 1237
190 Ga0105246_10021336 3300011119 Bacteria 4167
191 Ga0105246_10080331 3300011119 Bacteria 2321
192 Ga0157373_10047203 3300013100 Bacteria 3072
193 Ga0157371_10070116 3300013102 Bacteria 2482
194 Ga0157370_10008718 3300013104 Bacteria 10909
195 Ga0157370_10080822 3300013104 Bacteria 3060
196 Ga0157370_10514133 3300013104 Bacteria 1099
197 Ga0157369_10005664 3300013105 Bacteria 14513
198 Ga0157369_10334682 3300013105 Bacteria 1573
199 Ga0157369_10452714 3300013105 Bacteria 1329
200 Ga0171462_1021 3300013250 Bacteria 141297
201 Ga0157374_10025588 3300013296 Bacteria 5301
202 Ga0157374_10049196 3300013296 Bacteria 3915
203 Ga0157374_10107501 3300013296 Bacteria 2681
204 Ga0163162_10202954 3300013306 Bacteria 2111
205 Ga0163162_10318849 3300013306 Bacteria 1687
206 Ga0157372_10001324 3300013307 Bacteria 26822
207 Ga0157372_10304639 3300013307 Bacteria 1853
208 Ga0157375_10396012 3300013308 Bacteria 1548
209 Ga0163163_10123354 3300014325 Bacteria 2626
210 Ga0157380_10034278 3300014326 Bacteria 3915
211 Ga0157380_10047122 3300014326 Bacteria 3389
212 Ga0182008_10013391 3300014497 Bacteria 4313
213 Ga0157379_10211612 3300014968 Bacteria 1755
214 Ga0157379_10439930 3300014968 Bacteria 1202
215 Ga0182006_1079362 3300015261 Bacteria 1200
216 Ga0182007_10016112 3300015262 Bacteria 2767
217 Ga0182005_1027109 3300015265 Bacteria 1562
218 Ga0163161_10365848 3300017792 Bacteria 1149
219 Ga0213872_10095289 3300021361 Bacteria 1329
220 Ga0213874_10013244 3300021377 Bacteria 2132
221 Ga0213876_10002265 3300021384 Bacteria 11352
222 Ga0213876_10029843 3300021384 Bacteria 2874
223 Ga0213876_10035830 3300021384 Bacteria 2617
224 Ga0213876_10042957 3300021384 Bacteria 2389
225 Ga0213876_10051339 3300021384 Bacteria 2179
226 Ga0213876_10133626 3300021384 Bacteria 1319
227 Ga0213875_10000182 3300021388 Bacteria 64147
228 Ga0213875_10002256 3300021388 Bacteria 11691
229 Ga0213875_10113407 3300021388 Bacteria 1266
230 Ga0213871_10041302 3300021441 Bacteria 1239
231 Ga0209233_1000013 3300025261 Bacteria 1013785
232 Ga0209676_1002462 3300025292 Bacteria 13092
233 Ga0209564_1000075 3300025295 Bacteria 285760
234 Ga0209758_1000532 3300025297 Bacteria 60639
235 Ga0209051_1001617 3300025303 Bacteria 18379
236 Ga0209257_1002499 3300025304 Bacteria 18154
237 Ga0207653_10019460 3300025885 Bacteria 2140
238 Ga0207682_10003948 3300025893 Bacteria 6320
239 Ga0207692_10075663 3300025898 Bacteria 1787
240 Ga0207642_10129795 3300025899 Bacteria 1313
241 Ga0207688_10083269 3300025901 Bacteria 1829
242 Ga0207688_10136778 3300025901 Bacteria 1439
243 Ga0207647_10150064 3300025904 Bacteria 1363
244 Ga0207705_10007629 3300025909 Bacteria 7956
245 Ga0207705_10059658 3300025909 Bacteria 2754
246 Ga0207705_10079331 3300025909 Bacteria 2390
247 Ga0207705_10122348 3300025909 Bacteria 1932
248 Ga0207705_10219316 3300025909 Bacteria 1444
249 Ga0207654_10015946 3300025911 Bacteria 3908
250 Ga0207707_10016636 3300025912 Bacteria 6412
251 Ga0207707_10122628 3300025912 Bacteria 2273
252 Ga0207695_10003827 3300025913 Bacteria 20860
253 Ga0207695_10061179 3300025913 Bacteria 3893
254 Ga0207695_10074089 3300025913 Bacteria 3466
255 Ga0207695_10077586 3300025913 Bacteria 3373
256 Ga0207695_10080251 3300025913 Bacteria 3304
257 Ga0207695_10116069 3300025913 Bacteria 2651
258 Ga0207660_10005578 3300025917 Bacteria 8171
259 Ga0207660_10073718 3300025917 Bacteria 2489
260 Ga0207660_10340949 3300025917 Bacteria 1200
261 Ga0207662_10093198 3300025918 Bacteria 1856
262 Ga0207657_10031888 3300025919 Bacteria 4766
263 Ga0207657_10066994 3300025919 Bacteria 3055
264 Ga0207657_10067697 3300025919 Bacteria 3036
265 Ga0207657_10380028 3300025919 Bacteria 1112
266 Ga0207652_10048417 3300025921 Bacteria 3634
267 Ga0207681_10067767 3300025923 Bacteria 2476
268 Ga0207694_10002178 3300025924 Bacteria 16103
269 Ga0207659_10207814 3300025926 Bacteria 1567
270 Ga0207687_10009349 3300025927 Bacteria 6409
271 Ga0207687_10249828 3300025927 Bacteria 1409
272 Ga0207700_10060250 3300025928 Bacteria 2874
273 Ga0207664_10003873 3300025929 Bacteria 10049
274 Ga0207664_10056272 3300025929 Bacteria 3124
275 Ga0207664_10059394 3300025929 Bacteria 3045
276 Ga0207690_10008268 3300025932 Bacteria 6172
277 Ga0207706_10078994 3300025933 Bacteria 2894
278 Ga0207706_10111470 3300025933 Bacteria 2407
279 Ga0207706_10308336 3300025933 Bacteria 1379
280 Ga0207670_10094154 3300025936 Bacteria 2124
281 Ga0207669_10167893 3300025937 Bacteria 1558
282 Ga0207665_10134788 3300025939 Bacteria 1756
283 Ga0207691_10011683 3300025940 Bacteria 8432
284 Ga0207689_10281657 3300025942 Bacteria 1377
285 Ga0207661_10009105 3300025944 Bacteria 7118
286 Ga0207661_10249478 3300025944 Bacteria 1577
287 Ga0207679_10011161 3300025945 Bacteria 5803
288 Ga0207667_10002686 3300025949 Bacteria 21993
289 Ga0207667_10021873 3300025949 Bacteria 7077
290 Ga0207667_10567604 3300025949 Bacteria 1146
291 Ga0207712_10002182 3300025961 Bacteria 12780
292 Ga0207712_10452712 3300025961 Bacteria 1089
293 Ga0207668_10107821 3300025972 Bacteria 2083
294 Ga0207640_10003711 3300025981 Bacteria 8237
295 Ga0207640_10052823 3300025981 Bacteria 2649
296 Ga0207658_10406076 3300025986 Bacteria 1198
297 Ga0207677_10073846 3300026023 Bacteria 2417
298 Ga0207703_10376290 3300026035 Bacteria 1313
299 Ga0207678_10026173 3300026067 Bacteria 5090
300 Ga0207708_10009564 3300026075 Bacteria 7187
301 Ga0207708_10159028 3300026075 Bacteria 1783
