F477288

General Info

Members Datasets Scaffolds Average Seq Length
720 382 1440 386

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10144624|rootL2_101446242
Length 427
Sequence MSKTEDKDISPGMVLLLAAATGLIVANLYYAQTLVGPISQSTGLSPQAAGLIVTLTQIGYCLGLLFIVPLGDLLENRRLIVTGLLFTSAMLVLAAFSTTAWMFLTAALGIGLGSVAAQIVVPFAAHLSKEGTRGHTVGKVVSGLLLGIMLSRPVASLVADASNWHVVFGGGALIVLLVALVLRAKLPLRVPNHHMTYPKLMGSLWHLFLQTSVLRRRAAYHAGLFGSFSLFWTVTPLMLAGPLFHLSQTGIAIFALVGMAGAVASPVAGKLADAGHTLMATAAALGLGVIGFALPLIAPGSRDIALAILVLASIILDMGVAANLVLGQRAIFTLGAEVRSRLNGVYFALFFAGGALGSALGGWMYATHGWHAALLTGMAFNGAALLYWLTEYASHTTPTVIPAKAGIHTPQALKLSMDSGLRRNDVA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
38 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
39 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
56 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
72 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
73 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
74 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
75 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
171 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
172 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
173 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
174 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
175 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
176 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
177 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
178 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
179 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
180 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
181 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
182 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
183 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
184 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
185 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
186 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
187 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
188 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
189 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
190 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
191 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
192 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
193 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
194 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
195 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
196 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
197 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
198 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
199 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
200 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
201 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
202 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
203 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
204 2643221556 Massilia sp. Root1485 Isolate Unclassified
205 2643221638 Duganella sp. Root336D2 Isolate Unclassified
206 2643221645 Massilia sp. Root351 Isolate Unclassified
207 2643221664 Massilia sp. Root418 Isolate Unclassified
208 2643221684 Massilia sp. Root133 Isolate Unclassified
209 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
210 2718217882 Rhizobium sp. N741 Isolate Nodule
211 2718217927 Rhizobium sp. N324 Isolate Nodule
212 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
213 2718218009 Rhizobium sp. N561 Isolate Nodule
214 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
215 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
216 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
217 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
218 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
219 2718218363 Rhizobium sp. N113 Isolate Nodule
220 2718218365 Rhizobium sp. N731 Isolate Nodule
221 2718218366 Rhizobium sp. N621 Isolate Nodule
222 2718218423 Rhizobium sp. N941 Isolate Nodule
223 2721755514 Rhizobium sp. N6212 Isolate Nodule
224 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
225 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
226 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
227 2721755809 Rhizobium sp. N541 Isolate Nodule
228 2721755810 Rhizobium sp. N871 Isolate Nodule
229 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
230 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
231 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
232 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
233 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
234 2728369365 Rhizobium sp. N1341 Isolate Nodule
235 2728369397 Rhizobium sp. N1314 Isolate Nodule
236 2738541280 Massilia sp. GV090 Isolate Unclassified
237 2738541293 Rhizobium sp. GV031 Isolate Unclassified
238 2738541297 Duganella sp. GV083 Isolate Unclassified
239 2738541300 Massilia sp. GV016 Isolate Unclassified
240 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
241 2738541357 Duganella sp. GV053 Isolate Unclassified
242 2738543003 Duganella sp. GV066 Isolate Unclassified
243 2738543018 Massilia sp. GV045 Isolate Unclassified
244 2738543026 Duganella sp. GV089 Isolate Unclassified
245 2738543029 Duganella sp. GV039 Isolate Unclassified
246 2738543030 Massilia sp. GV097 Isolate Unclassified
247 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
248 2791355256 Rhizobium sp. M10 Isolate Nodule
249 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
250 2791355260 Rhizobium sp. L9 Isolate Nodule
251 2791355261 Rhizobium sp. J15 Isolate Nodule
252 2791355262 Rhizobium sp. M1 Isolate Nodule
253 2791355263 Rhizobium chutanense C5 Isolate Nodule
254 2791355264 Rhizobium sp. S9 Isolate Nodule
255 2791355265 Rhizobium sp. H4 Isolate Nodule