302 Ga0207702_10002356 3300026078 Bacteria 18040
303 Ga0207702_10110662 3300026078 Bacteria 2441
304 Ga0207648_10013191 3300026089 Bacteria 7701
305 Ga0207676_10054713 3300026095 Bacteria 3129
306 Ga0207676_10353045 3300026095 Bacteria 1360
307 Ga0207674_10000046 3300026116 Bacteria 122047
308 Ga0207674_10006766 3300026116 Bacteria 13453
309 Ga0207674_10007163 3300026116 Bacteria 13029
310 Ga0207674_10102845 3300026116 Bacteria 2836
311 Ga0207674_10276745 3300026116 Bacteria 1626
312 Ga0207674_10347591 3300026116 Bacteria 1434
313 Ga0207675_100021306 3300026118 Bacteria 6038
314 Ga0207675_100164842 3300026118 Bacteria 2116
315 Ga0207683_10007852 3300026121 Bacteria 9131
316 Ga0207683_10176050 3300026121 Bacteria 1939
317 Ga0207698_10012681 3300026142 Bacteria 5527
318 Ga0207698_10284998 3300026142 Bacteria 1530
319 Ga0209813_10012162 3300027866 Bacteria 2267
320 Ga0209813_10029957 3300027866 Bacteria 1596
321 Ga0209974_10003916 3300027876 Bacteria 5326
322 Ga0207428_10000133 3300027907 Bacteria 100902
323 Ga0207428_10001362 3300027907 Bacteria 25965
324 Ga0207428_10004374 3300027907 Bacteria 13474
325 Ga0207428_10049279 3300027907 Bacteria 3376
326 Ga0207428_10076104 3300027907 Bacteria 2629
327 Ga0207428_10284626 3300027907 Bacteria 1226
328 Ga0268265_10006963 3300028380 Bacteria 7649
329 Ga0268264_10003433 3300028381 Bacteria 13666
330 Ga0268264_10029701 3300028381 Bacteria 4480
331 Ga0265318_10031098 3300028577 Bacteria 2072
332 Ga0265338_10030476 3300028800 Bacteria 5313
333 Ga0265330_10053873 3300031235 Bacteria 1759
334 Ga0265332_10026267 3300031238 Bacteria 2554
335 Ga0265325_10044584 3300031241 Bacteria 2309
336 Ga0265339_10002476 3300031249 Bacteria 13211
337 Ga0265327_10001259 3300031251 Bacteria 33543
338 Ga0265316_10112421 3300031344 Bacteria 2061
339 Ga0265313_10046216 3300031595 Bacteria 2114
340 Ga0316575_10002528 3300031665 Bacteria 6159
341 Ga0316575_10009463 3300031665 Bacteria 3569
342 Ga0316579_10007131 3300031691 Bacteria 4600
343 Ga0265314_10003737 3300031711 Bacteria 14574
344 Ga0265314_10064623 3300031711 Bacteria 2476
345 Ga0265314_10088718 3300031711 Bacteria 2019
346 Ga0265314_10092347 3300031711 Bacteria 1968
347 Ga0265342_10088331 3300031712 Bacteria 1780
348 Ga0265342_10089489 3300031712 Bacteria 1766
349 Ga0307413_10030146 3300031824 Bacteria 3044
350 Ga0307413_10113928 3300031824 Bacteria 1816
351 Ga0307410_10023500 3300031852 Bacteria 3833
352 Ga0307416_100371651 3300032002 Bacteria 1456
353 Ga0307414_10068121 3300032004 Bacteria 2553
354 Ga0307414_10089283 3300032004 Bacteria 2284
355 Ga0307414_10094157 3300032004 Bacteria 2235
356 Ga0307411_10277447 3300032005 Bacteria 1332
357 Ga0307415_100041798 3300032126 Bacteria 3047
358 Ga0307415_100469181 3300032126 Bacteria 1093
359 Ga0316583_10006742 3300032133 Bacteria 4139
360 Ga0316583_10035987 3300032133 Bacteria 1757
361 Ga0307510_10095303 3300033180 Bacteria 2797
362 Ga0373958_0005665 3300034819 Bacteria 1910
363 Ga0373938_0002348 3300034957 Bacteria 3047
364 Ga0373934_0007766 3300035086 Bacteria 3985
365 Ga0373940_0010240 3300035088 Bacteria 2200
366 Ga0373944_0065028 3300035089 Bacteria 1177
367 Ga0373932_0022664 3300035112 Bacteria 1670
368 Ga0373936_0023678 3300035113 Bacteria 2394
369 Ga0373939_0019374 3300035114 Bacteria 1835
370 Ga0373941_0019955 3300035115 Bacteria 1873
371 Ga0373953_0004204 3300035117 Bacteria 4568
372 Ga0373953_0009490 3300035117 Bacteria 3352
373 Ga0373954_0000006 3300035118 Bacteria 98573
374 Ga0373954_0001839 3300035118 Bacteria 8757
375 Ga0373954_0034337 3300035118 Bacteria 2349
376 Ga0373956_0000620 3300035119 Bacteria 14542
377 Ga0373956_0006420 3300035119 Bacteria 4711
378 Ga0373956_0010757 3300035119 Bacteria 3758
379 Ga0373957_0000829 3300035120 Bacteria 8081
380 Ga0373955_0006604 3300035172 Bacteria 5294
381 Ga0373955_0008260 3300035172 Bacteria 4828
382 Ga0373955_0013572 3300035172 Bacteria 3943
383 Ga0316574_0002222 3300035398 Bacteria 9659
384 Ga0373924_0000705 3300035410 Bacteria 10403
385 Ga0373924_0015403 3300035410 Bacteria 2907
386 Ga0373931_0002317 3300035691 Bacteria 8413
387 Ga0373935_0045796 3300035692 Bacteria 2761
388 Ga0373927_0171867 3300035695 Bacteria 1421
389 Ga0373933_0000456 3300035724 Bacteria 25602
390 Ga0373933_0005686 3300035724 Bacteria 6785
391 Ga0373933_0188161 3300035724 Bacteria 1318
392 Ga0373937_0000595 3300036401 Bacteria 32029
393 Ga0373937_0003151 3300036401 Bacteria 13803
394 Ga0373937_0108885 3300036401 Bacteria 2576
395 Ga0373937_0460160 3300036401 Bacteria 1208
396 Ga0373937_0573784 3300036401 Bacteria 1071
397 Ga0316582_0037515 3300036647 Bacteria 3005
398 Ga0395899_0187774 3300037312 Bacteria 1447
399 Ga0395900_0014754 3300037418 Bacteria 7964
400 Ga0395900_0194824 3300037418 Bacteria 2054
401 Ga0395898_0006367 3300037466 Bacteria 12610
402 Ga0436364_0045510 3300037853 Bacteria 16396
403 Ga0436364_0250341 3300037853 Bacteria 6526
404 Ga0436364_1052080 3300037853 Bacteria 4580
405 Ga0395901_0010336 3300038443 Bacteria 9454
406 Ga0395901_0138181 3300038443 Bacteria 2561
407 Ga0395901_0312843 3300038443 Bacteria 1626
408 Ga0436365_0015906 3300039437 Bacteria 1195
409 Ga0436365_0051821 3300039437 Bacteria 3613
410 Ga0436365_0110577 3300039437 Bacteria 22612
411 Ga0436365_0846967 3300039437 Bacteria 2808
412 Ga0436365_0889766 3300039437 Bacteria 1751
413 Ga0436365_1484879 3300039437 Bacteria 1194
414 Ga0436365_1528483 3300039437 Bacteria 2505
415 Ga0436365_1540042 3300039437 Bacteria 70665
416 Ga0436365_1594393 3300039437 Bacteria 1176
417 Ga0436360_0050123 3300039438 Bacteria 4623
418 Ga0436360_1319865 3300039438 Bacteria 3241
419 Ga0436360_1320262 3300039438 Bacteria 2700
420 Ga0436361_0042221 3300039447 Bacteria 1384
421 Ga0436361_0239500 3300039447 Bacteria 1200
422 Ga0436361_0273018 3300039447 Bacteria 1969
423 Ga0436361_0624631 3300039447 Bacteria 1122
424 Ga0436361_1110668 3300039447 Bacteria 1090
425 Ga0436363_0295539 3300039450 Bacteria 2017
426 Ga0436363_1072504 3300039450 Bacteria 18743
427 Ga0436363_1447910 3300039450 Bacteria 1913
428 Ga0436362_0166111 3300039453 Bacteria 10615
429 Ga0436362_1173555 3300039453 Bacteria 1249
430 Ga0439461_0008905 3300041410 Bacteria 1811
431 Ga0451793_0186697 3300041452 Bacteria 1801
432 Ga0451807_0062428 3300041486 Bacteria 2122
433 Ga0439435_0005504 3300042436 Bacteria 2790
434 Ga0439435_0032514 3300042436 Bacteria 1424
435 Ga0466966_0035846 3300044684 Bacteria 3204
436 Ga0495592_0116293 3300046454 Bacteria 1887
437 Ga0495603_0236603 3300046455 Bacteria 1052
438 Ga0495651_0007569 3300046462 Bacteria 8307
439 Ga0495651_0049868 3300046462 Bacteria 3231
440 Ga0495580_0002673 3300046472 Bacteria 15453
441 Ga0495580_0136471 3300046472 Bacteria 1701
442 Ga0495639_0002006 3300046475 Bacteria 9012
443 Ga0495639_0100416 3300046475 Bacteria 1366
444 Ga0495606_0124478 3300046507 Bacteria 1539
445 Ga0495608_0031414 3300046511 Bacteria 3591
446 Ga0495610_0051069 3300046512 Bacteria 2015
447 Ga0495628_0000587 3300046516 Bacteria 33483
448 Ga0495630_0354986 3300046517 Bacteria 1122
449 Ga0495643_0144283 3300046522 Bacteria 1184
450 Ga0495666_0003054 3300046526 Bacteria 8414
451 Ga0495640_0135364 3300046533 Bacteria 1592
452 Ga0495586_0002793 3300046535 Bacteria 9434
453 Ga0495598_0010367 3300046537 Bacteria 2231
454 Ga0495645_0144490 3300046543 Bacteria 1657
455 Ga0495622_0092493 3300046557 Bacteria 1389
456 Ga0495667_0009786 3300046559 Bacteria 6493
457 Ga0495625_0046386 3300046660 Bacteria 3136
458 Ga0495588_0035306 3300046674 Bacteria 2533
459 Ga0495657_0083554 3300046675 Bacteria 2061
460 Ga0495657_0152854 3300046675 Bacteria 1432
461 Ga0495599_0169826 3300046678 Bacteria 1346
462 Ga0495613_0011354 3300046689 Bacteria 6619
463 Ga0495624_0061452 3300046690 Bacteria 2354
464 Ga0495600_0012105 3300046809 Bacteria 5387
465 Ga0495600_0186169 3300046809 Bacteria 1337
466 Ga0495604_0041054 3300047317 Bacteria 3630
467 Ga0495604_0286539 3300047317 Bacteria 1111
468 Ga0495674_0007588 3300047319 Bacteria 10364
469 Ga0495672_0005660 3300047320 Bacteria 9860
470 Ga0495676_0158228 3300047321 Bacteria 1605
471 Ga0495675_0072127 3300047444 Bacteria 2179
472 Ga0495614_0016995 3300048089 Bacteria 3162
473 Ga0496100_0066955 3300048903 Bacteria 2384
474 Ga0496100_0090886 3300048903 Bacteria 2083
475 Ga0496100_0140037 3300048903 Bacteria 1714
476 Ga0496101_0089712 3300048904 Bacteria 2285
477 Ga0496101_0255440 3300048904 Bacteria 1366
478 Ga0496101_0357147 3300048904 Bacteria 1149
479 Ga0496102_0017362 3300048905 Bacteria 6304
480 Ga0496102_0120911 3300048905 Bacteria 2446
481 Ga0496104_0004885 3300048907 Bacteria 11685
482 Ga0496104_0005122 3300048907 Bacteria 11440
483 Ga0496104_0007059 3300048907 Bacteria 9907
484 Ga0496105_0000424 3300048908 Bacteria 27799
485 Ga0496105_0058990 3300048908 Bacteria 3167
486 Ga0496105_0377621 3300048908 Bacteria 1128
487 Ga0496106_0000194 3300048909 Bacteria 42793
488 Ga0496106_0001287 3300048909 Bacteria 18830
489 Ga0496106_0065697 3300048909 Bacteria 2762
490 Ga0496107_0078769 3300048910 Bacteria 2401
491 Ga0496107_0177140 3300048910 Bacteria 1583
492 Ga0496108_0000941 3300048911 Bacteria 22730
493 Ga0496108_0002701 3300048911 Bacteria 14201
494 Ga0496108_0013407 3300048911 Bacteria 6684
495 Ga0496109_0001304 3300048912 Bacteria 20607
496 Ga0496109_0006158 3300048912 Bacteria 10083
497 Ga0496109_0040221 3300048912 Bacteria 4234
498 Ga0496110_0000973 3300048913 Bacteria 20082
499 Ga0496110_0002897 3300048913 Bacteria 12986
500 Ga0496110_0192457 3300048913 Bacteria 1852
501 Ga0496110_0287451 3300048913 Bacteria 1497
502 Ga0496111_0000315 3300048914 Bacteria 23917
503 Ga0496111_0081837 3300048914 Bacteria 2357
504 Ga0496111_0099110 3300048914 Bacteria 2140
505 Ga0496112_0030772 3300048915 Bacteria 5199
506 Ga0496112_0047851 3300048915 Bacteria 4195
507 Ga0496112_0066973 3300048915 Bacteria 3543
508 Ga0496112_0355536 3300048915 Bacteria 1407
509 Ga0496113_0000218 3300048916 Bacteria 26800
510 Ga0496113_0008768 3300048916 Bacteria 6605
511 Ga0496114_0051806 3300048917 Bacteria 3418
512 Ga0496114_0092015 3300048917 Bacteria 2576
513 Ga0496115_0017305 3300048918 Bacteria 5507
514 Ga0496115_0057577 3300048918 Bacteria 3126
515 Ga0496115_0067327 3300048918 Bacteria 2896
516 Ga0496115_0072432 3300048918 Bacteria 2796
517 Ga0496115_0076294 3300048918 Bacteria 2724
518 Ga0496115_0079502 3300048918 Bacteria 2669
519 Ga0496115_0093335 3300048918 Bacteria 2461
520 Ga0496121_0111583 3300048924 Bacteria 2084
521 Ga0496121_0141065 3300048924 Bacteria 1788
522 Ga0496125_0001211 3300048928 Bacteria 38785
523 Ga0496126_0090925 3300048929 Bacteria 2685
524 Ga0496126_0190744 3300048929 Bacteria 1736
525 Ga0501032_0016516 3300049569 Bacteria 5191
526 Ga0501032_0032956 3300049569 Bacteria 3550
527 Ga0501032_0170982 3300049569 Bacteria 1425
528 Ga0501032_0300997 3300049569 Bacteria 1037
529 Ga0501033_0023584 3300049570 Bacteria 4641