256 2791355266 Rhizobium sp. L43 Isolate Nodule
257 2791355267 Rhizobium sp. L18 Isolate Nodule
258 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
259 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
260 2802429633 Rhizobium anhuiense J3 Isolate Nodule
261 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
262 2802429637 Rhizobium anhuiense C15 Isolate Nodule
263 2818991436 Collimonas arenae 515 Isolate Unclassified
264 2821131069 Duganella sp. 1224 Isolate Unclassified
265 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
266 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
267 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
268 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
269 2838048938 Rhizobium pisi 27/80 Isolate Nodule
270 2838061910 Rhizobium phaseoli L15 Isolate Nodule
271 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
272 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
273 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
274 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
275 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
276 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
277 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
278 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
279 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
280 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
281 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
282 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
283 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
284 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
285 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
286 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
287 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
288 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
289 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
290 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
291 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
292 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
293 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
294 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
295 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
296 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
297 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
298 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
299 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
300 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
301 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
302 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
303 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
304 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
305 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
306 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
307 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
308 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
309 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
310 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
311 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
312 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
313 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
314 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
315 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
316 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
317 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
318 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
319 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
320 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
321 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
322 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
323 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
324 2842711865 Duganella sp. R-73148 Isolate Unclassified
325 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
326 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
327 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
328 2857553236 Duganella sp. R-74557 Isolate Unclassified
329 2857558681 Duganella sp. R-74565 Isolate Unclassified
330 2857564685 Duganella sp. R-74599 Isolate Unclassified
331 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
332 2904424332 Duganella sp. 1411 Isolate Rhizosphere
333 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
334 2919476304 Duganella sp. 3397 Isolate Unclassified
335 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
336 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
337 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
338 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
339 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
340 2933599457 Rhizobium phaseoli M3 Isolate Nodule
341 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
342 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
343 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
344 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
345 2936381700 Rhizobium chutanense C16 Isolate Unclassified
346 2996887358 Rhizobium sp. R711 Isolate Nodule
347 2996893221 Rhizobium sp. R635 Isolate Nodule
348 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
349 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
350 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
351 8005258706 Rhizobium sp. R693 Isolate Nodule
352 8005275841 Rhizobium sp. N4311 Isolate Nodule
353 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
354 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
355 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
356 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
357 8005321885 Rhizobium sp. R72 Isolate Nodule