530 Ga0501033_0039625 3300049570 Bacteria 3519
531 Ga0501033_0048422 3300049570 Bacteria 3157
532 Ga0501034_0007519 3300049571 Bacteria 11591
533 Ga0501034_0019149 3300049571 Bacteria 7008
534 Ga0501034_0238999 3300049571 Bacteria 1763
535 Ga0501034_0329874 3300049571 Bacteria 1457
536 Ga0501036_0001414 3300049572 Bacteria 18439
537 Ga0501036_0037139 3300049572 Bacteria 4121
538 Ga0501036_0253189 3300049572 Bacteria 1475
539 Ga0501037_0017570 3300049573 Bacteria 5264
540 Ga0501037_0225518 3300049573 Bacteria 1317
541 Ga0501038_0005163 3300049574 Bacteria 12141
542 Ga0501038_0149711 3300049574 Bacteria 1903
543 Ga0501039_0048191 3300049575 Bacteria 3294
544 Ga0501039_0130273 3300049575 Bacteria 1974
545 Ga0501039_0459352 3300049575 Bacteria 1000
546 Ga0501040_0000067 3300049576 Bacteria 50568
547 Ga0501040_0105449 3300049576 Bacteria 1969
548 Ga0501041_0000378 3300049577 Bacteria 22303
549 Ga0501041_0012012 3300049577 Bacteria 5125
550 Ga0501043_0017782 3300049579 Bacteria 5574
551 Ga0501043_0070277 3300049579 Bacteria 2750
552 Ga0501046_0000275 3300049580 Bacteria 52272
553 Ga0501046_0011492 3300049580 Bacteria 7570
554 Ga0501046_0172165 3300049580 Bacteria 1624
555 Ga0501047_0058937 3300049581 Bacteria 3708
556 Ga0501047_0077486 3300049581 Bacteria 3198
557 Ga0501047_0170038 3300049581 Bacteria 2048
558 Ga0501047_0254117 3300049581 Bacteria 1606
559 Ga0501047_0321144 3300049581 Bacteria 1388
560 Ga0501048_0000187 3300049582 Bacteria 39685
561 Ga0501048_0188956 3300049582 Bacteria 1460
562 Ga0501048_0229506 3300049582 Bacteria 1317
563 Ga0501067_0027255 3300049583 Bacteria 3166
564 Ga0501068_0061331 3300049584 Bacteria 2285
565 Ga0501068_0150404 3300049584 Bacteria 1463
566 Ga0501072_0000219 3300049588 Bacteria 41811
567 Ga0501072_0347072 3300049588 Bacteria 1178
568 Ga0501073_0094168 3300049589 Bacteria 2080
569 Ga0501073_0181453 3300049589 Bacteria 1457
570 Ga0501074_0100397 3300049590 Bacteria 2071
571 Ga0501074_0240418 3300049590 Bacteria 1288
572 Ga0501075_0000011 3300049591 Bacteria 83082
573 Ga0501076_0000116 3300049592 Bacteria 44179
574 Ga0501076_0138720 3300049592 Bacteria 1975
575 Ga0501077_0000804 3300049593 Bacteria 19003
576 Ga0501079_0000021 3300049741 Bacteria 63849
577 Ga0501080_0067856 3300049742 Bacteria 3317
578 Ga0501080_0253777 3300049742 Bacteria 1603
579 Ga0501080_0608408 3300049742 Bacteria 970
580 Ga0501081_0000461 3300049743 Bacteria 22580
581 Ga0501081_0022742 3300049743 Bacteria 4196
582 Ga0501081_0056365 3300049743 Bacteria 2716
583 Ga0501035_0137554 3300049822 Bacteria 2125
584 Ga0501035_0148441 3300049822 Bacteria 2036
585 Ga0501044_0015257 3300049823 Bacteria 8276
586 Ga0501044_0134906 3300049823 Bacteria 2460
587 Ga0501044_0138288 3300049823 Bacteria 2425
588 Ga0501044_0326479 3300049823 Bacteria 1458
589 Ga0501045_0000083 3300049824 Bacteria 45695
590 nmdc:mga03683_77987_c1 3300050489 Bacteria 1426
591 nmdc:mga03n38_29688_c1 3300050490 Bacteria 2291
592 nmdc:mga03n38_88137_c1 3300050490 Bacteria 1472
593 nmdc:mga00v17_12612_c1 3300050491 Bacteria 4667
594 nmdc:mga0yw44_131651_c1 3300050492 Bacteria 1620
595 nmdc:mga0yw44_23857_c1 3300050492 Bacteria 3452
596 nmdc:mga06z11_245387_c1 3300050494 Bacteria 1053
597 nmdc:mga06z11_34823_c1 3300050494 Bacteria 2474
598 nmdc:mga06z11_8366_c1 3300050494 Bacteria 4311
599 nmdc:mga04h51_13750_c1 3300050495 Bacteria 2298
600 nmdc:mga05p37_185_c1 3300050507 Bacteria 61269
601 nmdc:mga05p37_226638_c2 3300050507 Bacteria 1805
602 nmdc:mga05p37_638500_c1 3300050507 Bacteria 1195
603 nmdc:mga05p37_70429_c1 3300050507 Bacteria 4301
604 nmdc:mga05p37_748_c1 3300050507 Bacteria 36018
605 nmdc:mga09592_343575_c1 3300050508 Bacteria 1292
606 nmdc:mga09592_53870_c1 3300050508 Bacteria 3398
607 nmdc:mga09592_57971_c1 3300050508 Bacteria 3275
608 nmdc:mga0qj67_108533_c1 3300050509 Bacteria 2240
609 nmdc:mga0qj67_316383_c1 3300050509 Bacteria 1264
610 nmdc:mga0qj67_332128_c1 3300050509 Bacteria 1230
611 nmdc:mga0qj67_40017_c1 3300050509 Bacteria 3683
612 nmdc:mga0qj67_406198_c1 3300050509 Bacteria 1099
613 nmdc:mga0qj67_51675_c1 3300050509 Bacteria 3251
614 nmdc:mga06r32_1161_c1 3300050510 Bacteria 23692
615 nmdc:mga06r32_26832_c1 3300050510 Bacteria 5375
616 nmdc:mga06r32_30813_c1 3300050510 Bacteria 5034
617 nmdc:mga06r32_619430_c1 3300050510 Bacteria 1052
618 nmdc:mga06r32_86270_c1 3300050510 Bacteria 3061
619 nmdc:mga06r32_9234_c1 3300050510 Bacteria 8889
620 nmdc:mga08y16_114651_c1 3300050511 Bacteria 2806
621 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
622 nmdc:mga08y16_211_c1 3300050511 Bacteria 52298
623 nmdc:mga08y16_314496_c1 3300050511 Bacteria 1613
624 nmdc:mga08y16_45892_c1 3300050511 Bacteria 4577
625 nmdc:mga08y16_58128_c1 3300050511 Bacteria 4041
626 nmdc:mga0n895_18707_c1 3300050512 Bacteria 6418
627 nmdc:mga0n895_2017_c1 3300050512 Bacteria 15610
628 nmdc:mga0n895_280888_c1 3300050512 Bacteria 1688
629 nmdc:mga0n895_28969_c1 3300050512 Bacteria 5275
630 nmdc:mga0n895_6480_c1 3300050512 Bacteria 9945
631 nmdc:mga0rr50_4097_c1 3300050513 Bacteria 8512
632 nmdc:mga0rr50_920_c1 3300050513 Bacteria 15930
633 nmdc:mga08x19_27339_c1 3300050514 Bacteria 3567
634 nmdc:mga08x19_27794_c1 3300050514 Bacteria 3540
635 nmdc:mga08x19_2863_c2 3300050514 Bacteria 9634
636 nmdc:mga08x19_52002_c1 3300050514 Bacteria 2633
637 nmdc:mga0a205_2056_c1 3300050515 Bacteria 17593
638 nmdc:mga0a205_232482_c1 3300050515 Bacteria 1726
639 nmdc:mga0a205_529445_c1 3300050515 Bacteria 1034
640 nmdc:mga0sz30_52169_c1 3300050516 Bacteria 1736
641 Ga0495601_0059987 3300053077 Bacteria 2413
642 Ga0495601_0129830 3300053077 Bacteria 1641
643 Ga0500643_000026 3300053087 Bacteria 259231
644 Ga0500644_0001393 3300053088 Bacteria 6442
645 Ga0500646_0037090 3300053090 Bacteria 1360
646 Ga0500651_0112879 3300053093 Bacteria 1657
647 Ga0500593_016804 3300053117 Bacteria 3174
648 Ga0500595_002256 3300053119 Bacteria 9753
649 Ga0500595_002988 3300053119 Bacteria 8040
650 Ga0500595_005355 3300053119 Bacteria 5612
651 Ga0500642_0001378 3300053130 Bacteria 6964
652 Ga0500642_0018466 3300053130 Bacteria 2698
653 Ga0500652_000921 3300053131 Bacteria 9694
654 Ga0500658_0022153 3300053134 Bacteria 2412
655 Ga0500658_0053173 3300053134 Bacteria 1661
656 Ga0500568_0000226 3300053139 Bacteria 48324
657 Ga0500568_0001775 3300053139 Bacteria 13297
658 Ga0500573_0000003 3300053140 Bacteria 355643
659 Ga0500604_0030593 3300053151 Bacteria 1575
660 Ga0500616_0000001 3300053153 Bacteria 1986011
661 Ga0500616_0093802 3300053153 Bacteria 1480
662 Ga0500616_0145455 3300053153 Bacteria 1103
663 Ga0500622_0002091 3300053156 Bacteria 14874
664 Ga0500622_0016035 3300053156 Bacteria 4007
665 Ga0500622_0043413 3300053156 Bacteria 2332
666 Ga0501084_0000320 3300054114 Bacteria 36620
667 Ga0501084_0151033 3300054114 Bacteria 1958
668 Ga0590071_023553 3300059421 Bacteria 1456
669 Ga0590075_036343 3300059424 Bacteria 1255
670 Ga0501082_0053588 3300060353 Bacteria 3476
671 Ga0501082_0058645 3300060353 Bacteria 3317
672 Ga0501082_0062378 3300060353 Bacteria 3209
673 Ga0501082_0140816 3300060353 Bacteria 2093
674 Ga0530510_0023323 3300061734 Bacteria 4409
675 2509395713 2509276022 Bacteria 6200534
676 2523107215 2522572158 Bacteria 6514390
677 2545679130 2545555834 Bacteria 8130841
678 2599104067 2597490356 Bacteria 7030811
679 2643771459 2643221550 Bacteria 4619371
680 2643836773 2643221564 Bacteria 4193379
681 2643912202 2643221580 Bacteria 3816678
682 2644026460 2643221603 Bacteria 6147767
683 2644412603 2643221674 Bacteria 3919126
684 2644729417 2643221733 Bacteria 5690728
685 2688595105 2687453392 Bacteria 6880454
686 2739309445 2738543024 Bacteria 5603683
687 2792752146 2791355123 Bacteria 8049106
688 2842340276 2842333319 Bacteria 8899485
689 2846957107 2846952575 Bacteria 6587527
690 2848863114 2848858292 Bacteria 7391279
691 2856331740 2856328259 Bacteria 6528202
692 2856336852 2856334872 Bacteria 7037011
693 2857373393 2857367948 Bacteria 6965560
694 2869169185 2869162929 Bacteria 6399702
695 2869272978 2869271264 Bacteria 6908218
696 2871455345 2871451962 Bacteria 7336357
697 2874169094 2874168670 Bacteria 8062617
698 2876404824 2876399893 Bacteria 6927900
699 2878041831 2878035449 Bacteria 6555736
700 2878787879 2878781027 Bacteria 6834456
701 2885275537 2885270888 Bacteria 9831543
702 2885314269 2885312484 Bacteria 6415165
703 2917700233 2917699015 Bacteria 7043791
704 2919173947 2919171160 Bacteria 6499771
705 2922154544 2922151315 Bacteria 6902399
706 2937843511 2937843397 Bacteria 5256375
707 2958125864 2958122699 Bacteria 7280457
708 2961140007 2961136820 Bacteria 6775228
709 2965028429 2965025482 Bacteria 6532201
710 2965038313 2965032056 Bacteria 6887443
711 2965108981 2965102966 Bacteria 6800987
712 2965119174 2965110997 Bacteria 6693150
713 2970548713 2970547951 Bacteria 6931819
714 2977958188 2977957713 Bacteria 6877875
715 2979798992 2979793036 Bacteria 6808957
716 2987679309 2987673487 Bacteria 6884027
717 3004243223 3004239961 Bacteria 6892290
718 641644780 641522639 Bacteria 7737025
719 649864889 649633066 Bacteria 6690028
720 8055226277 8055225921 Bacteria 3341787
721 JGI25406J46586_10015198
722 Ga0055526_1000351
723 Ga0055526_1000616
724 Ga0055540_1001787
725 Ga0055531_10001782
726 Ga0065712_10151782
727 Ga0065715_10027859
728 Ga0070658_10004623
729 Ga0070658_10074423
730 Ga0070658_10084592
731 Ga0070658_10172416
732 Ga0070676_10310642
733 Ga0070683_100020032
734 Ga0070670_100385781
735 Ga0068869_100062713
736 Ga0068869_100214627
737 Ga0070680_100016831
738 Ga0070680_100046413
739 Ga0070680_100417884
740 Ga0070660_100000662
741 Ga0070660_100016666
742 Ga0070689_100047940
743 Ga0070691_10025872
744 Ga0070691_10028012
745 Ga0070661_100017770
746 Ga0070668_100163645
747 Ga0070668_100353901
748 Ga0070669_100116364
749 Ga0070675_100163387
750 Ga0070671_100190391
751 Ga0070674_100094998
752 Ga0070674_100301687
753 Ga0070688_100013163
754 Ga0070667_100048996
755 Ga0070714_100005060
756 Ga0070714_100292270
757 Ga0070710_10061572
758 Ga0070705_100001612
759 Ga0070705_100031692
760 Ga0070705_100222195
761 Ga0070700_100018834
762 Ga0070700_100047868
763 Ga0070694_100002314
764 Ga0070694_100026326
765 Ga0070694_100041950
766 Ga0070708_100117687
767 Ga0070663_100041671
768 Ga0070678_100025693
769 Ga0070662_100133646
770 Ga0070681_10009772
771 Ga0070681_10228340
772 Ga0068867_100164107
773 Ga0070699_100001776
774 Ga0070699_100018725
775 Ga0070699_100143041
776 Ga0070679_100003357
777 Ga0070684_100003240
778 Ga0070697_100003270
779 Ga0070697_100034198
780 Ga0070697_100062513
781 Ga0068853_100150444
782 Ga0070672_100077983
783 Ga0070672_100238900
784 Ga0070686_100134720
785 Ga0070695_100000478
786 Ga0070695_100001540
787 Ga0070695_100007921
788 Ga0070695_100021490
789 Ga0070695_100170289
790 Ga0070695_100230841
791 Ga0070696_100000872
792 Ga0070696_100021109
793 Ga0070696_100083943
794 Ga0070693_100321950