358 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
359 8005382845 Rhizobium sp. R634 Isolate Nodule
360 8005395548 Rhizobium sp. R339 Isolate Nodule
361 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
362 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
363 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
364 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
365 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
366 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
367 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
368 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
369 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
370 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
371 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
372 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
373 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
374 8018176218 Rhizobium sp. N122 Isolate Nodule
375 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
376 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
377 8024501048 Rhizobium sp. H4 Isolate Nodule
378 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
379 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
380 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
381 8056382006 Rhizobium croatiense 13T Isolate Nodule
382 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.33
Metatranscriptomes 0
Isolates 31.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.39
Nodule 23.61
Rhizoplane 0.97
Rhizosphere 39.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10144624 3300003322 Bacteria 4952
2 JGI25158J39367_1000129 3300002739 Bacteria 17721
3 JGI25158J39367_1000221 3300002739 Bacteria 13394
4 JGI25158J39367_1000877 3300002739 Bacteria 5705
5 JGI25152J39213_1002299 3300002773 Bacteria 7368
6 JGI25152J39213_1002640 3300002773 Bacteria 6651
7 JGI25150J39212_1000165 3300002774 Bacteria 37364
8 JGI25150J39212_1005368 3300002774 Bacteria 2741
9 JGI25150J39212_1009032 3300002774 Bacteria 1919
10 JGI25150J39212_1011152 3300002774 Bacteria 1640
11 JGI25159J45721_1000914 3300002987 Bacteria 12835
12 JGI25159J45721_1006700 3300002987 Bacteria 3404
13 JGI25151J46595_10000329 3300003187 Bacteria 51364
14 JGI25151J46595_10001052 3300003187 Bacteria 20592
15 JGI25151J46595_10027272 3300003187 Bacteria 2292
16 JGI25153J46596_10003106 3300003215 Bacteria 9362
17 JGI25153J46596_10009303 3300003215 Bacteria 4588
18 rootL2_10021691 3300003322 Bacteria 3599
19 rootL2_10021692 3300003322 Bacteria 3691
20 rootL2_10042496 3300003322 Bacteria 3522
21 rootL2_10094471 3300003322 Bacteria 4352
22 JGI25161J50226_1000099 3300003374 Bacteria 70186
23 JGI25161J50226_1000140 3300003374 Bacteria 50175
24 JGI25161J50226_1000162 3300003374 Bacteria 46749
25 JGI25161J50226_1000840 3300003374 Bacteria 11442
26 Ga0055529_1000097 3300003763 Bacteria 132109
27 Ga0055526_1000030 3300003771 Bacteria 143833
28 Ga0055526_1000125 3300003771 Bacteria 67941
29 Ga0055526_1000163 3300003771 Bacteria 58968
30 Ga0055526_1000269 3300003771 Bacteria 43927
31 Ga0055526_1000326 3300003771 Bacteria 39597
32 Ga0055526_1000484 3300003771 Bacteria 31547
33 Ga0055526_1003173 3300003771 Bacteria 10646
34 Ga0055526_1006325 3300003771 Bacteria 6465
35 Ga0055537_1000120 3300003773 Bacteria 59665
36 Ga0055537_1000122 3300003773 Bacteria 58918
37 Ga0055537_1004192 3300003773 Bacteria 4188
38 Ga0055524_1000010 3300003775 Bacteria 282893
39 Ga0055524_1000049 3300003775 Bacteria 149383
40 Ga0055524_1003087 3300003775 Bacteria 8223
41 Ga0055524_1008650 3300003775 Bacteria 4213
42 Ga0055534_1000170 3300003784 Bacteria 48165
43 Ga0055534_1000261 3300003784 Bacteria 36634
44 Ga0055534_1004648 3300003784 Bacteria 3901
45 Ga0055528_1000042 3300003790 Bacteria 104874
46 Ga0055528_1000379 3300003790 Bacteria 36239
47 Ga0055528_1000774 3300003790 Bacteria 22251
48 Ga0055528_1013285 3300003790 Bacteria 3129
49 Ga0055530_10000057 3300003791 Bacteria 100782
50 Ga0055530_10006222 3300003791 Bacteria 5392
51 Ga0055530_10009376 3300003791 Bacteria 3770
52 Ga0055540_1000283 3300003792 Bacteria 45546
53 Ga0055540_1005136 3300003792 Bacteria 5627
54 Ga0055531_10015789 3300003794 Bacteria 3302
55 Ga0055531_10027074 3300003794 Bacteria 2023
56 Ga0055543_1000111 3300004625 Bacteria 70136
57 Ga0055543_1000128 3300004625 Bacteria 63029
58 Ga0055543_1002795 3300004625 Bacteria 5522
59 Ga0055543_1003432 3300004625 Bacteria 4683
60 Ga0065165_1000003 3300005262 Bacteria 390701
61 Ga0065165_1000351 3300005262 Bacteria 75383
62 Ga0065165_1000364 3300005262 Bacteria 74307
63 Ga0065165_1017006 3300005262 Bacteria 2698
64 Ga0070665_100157423 3300005548 Bacteria 2273
65 Ga0075365_10003176 3300006038 Bacteria 8390
66 Ga0075367_10008091 3300006178 Bacteria 5428
67 Ga0075369_10000132 3300006186 Bacteria 20799
68 Ga0075370_10012069 3300006353 Bacteria 4556
69 Ga0079104_1006300 3300006946 Bacteria 4526
70 Ga0099826_10000002 3300006948 Bacteria 1125830
71 Ga0099826_10000005 3300006948 Bacteria 465206
72 Ga0105244_10000853 3300009036 Bacteria 25698
73 Ga0105244_10001794 3300009036 Bacteria 16819
74 Ga0123342_1029639 3300009766 Bacteria 2826
75 Ga0123342_1042666 3300009766 Bacteria 1591
76 Ga0182008_10005451 3300014497 Bacteria 7243
77 Ga0182006_1000019 3300015261 Bacteria 294192
78 Ga0182006_1000102 3300015261 Bacteria 94384
79 Ga0182006_1008522 3300015261 Bacteria 4647
80 Ga0182007_10002852 3300015262 Bacteria 8413
81 Ga0182005_1000005 3300015265 Bacteria 537378
82 Ga0182005_1000006 3300015265 Bacteria 515188
83 Ga0182005_1000238 3300015265 Bacteria 35328
84 Ga0213872_10000040 3300021361 Bacteria 122419
85 Ga0213872_10000059 3300021361 Bacteria 100362
86 Ga0209436_100005 3300025208 Bacteria 151087
87 Ga0209436_100029 3300025208 Bacteria 85964
88 Ga0209436_100524 3300025208 Bacteria 16667