795 Ga0070665_100000737
796 Ga0070665_100244289
797 Ga0070704_100006437
798 Ga0070704_100029072
799 Ga0068855_100007162
800 Ga0068855_100488262
801 Ga0070664_100042761
802 Ga0068857_100002495
803 Ga0068857_100046400
804 Ga0068857_100050735
805 Ga0068857_100319804
806 Ga0068854_100001185
807 Ga0068856_100012853
808 Ga0068856_100059132
809 Ga0068852_100000367
810 Ga0068859_100005145
811 Ga0068859_100353813
812 Ga0068864_100210627
813 Ga0068864_100341663
814 Ga0068866_10214259
815 Ga0068861_100007079
816 Ga0068861_100059155
817 Ga0068863_100152926
818 Ga0068860_100006129
819 Ga0068862_100006164
820 Ga0068862_100051377
821 Ga0081455_10000015
822 Ga0081455_10050275
823 Ga0081538_10025816
824 Ga0081540_1000034
825 Ga0081539_10000308
826 Ga0081539_10000522
827 Ga0081539_10027324
828 Ga0075365_10044325
829 Ga0075365_10126619
830 Ga0075368_10001099
831 Ga0075368_10024861
832 Ga0075363_100005801
833 Ga0075363_100007586
834 Ga0075364_10148450
835 Ga0075432_10014608
836 Ga0070716_100095654
837 Ga0070712_100067872
838 Ga0075362_10021662
839 Ga0075367_10012300
840 Ga0075367_10035202
841 Ga0075369_10073397
842 Ga0097621_100009732
843 Ga0097621_100028250
844 Ga0068871_100013721
845 Ga0068871_100440172
846 Ga0075428_100000800
847 Ga0075428_100001436
848 Ga0075428_100126562
849 Ga0075430_100046497
850 Ga0075430_100077220
851 Ga0075430_100137855
852 Ga0075430_100171962
853 Ga0075431_100001164
854 Ga0075431_100038116
855 Ga0075431_100129353
856 Ga0075431_100425600
857 Ga0075433_10000760
858 Ga0075434_100000159
859 Ga0075434_100001640
860 Ga0075434_100015709
861 Ga0075434_100304726
862 Ga0075429_100001322
863 Ga0075429_100035476
864 Ga0075429_100107208
865 Ga0075436_100001167
866 Ga0075436_100007018
867 Ga0075436_100018084
868 Ga0075436_100037416
869 Ga0097620_100005145
870 Ga0097620_100353819
871 Ga0075435_100000197
872 Ga0075435_100005969
873 Ga0075435_100220308
874 Ga0099795_10011497
875 Ga0105240_10000955
876 Ga0105240_10036727
877 Ga0105240_10051545
878 Ga0105240_10053106
879 Ga0105240_10270130
880 Ga0105240_10367517
881 Ga0105240_10446335
882 Ga0111539_10000123
883 Ga0111539_10000178
884 Ga0111539_10036631
885 Ga0111539_10051083
886 Ga0111539_10174922
887 Ga0111539_10248610
888 Ga0111539_10345914
889 Ga0105245_10475233
890 Ga0105245_10787717
891 Ga0114129_10000702
892 Ga0114129_10001064
893 Ga0114129_10201481
894 Ga0114129_10248345
895 Ga0114129_10301144
896 Ga0105243_10077669
897 Ga0105243_10124766
898 Ga0105241_10028352
899 Ga0105241_10272812
900 Ga0105248_10057854
901 Ga0105248_10433252
902 Ga0105237_10319047
903 Ga0105237_10368936
904 Ga0105237_10444186
905 Ga0105238_10004584
906 Ga0105238_10015970
907 Ga0105238_10498093
908 Ga0105249_10351194
909 Ga0105249_10520112
910 Ga0105246_10021336
911 Ga0105246_10080331
912 Ga0157373_10047203
913 Ga0157371_10070116
914 Ga0157370_10008718
915 Ga0157370_10080822
916 Ga0157370_10514133
917 Ga0157369_10005664
918 Ga0157369_10334682
919 Ga0157369_10452714
920 Ga0171462_1021
921 Ga0157374_10025588
922 Ga0157374_10049196
923 Ga0157374_10107501
924 Ga0163162_10202954
925 Ga0163162_10318849
926 Ga0157372_10001324
927 Ga0157372_10304639
928 Ga0157375_10396012
929 Ga0163163_10123354
930 Ga0157380_10034278
931 Ga0157380_10047122
932 Ga0182008_10013391
933 Ga0157379_10211612
934 Ga0157379_10439930
935 Ga0182006_1079362
936 Ga0182007_10016112
937 Ga0182005_1027109
938 Ga0163161_10365848
939 Ga0213872_10095289
940 Ga0213874_10013244
941 Ga0213876_10002265
942 Ga0213876_10029843
943 Ga0213876_10035830
944 Ga0213876_10042957
945 Ga0213876_10051339
946 Ga0213876_10133626
947 Ga0213875_10000182
948 Ga0213875_10002256
949 Ga0213875_10113407
950 Ga0213871_10041302
951 Ga0209233_1000013
952 Ga0209676_1002462
953 Ga0209564_1000075
954 Ga0209758_1000532
955 Ga0209051_1001617
956 Ga0209257_1002499
957 Ga0207653_10019460
958 Ga0207682_10003948
959 Ga0207692_10075663
960 Ga0207642_10129795
961 Ga0207688_10083269
962 Ga0207688_10136778
963 Ga0207647_10150064
964 Ga0207705_10007629
965 Ga0207705_10059658
966 Ga0207705_10079331
967 Ga0207705_10122348
968 Ga0207705_10219316
969 Ga0207654_10015946
970 Ga0207707_10016636
971 Ga0207707_10122628
972 Ga0207695_10003827
973 Ga0207695_10061179
974 Ga0207695_10074089
975 Ga0207695_10077586
976 Ga0207695_10080251
977 Ga0207695_10116069
978 Ga0207660_10005578
979 Ga0207660_10073718
980 Ga0207660_10340949
981 Ga0207662_10093198
982 Ga0207657_10031888
983 Ga0207657_10066994
984 Ga0207657_10067697
985 Ga0207657_10380028
986 Ga0207652_10048417
987 Ga0207681_10067767
988 Ga0207694_10002178
989 Ga0207659_10207814
990 Ga0207687_10009349
991 Ga0207687_10249828
992 Ga0207700_10060250
993 Ga0207664_10003873
994 Ga0207664_10056272
995 Ga0207664_10059394
996 Ga0207690_10008268
997 Ga0207706_10078994
998 Ga0207706_10111470
999 Ga0207706_10308336
1000 Ga0207670_10094154
1001 Ga0207669_10167893
1002 Ga0207665_10134788
1003 Ga0207691_10011683
1004 Ga0207689_10281657
1005 Ga0207661_10009105
1006 Ga0207661_10249478
1007 Ga0207679_10011161
1008 Ga0207667_10002686
1009 Ga0207667_10021873
1010 Ga0207667_10567604
1011 Ga0207712_10002182
1012 Ga0207712_10452712
1013 Ga0207668_10107821
1014 Ga0207640_10003711
1015 Ga0207640_10052823
1016 Ga0207658_10406076
1017 Ga0207677_10073846
1018 Ga0207703_10376290
1019 Ga0207678_10026173
1020 Ga0207708_10009564
1021 Ga0207708_10159028
1022 Ga0207702_10002356
1023 Ga0207702_10110662
1024 Ga0207648_10013191
1025 Ga0207676_10054713
1026 Ga0207676_10353045
1027 Ga0207674_10000046
1028 Ga0207674_10006766
1029 Ga0207674_10007163
1030 Ga0207674_10102845
1031 Ga0207674_10276745
1032 Ga0207674_10347591
1033 Ga0207675_100021306
1034 Ga0207675_100164842
1035 Ga0207683_10007852
1036 Ga0207683_10176050
1037 Ga0207698_10012681
1038 Ga0207698_10284998
1039 Ga0209813_10012162
1040 Ga0209813_10029957
1041 Ga0209974_10003916
1042 Ga0207428_10000133
1043 Ga0207428_10001362
1044 Ga0207428_10004374
1045 Ga0207428_10049279
1046 Ga0207428_10076104
1047 Ga0207428_10284626
1048 Ga0268265_10006963
1049 Ga0268264_10003433
1050 Ga0268264_10029701
1051 Ga0265318_10031098
1052 Ga0265338_10030476
1053 Ga0265330_10053873
1054 Ga0265332_10026267
1055 Ga0265325_10044584
1056 Ga0265339_10002476
1057 Ga0265327_10001259
1058 Ga0265316_10112421
1059 Ga0265313_10046216
1060 Ga0316575_10002528
1061 Ga0316575_10009463
1062 Ga0316579_10007131
1063 Ga0265314_10003737
1064 Ga0265314_10064623
1065 Ga0265314_10088718
1066 Ga0265314_10092347
1067 Ga0265342_10088331
1068 Ga0265342_10089489
1069 Ga0307413_10030146
1070 Ga0307413_10113928
1071 Ga0307410_10023500
1072 Ga0307416_100371651
1073 Ga0307414_10068121
1074 Ga0307414_10089283
1075 Ga0307414_10094157
1076 Ga0307411_10277447
1077 Ga0307415_100041798
1078 Ga0307415_100469181
1079 Ga0316583_10006742
1080 Ga0316583_10035987
1081 Ga0307510_10095303
1082 Ga0373958_0005665
1083 Ga0373938_0002348
1084 Ga0373934_0007766
1085 Ga0373940_0010240
1086 Ga0373944_0065028
1087 Ga0373932_0022664
1088 Ga0373936_0023678
1089 Ga0373939_0019374
1090 Ga0373941_0019955
1091 Ga0373953_0004204
1092 Ga0373953_0009490
1093 Ga0373954_0000006
1094 Ga0373954_0001839
1095 Ga0373954_0034337
1096 Ga0373956_0000620
1097 Ga0373956_0006420
1098 Ga0373956_0010757
1099 Ga0373957_0000829
1100 Ga0373955_0006604
1101 Ga0373955_0008260
1102 Ga0373955_0013572
1103 Ga0316574_0002222
1104 Ga0373924_0000705
1105 Ga0373924_0015403
1106 Ga0373931_0002317
1107 Ga0373935_0045796
1108 Ga0373927_0171867
1109 Ga0373933_0000456
1110 Ga0373933_0005686
1111 Ga0373933_0188161
1112 Ga0373937_0000595
1113 Ga0373937_0003151
1114 Ga0373937_0108885
1115 Ga0373937_0460160
1116 Ga0373937_0573784
1117 Ga0316582_0037515
1118 Ga0395899_0187774
1119 Ga0395900_0014754
1120 Ga0395900_0194824
1121 Ga0395898_0006367
1122 Ga0436364_0045510
1123 Ga0436364_0250341
1124 Ga0436364_1052080
1125 Ga0395901_0010336
1126 Ga0395901_0138181
1127 Ga0395901_0312843
1128 Ga0436365_0015906
1129 Ga0436365_0051821
1130 Ga0436365_0110577
1131 Ga0436365_0846967
1132 Ga0436365_0889766
1133 Ga0436365_1484879
1134 Ga0436365_1528483
1135 Ga0436365_1540042
1136 Ga0436365_1594393
1137 Ga0436360_0050123
1138 Ga0436360_1319865
1139 Ga0436360_1320262
1140 Ga0436361_0042221
1141 Ga0436361_0239500
1142 Ga0436361_0273018
1143 Ga0436361_0624631
1144 Ga0436361_1110668
1145 Ga0436363_0295539
1146 Ga0436363_1072504
1147 Ga0436363_1447910
1148 Ga0436362_0166111
1149 Ga0436362_1173555
1150 Ga0439461_0008905
1151 Ga0451793_0186697
1152 Ga0451807_0062428
1153 Ga0439435_0005504
1154 Ga0439435_0032514
1155 Ga0466966_0035846
1156 Ga0495592_0116293
1157 Ga0495603_0236603
1158 Ga0495651_0007569
1159 Ga0495651_0049868
1160 Ga0495580_0002673
1161 Ga0495580_0136471
1162 Ga0495639_0002006
1163 Ga0495639_0100416
1164 Ga0495606_0124478
1165 Ga0495608_0031414
1166 Ga0495610_0051069
1167 Ga0495628_0000587
1168 Ga0495630_0354986
1169 Ga0495643_0144283
1170 Ga0495666_0003054
1171 Ga0495640_0135364
1172 Ga0495586_0002793
1173 Ga0495598_0010367
1174 Ga0495645_0144490
1175 Ga0495622_0092493
1176 Ga0495667_0009786
1177 Ga0495625_0046386
1178 Ga0495588_0035306
1179 Ga0495657_0083554
1180 Ga0495657_0152854
1181 Ga0495599_0169826
1182 Ga0495613_0011354
1183 Ga0495624_0061452
1184 Ga0495600_0012105
1185 Ga0495600_0186169
1186 Ga0495604_0041054
1187 Ga0495604_0286539
1188 Ga0495674_0007588
1189 Ga0495672_0005660
1190 Ga0495676_0158228
1191 Ga0495675_0072127
1192 Ga0495614_0016995
1193 Ga0496100_0066955
1194 Ga0496100_0090886
1195 Ga0496100_0140037
1196 Ga0496101_0089712
1197 Ga0496101_0255440
1198 Ga0496101_0357147
1199 Ga0496102_0017362
1200 Ga0496102_0120911
1201 Ga0496104_0004885
1202 Ga0496104_0005122
1203 Ga0496104_0007059
1204 Ga0496105_0000424
1205 Ga0496105_0058990
1206 Ga0496105_0377621
1207 Ga0496106_0000194
1208 Ga0496106_0001287
1209 Ga0496106_0065697
1210 Ga0496107_0078769
1211 Ga0496107_0177140
1212 Ga0496108_0000941
1213 Ga0496108_0002701
1214 Ga0496108_0013407
1215 Ga0496109_0001304
1216 Ga0496109_0006158
1217 Ga0496109_0040221
1218 Ga0496110_0000973
1219 Ga0496110_0002897
1220 Ga0496110_0192457
1221 Ga0496110_0287451
1222 Ga0496111_0000315
1223 Ga0496111_0081837
1224 Ga0496111_0099110
1225 Ga0496112_0030772
1226 Ga0496112_0047851
1227 Ga0496112_0066973
1228 Ga0496112_0355536
1229 Ga0496113_0000218
1230 Ga0496113_0008768
1231 Ga0496114_0051806
1232 Ga0496114_0092015
1233 Ga0496115_0017305
1234 Ga0496115_0057577
1235 Ga0496115_0067327
1236 Ga0496115_0072432
1237 Ga0496115_0076294
1238 Ga0496115_0079502
1239 Ga0496115_0093335
1240 Ga0496121_0111583
1241 Ga0496121_0141065
1242 Ga0496125_0001211
1243 Ga0496126_0090925
1244 Ga0496126_0190744
1245 Ga0501032_0016516
1246 Ga0501032_0032956
1247 Ga0501032_0170982
1248 Ga0501032_0300997
1249 Ga0501033_0023584
1250 Ga0501033_0039625
1251 Ga0501033_0048422
1252 Ga0501034_0007519
1253 Ga0501034_0019149
1254 Ga0501034_0238999
1255 Ga0501034_0329874
1256 Ga0501036_0001414
1257 Ga0501036_0037139
1258 Ga0501036_0253189
1259 Ga0501037_0017570