89 Ga0209437_108305 3300025233 Bacteria 1663
90 Ga0207425_1000024 3300025245 Bacteria 328978
91 Ga0207425_1000085 3300025245 Bacteria 95577
92 Ga0207425_1000633 3300025245 Bacteria 19975
93 Ga0207425_1001990 3300025245 Bacteria 7641
94 Ga0209646_1000049 3300025246 Bacteria 301924
95 Ga0209646_1000247 3300025246 Bacteria 54824
96 Ga0209129_1000146 3300025258 Bacteria 115180
97 Ga0209129_1000384 3300025258 Bacteria 35556
98 Ga0209129_1000656 3300025258 Bacteria 23090
99 Ga0209129_1001961 3300025258 Bacteria 10721
100 Ga0209129_1002689 3300025258 Bacteria 8365
101 Ga0209129_1004653 3300025258 Bacteria 5251
102 Ga0209565_1000009 3300025263 Bacteria 751701
103 Ga0209565_1000018 3300025263 Bacteria 460940
104 Ga0209565_1001544 3300025263 Bacteria 9891
105 Ga0209565_1006293 3300025263 Bacteria 3347
106 Ga0209455_1000031 3300025272 Bacteria 519952
107 Ga0209673_1000006 3300025273 Bacteria 650600
108 Ga0209673_1000019 3300025273 Bacteria 449094
109 Ga0209673_1000384 3300025273 Bacteria 79540
110 Ga0209673_1000977 3300025273 Bacteria 35281
111 Ga0209673_1002902 3300025273 Bacteria 10856
112 Ga0209673_1005401 3300025273 Bacteria 6439
113 Ga0209130_1000020 3300025284 Bacteria 379297
114 Ga0209130_1000036 3300025284 Bacteria 284111
115 Ga0209130_1000055 3300025284 Bacteria 211696
116 Ga0209130_1000240 3300025284 Bacteria 70293
117 Ga0209130_1001310 3300025284 Bacteria 17027
118 Ga0209130_1003245 3300025284 Bacteria 7130
119 Ga0209675_1000005 3300025291 Bacteria 849192
120 Ga0209675_1000013 3300025291 Bacteria 448220
121 Ga0209675_1000634 3300025291 Bacteria 24993
122 Ga0209675_1014380 3300025291 Bacteria 2413
123 Ga0209676_1021853 3300025292 Bacteria 2135
124 Ga0209025_1000050 3300025294 Bacteria 331531
125 Ga0209025_1000058 3300025294 Bacteria 311398
126 Ga0209025_1001479 3300025294 Bacteria 30558
127 Ga0209564_1000010 3300025295 Bacteria 885399
128 Ga0209564_1000078 3300025295 Bacteria 275766
129 Ga0209564_1000124 3300025295 Bacteria 202046
130 Ga0209564_1000240 3300025295 Bacteria 118922
131 Ga0209564_1000388 3300025295 Bacteria 79331
132 Ga0209564_1000464 3300025295 Bacteria 67994
133 Ga0209564_1000512 3300025295 Bacteria 63708
134 Ga0209564_1001530 3300025295 Bacteria 22948
135 Ga0209564_1007537 3300025295 Bacteria 5604
136 Ga0209564_1012645 3300025295 Bacteria 3659
137 Ga0209564_1022454 3300025295 Bacteria 2230
138 Ga0209758_1000083 3300025297 Bacteria 257283
139 Ga0209758_1000960 3300025297 Bacteria 38911
140 Ga0209758_1001497 3300025297 Bacteria 27181
141 Ga0209758_1003320 3300025297 Bacteria 14817
142 Ga0209758_1011348 3300025297 Bacteria 5174
143 Ga0209050_1000304 3300025298 Bacteria 100918
144 Ga0209050_1000360 3300025298 Bacteria 87458
145 Ga0209050_1001621 3300025298 Bacteria 23090
146 Ga0209050_1003737 3300025298 Bacteria 10929
147 Ga0209050_1004042 3300025298 Bacteria 10298
148 Ga0209256_1000007 3300025299 Bacteria 1136599
149 Ga0209256_1000040 3300025299 Bacteria 366839
150 Ga0209256_1000052 3300025299 Bacteria 299374
151 Ga0209256_1000070 3300025299 Bacteria 245034
152 Ga0209256_1000738 3300025299 Bacteria 42913
153 Ga0209256_1000778 3300025299 Bacteria 41213
154 Ga0209256_1003086 3300025299 Bacteria 12230
155 Ga0209256_1003337 3300025299 Bacteria 11390
156 Ga0209256_1006190 3300025299 Bacteria 6454
157 Ga0209256_1007396 3300025299 Bacteria 5429
158 Ga0209256_1016254 3300025299 Bacteria 2548
159 Ga0207426_1000008 3300025302 Bacteria 848730
160 Ga0207426_1001525 3300025302 Bacteria 18880
161 Ga0209051_1000308 3300025303 Bacteria 76477
162 Ga0209051_1003270 3300025303 Bacteria 10749
163 Ga0209257_1000853 3300025304 Bacteria 43617
164 Ga0209257_1001683 3300025304 Bacteria 24879
165 Ga0209257_1018341 3300025304 Bacteria 2698
166 Ga0207655_1006700 3300025728 Bacteria 7587
167 Ga0207655_1040622 3300025728 Bacteria 2004
168 Ga0207711_10065806 3300025941 Bacteria 3134
169 Ga0209281_1008839 3300027111 Bacteria 2409
170 Ga0209281_1011402 3300027111 Bacteria 1993
171 Ga0209282_1000001 3300027666 Bacteria 2450367
172 Ga0209282_1000003 3300027666 Bacteria 856377
173 Ga0209813_10021420 3300027866 Bacteria 1818
174 Ga0307515_10035804 3300028794 Bacteria 8057
175 Ga0316181_1068628 3300030744 Bacteria 8778
176 Ga0307408_100000022 3300031548 Bacteria 310242
177 Ga0307408_100003823 3300031548 Bacteria 10250
178 Ga0307408_100009899 3300031548 Bacteria 6281
179 Ga0307408_100019273 3300031548 Bacteria 4592
180 Ga0307408_100035811 3300031548 Bacteria 3485
181 Ga0307405_10009630 3300031731 Bacteria 4962
182 Ga0307518_10010757 3300031838 Bacteria 6536
183 Ga0307406_10013649 3300031901 Bacteria 4657
184 Ga0307412_10013523 3300031911 Bacteria 4788
185 Ga0395899_0001133 3300037312 Bacteria 23575
186 Ga0395900_0007781 3300037418 Bacteria 11056
187 Ga0395905_0001288 3300037471 Bacteria 30819
188 Ga0395905_0020053 3300037471 Bacteria 6335
189 Ga0395901_0032091 3300038443 Bacteria 5419
190 Ga0436361_0173203 3300039447 Bacteria 24297
191 Ga0436361_0993359 3300039447 Bacteria 43823
192 Ga0439465_0001522 3300041413 Bacteria 7532
193 Ga0451787_341380 3300041441 Bacteria 2662
194 Ga0451833_1382245 3300041491 Bacteria 2150
195 Ga0451839_0067884 3300041496 Bacteria 1793
196 Ga0451841_0994005 3300041498 Bacteria 1988
197 Ga0451847_0315990 3300041503 Bacteria 2228
198 Ga0451853_2236988 3300041512 Bacteria 3680
199 Ga0466967_0197284 3300045976 Bacteria 1905
200 Ga0495617_000157 3300046452 Bacteria 43264
201 Ga0495617_000223 3300046452 Bacteria 34537
202 Ga0495617_000979 3300046452 Bacteria 13256
203 Ga0495617_010003 3300046452 Bacteria 3251
204 Ga0495627_000004 3300046453 Bacteria 640612
205 Ga0495590_0000014 3300046457 Bacteria 258314
206 Ga0495638_0000064 3300046460 Bacteria 180807
207 Ga0495638_0011865 3300046460 Bacteria 5991
208 Ga0495638_0013142 3300046460 Bacteria 5651
209 Ga0495638_0029176 3300046460 Bacteria 3558
210 Ga0495638_0119192 3300046460 Bacteria 1561
211 Ga0495653_0000056 3300046463 Bacteria 100732
212 Ga0495653_0008446 3300046463 Bacteria 8442
213 Ga0495650_0000317 3300046471 Bacteria 86483
214 Ga0495650_0000328 3300046471 Bacteria 85135
215 Ga0495650_0000368 3300046471 Bacteria 78685
216 Ga0495650_0000918 3300046471 Bacteria 34577
217 Ga0495650_0001126 3300046471 Bacteria 29062
218 Ga0495650_0001529 3300046471 Bacteria 21970
219 Ga0495650_0003117 3300046471 Bacteria 12431
220 Ga0495605_0000267 3300046474 Bacteria 59550
221 Ga0495605_0000906 3300046474 Bacteria 20363
222 Ga0495584_0000026 3300046491 Bacteria 114028
223 Ga0495584_0000683 3300046491 Bacteria 22522
224 Ga0495584_0002580 3300046491 Bacteria 10216
225 Ga0495585_0000352 3300046492 Bacteria 44459
226 Ga0495585_0003835 3300046492 Bacteria 10001
227 Ga0495585_0007906 3300046492 Bacteria 6467
228 Ga0495585_0020995 3300046492 Bacteria 3750
229 Ga0495585_0051231 3300046492 Bacteria 2288
230 Ga0495596_0007147 3300046500 Bacteria 5052
231 Ga0495607_0000295 3300046501 Bacteria 52177
232 Ga0495607_0002318 3300046501 Bacteria 15610
233 Ga0495607_0002600 3300046501 Bacteria 14516
234 Ga0495607_0016919 3300046501 Bacteria 4694
235 Ga0495607_0022274 3300046501 Bacteria 3981
236 Ga0495607_0064155 3300046501 Bacteria 2075
237 Ga0495607_0065930 3300046501 Bacteria 2039
238 Ga0495607_0101034 3300046501 Bacteria 1544
239 Ga0495583_0000014 3300046506 Bacteria 320136
240 Ga0495583_0000108 3300046506 Bacteria 139791
241 Ga0495583_0000287 3300046506 Bacteria 80398
242 Ga0495583_0001630 3300046506 Bacteria 21886
243 Ga0495606_0000757 3300046507 Bacteria 49718
244 Ga0495606_0000880 3300046507 Bacteria 44927
245 Ga0495606_0000897 3300046507 Bacteria 44320
246 Ga0495606_0001004 3300046507 Bacteria 41149
247 Ga0495606_0001694 3300046507 Bacteria 28468
248 Ga0495606_0002140 3300046507 Bacteria 23813
249 Ga0495606_0002897 3300046507 Bacteria 18948
250 Ga0495606_0004118 3300046507 Bacteria 14766
251 Ga0495606_0004694 3300046507 Bacteria 13491
252 Ga0495606_0006620 3300046507 Bacteria 10630
253 Ga0495606_0036949 3300046507 Bacteria 3321
254 Ga0495606_0039895 3300046507 Bacteria 3158
255 Ga0495610_0000027 3300046512 Bacteria 275273
256 Ga0495610_0001253 3300046512 Bacteria 22804
257 Ga0495610_0001490 3300046512 Bacteria 20605
258 Ga0495610_0011927 3300046512 Bacteria 5272
259 Ga0495610_0026583 3300046512 Bacteria 3088
260 Ga0495610_0036071 3300046512 Bacteria 2531
261 Ga0495616_0002237 3300046513 Bacteria 12947
262 Ga0495616_0005272 3300046513 Bacteria 7975
263 Ga0495616_0005336 3300046513 Bacteria 7927
264 Ga0495620_0033526 3300046515 Bacteria 2330
265 Ga0495631_0018007 3300046518 Bacteria 3333
266 Ga0495637_0000240 3300046520 Bacteria 42746
267 Ga0495637_0000634 3300046520 Bacteria 24740
268 Ga0495643_0000108 3300046522 Bacteria 136032
269 Ga0495643_0000153 3300046522 Bacteria 112514
270 Ga0495643_0000471 3300046522 Bacteria 51325
271 Ga0495643_0003818 3300046522 Bacteria 10865
272 Ga0495643_0017752 3300046522 Bacteria 4152
273 Ga0495643_0027141 3300046522 Bacteria 3222
274 Ga0495643_0103953 3300046522 Bacteria 1452
275 Ga0495644_0000244 3300046523 Bacteria 25588
276 Ga0495644_0000399 3300046523 Bacteria 19433
277 Ga0495644_0022630 3300046523 Bacteria 2395
278 Ga0495644_0053451 3300046523 Bacteria 1517
279 Ga0495648_0000006 3300046524 Bacteria 361208
280 Ga0495648_0001600 3300046524 Bacteria 22041
281 Ga0495648_0003425 3300046524 Bacteria 13939
282 Ga0495648_0004553 3300046524 Bacteria 11811
283 Ga0495648_0005550 3300046524 Bacteria 10464
284 Ga0495648_0006664 3300046524 Bacteria 9354
285 Ga0495648_0012448 3300046524 Bacteria 6347
286 Ga0495648_0015110 3300046524 Bacteria 5621
287 Ga0495642_0000740 3300046528 Bacteria 16183
288 Ga0495642_0000946 3300046528 Bacteria 13585
289 Ga0495652_0003647 3300046529 Bacteria 15080
290 Ga0495654_0000131 3300046530 Bacteria 80339
291 Ga0495654_0001470 3300046530 Bacteria 16128
292 Ga0495609_0000207 3300046538 Bacteria 58652
293 Ga0495609_0000464 3300046538 Bacteria 32813
294 Ga0495609_0000876 3300046538 Bacteria 22076
295 Ga0495609_0000944 3300046538 Bacteria 21046
296 Ga0495609_0005406 3300046538 Bacteria 6722
297 Ga0495609_0009785 3300046538 Bacteria 4624
298 Ga0495597_0000043 3300046542 Bacteria 106919
299 Ga0495597_0000648 3300046542 Bacteria 28260
300 Ga0495597_0001867 3300046542 Bacteria 14395
301 Ga0495597_0006327 3300046542 Bacteria 6134
302 Ga0495597_0014350 3300046542 Bacteria 3774
303 Ga0495597_0020464 3300046542 Bacteria 3081
304 Ga0495622_0000061 3300046557 Bacteria 96048
305 Ga0495622_0000155 3300046557 Bacteria 58297
306 Ga0495622_0000208 3300046557 Bacteria 46373
307 Ga0495622_0049391 3300046557 Bacteria 1953
308 Ga0495633_0000132 3300046558 Bacteria 100231
309 Ga0495633_0000469 3300046558 Bacteria 41254
310 Ga0495633_0000535 3300046558 Bacteria 37893
311 Ga0495633_0000693 3300046558 Bacteria 30805
312 Ga0495633_0002795 3300046558 Bacteria 12067
313 Ga0495633_0004214 3300046558 Bacteria 9212
314 Ga0495633_0005638 3300046558 Bacteria 7590
315 Ga0495633_0012668 3300046558 Bacteria 4474
316 Ga0495633_0017351 3300046558 Bacteria 3683
317 Ga0495633_0084719 3300046558 Bacteria 1474
318 Ga0495656_0013284 3300046615 Bacteria 3060
319 Ga0495668_0000046 3300046616 Bacteria 224203
320 Ga0495668_0000063 3300046616 Bacteria 184563
321 Ga0495668_0000209 3300046616 Bacteria 84817
322 Ga0495668_0000911 3300046616 Bacteria 33089
323 Ga0495668_0001057 3300046616 Bacteria 29161
324 Ga0495668_0016872 3300046616 Bacteria 4241
325 Ga0495611_0001871 3300046648 Bacteria 10034
326 Ga0495611_0002677 3300046648 Bacteria 8036
327 Ga0495611_0007893 3300046648 Bacteria 4517
328 Ga0495611_0013478 3300046648 Bacteria 3481
329 Ga0495625_0000780 3300046660 Bacteria 44247
330 Ga0495625_0001523 3300046660 Bacteria 27723