1260 Ga0501037_0225518
1261 Ga0501038_0005163
1262 Ga0501038_0149711
1263 Ga0501039_0048191
1264 Ga0501039_0130273
1265 Ga0501039_0459352
1266 Ga0501040_0000067
1267 Ga0501040_0105449
1268 Ga0501041_0000378
1269 Ga0501041_0012012
1270 Ga0501043_0017782
1271 Ga0501043_0070277
1272 Ga0501046_0000275
1273 Ga0501046_0011492
1274 Ga0501046_0172165
1275 Ga0501047_0058937
1276 Ga0501047_0077486
1277 Ga0501047_0170038
1278 Ga0501047_0254117
1279 Ga0501047_0321144
1280 Ga0501048_0000187
1281 Ga0501048_0188956
1282 Ga0501048_0229506
1283 Ga0501067_0027255
1284 Ga0501068_0061331
1285 Ga0501068_0150404
1286 Ga0501072_0000219
1287 Ga0501072_0347072
1288 Ga0501073_0094168
1289 Ga0501073_0181453
1290 Ga0501074_0100397
1291 Ga0501074_0240418
1292 Ga0501075_0000011
1293 Ga0501076_0000116
1294 Ga0501076_0138720
1295 Ga0501077_0000804
1296 Ga0501079_0000021
1297 Ga0501080_0067856
1298 Ga0501080_0253777
1299 Ga0501080_0608408
1300 Ga0501081_0000461
1301 Ga0501081_0022742
1302 Ga0501081_0056365
1303 Ga0501035_0137554
1304 Ga0501035_0148441
1305 Ga0501044_0015257
1306 Ga0501044_0134906
1307 Ga0501044_0138288
1308 Ga0501044_0326479
1309 Ga0501045_0000083
1310 nmdc:mga03683_77987_c1
1311 nmdc:mga03n38_29688_c1
1312 nmdc:mga03n38_88137_c1
1313 nmdc:mga00v17_12612_c1
1314 nmdc:mga0yw44_131651_c1
1315 nmdc:mga0yw44_23857_c1
1316 nmdc:mga06z11_245387_c1
1317 nmdc:mga06z11_34823_c1
1318 nmdc:mga06z11_8366_c1
1319 nmdc:mga04h51_13750_c1
1320 nmdc:mga05p37_185_c1
1321 nmdc:mga05p37_226638_c2
1322 nmdc:mga05p37_638500_c1
1323 nmdc:mga05p37_70429_c1
1324 nmdc:mga05p37_748_c1
1325 nmdc:mga09592_343575_c1
1326 nmdc:mga09592_53870_c1
1327 nmdc:mga09592_57971_c1
1328 nmdc:mga0qj67_108533_c1
1329 nmdc:mga0qj67_316383_c1
1330 nmdc:mga0qj67_332128_c1
1331 nmdc:mga0qj67_40017_c1
1332 nmdc:mga0qj67_406198_c1
1333 nmdc:mga0qj67_51675_c1
1334 nmdc:mga06r32_1161_c1
1335 nmdc:mga06r32_26832_c1
1336 nmdc:mga06r32_30813_c1
1337 nmdc:mga06r32_619430_c1
1338 nmdc:mga06r32_86270_c1
1339 nmdc:mga06r32_9234_c1
1340 nmdc:mga08y16_114651_c1
1341 nmdc:mga08y16_121_c1
1342 nmdc:mga08y16_211_c1
1343 nmdc:mga08y16_314496_c1
1344 nmdc:mga08y16_45892_c1
1345 nmdc:mga08y16_58128_c1
1346 nmdc:mga0n895_18707_c1
1347 nmdc:mga0n895_2017_c1
1348 nmdc:mga0n895_280888_c1
1349 nmdc:mga0n895_28969_c1
1350 nmdc:mga0n895_6480_c1
1351 nmdc:mga0rr50_4097_c1
1352 nmdc:mga0rr50_920_c1
1353 nmdc:mga08x19_27339_c1
1354 nmdc:mga08x19_27794_c1
1355 nmdc:mga08x19_2863_c2
1356 nmdc:mga08x19_52002_c1
1357 nmdc:mga0a205_2056_c1
1358 nmdc:mga0a205_232482_c1
1359 nmdc:mga0a205_529445_c1
1360 nmdc:mga0sz30_52169_c1
1361 Ga0495601_0059987
1362 Ga0495601_0129830
1363 Ga0500643_000026
1364 Ga0500644_0001393
1365 Ga0500646_0037090
1366 Ga0500651_0112879
1367 Ga0500593_016804
1368 Ga0500595_002256
1369 Ga0500595_002988
1370 Ga0500595_005355
1371 Ga0500642_0001378
1372 Ga0500642_0018466
1373 Ga0500652_000921
1374 Ga0500658_0022153
1375 Ga0500658_0053173
1376 Ga0500568_0000226
1377 Ga0500568_0001775
1378 Ga0500573_0000003
1379 Ga0500604_0030593
1380 Ga0500616_0000001
1381 Ga0500616_0093802
1382 Ga0500616_0145455
1383 Ga0500622_0002091
1384 Ga0500622_0016035
1385 Ga0500622_0043413
1386 Ga0501084_0000320
1387 Ga0501084_0151033
1388 Ga0590071_023553
1389 Ga0590075_036343
1390 Ga0501082_0053588
1391 Ga0501082_0058645
1392 Ga0501082_0062378
1393 Ga0501082_0140816
1394 Ga0530510_0023323
1395 2509395713
1396 2523107215
1397 2545679130
1398 2599104067
1399 2643771459
1400 2643836773
1401 2643912202
1402 2644026460
1403 2644412603
1404 2644729417
1405 2688595105
1406 2739309445
1407 2792752146
1408 2842340276
1409 2846957107
1410 2848863114
1411 2856331740
1412 2856336852
1413 2857373393
1414 2869169185
1415 2869272978
1416 2871455345
1417 2874169094
1418 2876404824
1419 2878041831
1420 2878787879
1421 2885275537
1422 2885314269
1423 2917700233
1424 2919173947
1425 2922154544
1426 2937843511
1427 2958125864
1428 2961140007
1429 2965028429
1430 2965038313
1431 2965108981
1432 2965119174
1433 2970548713
1434 2977958188
1435 2979798992
1436 2987679309
1437 3004243223
1438 641644780
1439 649864889
1440 8055226277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05853

BKACE

beta-keto acid cleavage enzyme

6

304

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.985 4 312
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.9819 4 312
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.9762 1 312
3lot-assembly1.cif.gz_C crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution 0.9744 5 312
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.9731 1 312
ID Description Score Start End Superfamily
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.984 4 312 3.20.20.70
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9807 4 312 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9653 6 306 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9549 6 306 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9497 5 303 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A529ME14-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9973 26 101 GO:0043720
GO:0046872
AF-A0A7C9RF70-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9966 4 80 GO:0043720
GO:0046872
AF-A0A434EKR6-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9964 6 114 GO:0043720
GO:0046872
AF-A0A1G4UL38-F1-model_v4 deleted 0.9964 6 103
AF-A0A357CK18-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9959 18 95 GO:0043720
GO:0046872

Map