331 Ga0495625_0002153 3300046660 Bacteria 21908
332 Ga0495625_0004626 3300046660 Bacteria 12933
333 Ga0495625_0005455 3300046660 Bacteria 11593
334 Ga0495625_0010304 3300046660 Bacteria 7749
335 Ga0495625_0035514 3300046660 Bacteria 3673
336 Ga0495625_0058504 3300046660 Bacteria 2739
337 Ga0495625_0074345 3300046660 Bacteria 2380
338 Ga0495625_0113987 3300046660 Bacteria 1845
339 Ga0495625_0117376 3300046660 Bacteria 1814
340 Ga0495659_0000043 3300046664 Bacteria 56421
341 Ga0495659_0000398 3300046664 Bacteria 16654
342 Ga0495659_0002842 3300046664 Bacteria 5560
343 Ga0495659_0003193 3300046664 Bacteria 5249
344 Ga0495661_0002960 3300046665 Bacteria 12825
345 Ga0495661_0016467 3300046665 Bacteria 4900
346 Ga0495661_0018493 3300046665 Bacteria 4582
347 Ga0495661_0083396 3300046665 Bacteria 1837
348 Ga0495588_0000062 3300046674 Bacteria 253674
349 Ga0495646_0081763 3300046680 Bacteria 1881
350 Ga0495669_0000224 3300046684 Bacteria 33850
351 Ga0495669_0021410 3300046684 Bacteria 2805
352 Ga0495670_0000177 3300046691 Bacteria 28439
353 Ga0495670_0000447 3300046691 Bacteria 19759
354 Ga0495670_0010900 3300046691 Bacteria 4466
355 Ga0495670_0018740 3300046691 Bacteria 3409
356 Ga0495670_0042648 3300046691 Bacteria 2264
357 Ga0495671_0000106 3300046692 Bacteria 74947
358 Ga0495671_0000251 3300046692 Bacteria 46068
359 Ga0495671_0001329 3300046692 Bacteria 16769
360 Ga0495671_0028514 3300046692 Bacteria 2874
361 Ga0495671_0053799 3300046692 Bacteria 1997
362 Ga0495649_0007163 3300046694 Bacteria 6848
363 Ga0495649_0039513 3300046694 Bacteria 2587
364 Ga0495589_0003437 3300046794 Bacteria 8571
365 Ga0495589_0011802 3300046794 Bacteria 4533
366 Ga0495589_0059732 3300046794 Bacteria 1873
367 Ga0495600_0048506 3300046809 Bacteria 2770
368 Ga0495660_0000057 3300046810 Bacteria 133310
369 Ga0495660_0000791 3300046810 Bacteria 23702
370 Ga0495660_0001583 3300046810 Bacteria 15284
371 Ga0495660_0002052 3300046810 Bacteria 13103
372 Ga0495660_0009640 3300046810 Bacteria 5630
373 Ga0495636_0000858 3300047318 Bacteria 11238
374 Ga0495636_0010416 3300047318 Bacteria 3671
375 Ga0495672_0000023 3300047320 Bacteria 419080
376 Ga0495672_0000161 3300047320 Bacteria 96964
377 Ga0495672_0000399 3300047320 Bacteria 52911
378 Ga0495672_0003147 3300047320 Bacteria 14368
379 Ga0495672_0028406 3300047320 Bacteria 3540
380 Ga0495672_0033209 3300047320 Bacteria 3199
381 Ga0495683_0002452 3300047323 Bacteria 11206
382 Ga0495683_0009295 3300047323 Bacteria 5237
383 Ga0495683_0021122 3300047323 Bacteria 3355
384 Ga0495687_000036 3300047443 Bacteria 255427
385 Ga0495687_000740 3300047443 Bacteria 35582
386 Ga0495687_000904 3300047443 Bacteria 31028
387 Ga0495687_004099 3300047443 Bacteria 10080
388 Ga0495687_004228 3300047443 Bacteria 9843
389 Ga0495687_021336 3300047443 Bacteria 3135
390 Ga0495677_0001180 3300047445 Bacteria 10461
391 Ga0495677_0001797 3300047445 Bacteria 8588
392 Ga0495677_0004812 3300047445 Bacteria 5146
393 Ga0495677_0005292 3300047445 Bacteria 4898
394 Ga0495677_0020255 3300047445 Bacteria 2411
395 Ga0495677_0022924 3300047445 Bacteria 2266
396 Ga0495679_003595 3300047446 Bacteria 7402
397 Ga0495679_018385 3300047446 Bacteria 2482
398 Ga0495685_000020 3300047447 Bacteria 73280
399 Ga0495685_000168 3300047447 Bacteria 22027
400 Ga0495685_011249 3300047447 Bacteria 3015
401 Ga0495673_0000008 3300047469 Bacteria 752462
402 Ga0495673_0000009 3300047469 Bacteria 731993
403 Ga0495673_0000185 3300047469 Bacteria 100703
404 Ga0495673_0008065 3300047469 Bacteria 5967
405 Ga0495673_0066843 3300047469 Bacteria 1523
406 Ga0495681_0004313 3300047470 Bacteria 9731
407 Ga0495681_0006959 3300047470 Bacteria 7327
408 Ga0495681_0017431 3300047470 Bacteria 3987
409 Ga0495686_0000830 3300047472 Bacteria 39724
410 Ga0495686_0001620 3300047472 Bacteria 23577
411 Ga0495686_0016979 3300047472 Bacteria 4915
412 Ga0495686_0048047 3300047472 Bacteria 2692
413 Ga0495686_0067393 3300047472 Bacteria 2209
414 Ga0495626_0000017 3300048091 Bacteria 231648
415 Ga0495626_0002878 3300048091 Bacteria 11475
416 Ga0496102_0105349 3300048905 Bacteria 2623
417 Ga0496103_0003227 3300048906 Bacteria 10008
418 Ga0496103_0006047 3300048906 Bacteria 7232
419 Ga0496103_0107024 3300048906 Bacteria 1774
420 Ga0496105_0159422 3300048908 Bacteria 1852
421 Ga0496116_0002238 3300048919 Bacteria 20578
422 Ga0496116_0014414 3300048919 Bacteria 6314
423 Ga0496116_0024138 3300048919 Bacteria 4504
424 Ga0496116_0030817 3300048919 Bacteria 3848
425 Ga0496116_0033083 3300048919 Bacteria 3674
426 Ga0496117_0006678 3300048920 Bacteria 11554
427 Ga0496117_0021190 3300048920 Bacteria 5269
428 Ga0496118_0006625 3300048921 Bacteria 12647
429 Ga0496118_0016280 3300048921 Bacteria 6828
430 Ga0496118_0033179 3300048921 Bacteria 4241
431 Ga0496119_0013948 3300048922 Bacteria 6339
432 Ga0496119_0019374 3300048922 Bacteria 5015
433 Ga0496120_0005731 3300048923 Bacteria 9782
434 Ga0496120_0032669 3300048923 Bacteria 3135
435 Ga0496121_0018620 3300048924 Bacteria 6992
436 Ga0496121_0018883 3300048924 Bacteria 6920
437 Ga0496121_0022429 3300048924 Bacteria 6128
438 Ga0496121_0024515 3300048924 Bacteria 5765
439 Ga0496122_0016168 3300048925 Bacteria 7086
440 Ga0496122_0017792 3300048925 Bacteria 6610
441 Ga0496122_0030204 3300048925 Bacteria 4549
442 Ga0496122_0031324 3300048925 Bacteria 4429
443 Ga0496122_0037458 3300048925 Bacteria 3903
444 Ga0496122_0037962 3300048925 Bacteria 3867
445 Ga0496122_0048896 3300048925 Bacteria 3247
446 Ga0496123_0001273 3300048926 Bacteria 36130
447 Ga0496123_0007309 3300048926 Bacteria 10471
448 Ga0496123_0017919 3300048926 Bacteria 5669
449 Ga0496123_0026440 3300048926 Bacteria 4346
450 Ga0496124_0018466 3300048927 Bacteria 6529
451 Ga0496124_0020362 3300048927 Bacteria 6133
452 Ga0496124_0031055 3300048927 Bacteria 4732
453 Ga0496124_0271332 3300048927 Bacteria 1242
454 Ga0496125_0007334 3300048928 Bacteria 11742
455 Ga0496125_0015030 3300048928 Bacteria 7517
456 Ga0496125_0110981 3300048928 Bacteria 1986
457 Ga0496126_0021335 3300048929 Bacteria 6326
458 Ga0496126_0130562 3300048929 Bacteria 2171
459 Ga0495678_000001 3300049459 Bacteria 1060340
460 Ga0495678_000149 3300049459 Bacteria 84717
461 Ga0495678_000297 3300049459 Bacteria 54532
462 Ga0495678_003375 3300049459 Bacteria 9937
463 Ga0495678_003562 3300049459 Bacteria 9543
464 Ga0495678_007024 3300049459 Bacteria 5901
465 Ga0495682_0000013 3300049460 Bacteria 259670
466 Ga0495682_0000016 3300049460 Bacteria 233668
467 Ga0495682_0004213 3300049460 Bacteria 6222
468 Ga0495682_0004216 3300049460 Bacteria 6218
469 Ga0501032_0086844 3300049569 Bacteria 2078
470 Ga0501034_0117427 3300049571 Bacteria 2648
471 Ga0501036_0076671 3300049572 Bacteria 2828
472 Ga0501037_0080904 3300049573 Bacteria 2356
473 Ga0501043_0012696 3300049579 Bacteria 6588
474 Ga0501047_0173272 3300049581 Bacteria 2026
475 Ga0501073_0061685 3300049589 Bacteria 2616
476 Ga0501080_0049516 3300049742 Bacteria 3911
477 Ga0501083_0090339 3300049744 Bacteria 2023
478 Ga0501269_000353 3300049766 Bacteria 11518
479 nmdc:mga07m45_94237_c1 3300050496 Bacteria 1717
480 nmdc:mga0sz30_23305_c1 3300050516 Bacteria 2517
481 Ga0500569_023506 3300053109 Bacteria 1657
482 Ga0500595_000960 3300053119 Bacteria 16254
483 Ga0500618_000103 3300053125 Bacteria 69422
484 Ga0500658_0000529 3300053134 Bacteria 16130
485 Ga0500658_0027527 3300053134 Bacteria 2199
486 Ga0500568_0002595 3300053139 Bacteria 10505
487 Ga0500586_000093 3300053145 Bacteria 15423
488 Ga0500586_000535 3300053145 Bacteria 7638
489 Ga0500616_0003835 3300053153 Bacteria 11123
490 Ga0500619_000510 3300053154 Bacteria 6732
491 Ga0500622_0000899 3300053156 Bacteria 25323
492 Ga0501082_0039279 3300060353 Bacteria 4083
493 2509392155 2509276021 Bacteria 7634384
494 2509445798 2509276033 Bacteria 7180565
495 2509446900 2509276033 Bacteria 7180565
496 2510133854 2510065019 Bacteria 6903379
497 2510895274 2510461076 Bacteria 8618824
498 2512037795 2511231221 Bacteria 6846400
499 2513573671 2513237084 Bacteria 7231967
500 2513576845 2513237085 Bacteria 7695351
501 2513629500 2513237093 Bacteria 7545552
502 2513708148 2513237103 Bacteria 7647401
503 2513909202 2513237144 Bacteria 7530820
504 2513925471 2513237146 Bacteria 7166346
505 2514020107 2513237162 Bacteria 7468464
506 2515112899 2515075009 Bacteria 7288508
507 2515636423 2515154113 Bacteria 7807172
508 2515640861 2515154114 Bacteria 7848616
509 2515655455 2515154116 Bacteria 7552979
510 2515739384 2515154134 Bacteria 7220242
511 2517036601 2516653077 Bacteria 7555578
512 2517076964 2516653085 Bacteria 7346596
513 2517095732 2517093000 Bacteria 7412387
514 2517407301 2517287029 Bacteria 6905599
515 2530646054 2529292951 Bacteria 6916614
516 2535516784 2534681796 Bacteria 7146037
517 2585200521 2582581294 Bacteria 6626667
518 2585222731 2582581298 Bacteria 7315509
519 2585254998 2582581304 Bacteria 5831370
520 2585527344 2585427526 Bacteria 7258840
521 2585545314 2585427529 Bacteria 7395659
522 2585822827 2585427590 Bacteria 6824633
523 2585843083 2585427594 Bacteria 6180594
524 2599417386 2599185170 Bacteria 7295545
525 2601667956 2600255292 Bacteria 6300551
526 2616293455 2615840624 Bacteria 6557588
527 2643786889 2643221554 Bacteria 6603920
528 2643798779 2643221556 Bacteria 7251154
529 2644212638 2643221638 Bacteria 6579467
530 2644250113 2643221645 Bacteria 7207331
531 2644360019 2643221664 Bacteria 7272945
532 2644471126 2643221684 Bacteria 7145183
533 2671692584 2671180139 Bacteria 4196045
534 2719181716 2718217882 Bacteria 6556348
535 2719386238 2718217927 Bacteria 6972593
536 2719666059 2718217997 Bacteria 6740740
537 2719732380 2718218009 Bacteria 6478651
538 2720492479 2718218199 Bacteria 6740745
539 2720613917 2718218232 Bacteria 6720332
540 2720620721 2718218233 Bacteria 6662049
541 2720632044 2718218235 Bacteria 6630699
542 2720775772 2718218269 Bacteria 6906114
543 2721147807 2718218363 Bacteria 6524337
544 2721159256 2718218365 Bacteria 6274507
545 2721164643 2718218366 Bacteria 6425255
546 2721400020 2718218423 Bacteria 6438183
547 2722840813 2721755514 Bacteria 6424414
548 2723027379 2721755556 Bacteria 6745503
549 2723560998 2721755684 Bacteria 6859907
550 2723567591 2721755685 Bacteria 6704835
551 2724038833 2721755809 Bacteria 6438790
552 2724045136 2721755810 Bacteria 6479005
553 2724090379 2721755819 Bacteria 6906405
554 2724104856 2721755822 Bacteria 6726041
555 2724110661 2721755823 Bacteria 6752556
556 2725952660 2724679232 Bacteria 7646494
557 2730108315 2728369352 Bacteria 6745171
558 2730164951 2728369365 Bacteria 6555560
559 2730298888 2728369397 Bacteria 6274511
560 2738737544 2738541280 Bacteria 6630198
561 2738742847 2738541280 Bacteria 6630198
562 2738799994 2738541293 Bacteria 7065685
563 2738826668 2738541297 Bacteria 6549566
564 2738841736 2738541300 Bacteria 6675882
565 2738846829 2738541300 Bacteria 6675882
566 2739032743 2738541333 Bacteria 7106503
567 2739150465 2738541357 Bacteria 6549408
568 2739151154 2738541357 Bacteria 6549408
569 2739192384 2738543003 Bacteria 6549560
570 2739193073 2738543003 Bacteria 6549560
571 2739272608 2738543018 Bacteria 6718814
572 2739277717 2738543018 Bacteria 6718814
573 2739318861 2738543026 Bacteria 6549408
574 2739319550 2738543026 Bacteria 6549408
575 2739337102 2738543029 Bacteria 6549249
576 2739337791 2738543029 Bacteria 6549249
577 2739341652 2738543030 Bacteria 6719714
578 2739346760 2738543030 Bacteria 6719714
579 2766065767 2765235942 Bacteria 7445910
580 2793294532 2791355256 Bacteria 6798008
581 2793314634 2791355259 Bacteria 7254731
582 2793320460 2791355260 Bacteria 6598818
583 2793330536 2791355261 Bacteria 6661293
584 2793336815 2791355262 Bacteria 6774204
585 2793339106 2791355263 Bacteria 6872478
586 2793348790 2791355264 Bacteria 6429314
587 2793351928 2791355265 Bacteria 6539969
588 2793363601 2791355266 Bacteria 7116587
589 2793370273 2791355267 Bacteria 7222458
590 2805931398 2802429605 Bacteria 6875453
591 2805937405 2802429606 Bacteria 6346811
592 2806043723 2802429633 Bacteria 7341974
593 2806064544 2802429636 Bacteria 7597525
594 2806071811 2802429637 Bacteria 7067217
595 2819541712 2818991436 Bacteria 5376622
596 2821134715 2821131069 Bacteria 6108407
597 2821135385 2821131069 Bacteria 6108407
598 2838017750 2838016132 Bacteria 6577831
599 2838028377 2838022645 Bacteria 6494267
600 2838038410 2838035591 Bacteria 7166484
601 2838043870 2838042994 Bacteria 6046894
602 2838051958 2838048938 Bacteria 6044578
603 2838067425 2838061910 Bacteria 6794874
604 2838070243 2838068647 Bacteria 6208656
605 2838661680 2838661181 Bacteria 7385261
606 2838670263 2838668709 Bacteria 6671819
607 2838681708 2838680041 Bacteria 6545511
608 2838687155 2838686498 Bacteria 7807632
609 2838696280 2838694306 Bacteria 6853137
610 2838702634 2838701080 Bacteria 6669771
611 2838710481 2838707686 Bacteria 6619912
612 2838729873 2838729681 Bacteria 7400765
613 2838743112 2838742623 Bacteria 7396178
614 2841852598 2841851746 Bacteria 7532261
615 2841869895 2841864319 Bacteria 6742987
616 2842078655 2842077413 Bacteria 6508645
617 2842114880 2842110456 Bacteria 7656360
618 2842118836 2842118031 Bacteria 7033875
619 2842148108 2842146304 Bacteria 5957337
620 2842157942 2842156927 Bacteria 6894975
621 2842167508 2842163707 Bacteria 6916235
622 2842181561 2842180545 Bacteria 6888678
623 2842198563 2842192696 Bacteria 6147454
624 2842204492 2842198810 Bacteria 6608673
625 2842205575 2842205361 Bacteria 6340321
626 2842217832 2842217011 Bacteria 7497767
627 2842230388 2842229732 Bacteria 7475766
628 2842239893 2842237096 Bacteria 6620661
629 2842244290 2842243621 Bacteria 7421798
630 2842253174 2842250916 Bacteria 6579627
631 2842257624 2842257432 Bacteria 7401195
632 2842266167 2842264693 Bacteria 6472963
633 2842271307 2842271015 Bacteria 7807131
634 2842279032 2842278818 Bacteria 6340002
635 2842285696 2842285085 Bacteria 6011953
636 2842292317 2842291075 Bacteria 7076806
637 2842304938 2842304105 Bacteria 7023636
638 2842315010 2842311132 Bacteria 6616990
639 2842320612 2842317721 Bacteria 6793725
640 2842346359 2842341865 Bacteria 7003929
641 2842369062 2842363717 Bacteria 6844742
642 2842372275 2842370503 Bacteria 7038661
643 2842378714 2842377471 Bacteria 7140707
644 2842385346 2842384541 Bacteria 7057858
645 2842399980 2842395702 Bacteria 6780583
646 2842403055 2842402390 Bacteria 6681310
647 2842409572 2842409023 Bacteria 6687331
648 2842416224 2842415677 Bacteria 6596907
649 2842423857 2842422224 Bacteria 6239196
650 2842430630 2842428310 Bacteria 6767288
651 2842437383 2842434925 Bacteria 6502746
652 2842443753 2842441272 Bacteria 6769273
653 2842453121 2842447887 Bacteria 6754142
654 2842464773 2842462802 Bacteria 6588055
655 2842472001 2842469257 Bacteria 6752936
656 2842496924 2842495871 Bacteria 6820686
657 2842715259 2842711865 Bacteria 7155354
658 2842717441 2842711865 Bacteria 7155354
659 2844458521 2844454524 Bacteria 7952546
660 2857517538 2857516855 Bacteria 7787325
661 2857550007 2857547612 Bacteria 6179999
662 2857556383 2857553236 Bacteria 6166726
663 2857557935 2857553236 Bacteria 6166726
664 2857562103 2857558681 Bacteria 6617694
665 2857564074 2857558681 Bacteria 6617694
666 2857567890 2857564685 Bacteria 6290584
667 2857569037 2857564685 Bacteria 6290584
668 2885081642 2885080285 Bacteria 6355622
669 2904427850 2904424332 Bacteria 7633521
670 2919106616 2919100787 Bacteria 7710546
671 2919476853 2919476304 Bacteria 5888696
672 2919479551 2919476304 Bacteria 5888696
673 2932411657 2932410948 Bacteria 6312192
674 2932418776 2932416698 Bacteria 6315112
675 2933017490 2933016740 Bacteria 6355406
676 2933570746 2933570622 Bacteria 7023390
677 2933591252 2933586486 Bacteria 7667493
678 2933601049 2933599457 Bacteria 5858799
679 2935900714 2935894831 Bacteria 6620579
680 2935902058 2935901341 Bacteria 7341747
681 2936372144 2936367885 Bacteria 7324495
682 2936381052 2936375103 Bacteria 6652732
683 2936382991 2936381700 Bacteria 7006523
684 2996889125 2996887358 Bacteria 5795980
685 2996896453 2996893221 Bacteria 5823108
686 3005414716 3005409236 Bacteria 7188837
687 3005448341 3005445848 Bacteria 6906074
688 639649093 639633055 Bacteria 7751309
689 8005262278 8005258706 Bacteria 6184835
690 8005281029 8005275841 Bacteria 6929066
691 8005283359 8005282627 Bacteria 6675747
692 8005293540 8005289223 Bacteria 6634003
693 8005303024 8005301065 Bacteria 6614431
694 8005312731 8005307578 Bacteria 7395396
695 8005323652 8005321885 Bacteria 5795980
696 8005380826 8005376324 Bacteria 6590079
697 8005385304 8005382845 Bacteria 6732062
698 8005396222 8005395548 Bacteria 6806915
699 8005435055 8005430974 Bacteria 6689030
700 8005463576 8005460587 Bacteria 7157962
701 8005545510 8005542996 Bacteria 7077758
702 8005557116 8005556819 Bacteria 6908598
703 8005567888 8005563573 Bacteria 7153261
704 8005573565 8005570704 Bacteria 6957481
705 8005622170 8005619151 Bacteria 7030230
706 8005632353 8005626139 Bacteria 6534237
707 8005659122 8005658619 Bacteria 4500593
708 8005692206 8005688590 Bacteria 6610080
709 8005697299 8005695170 Bacteria 6912330
710 8018133995 8018127388 Bacteria 7351159
711 8018166195 8018163183 Bacteria 7277977
712 8018181422 8018176218 Bacteria 6896178
713 8023683270 8023680758 Bacteria 7729763
714 8024482968 8024479707 Bacteria 6954785
715 8024504260 8024501048 Bacteria 6427847
716 8047678335 8047673197 Bacteria 7395230
717 8054007057 8054002106 Bacteria 7987183
718 8056378428 8056375014 Bacteria 7006639
719 8056386626 8056382006 Bacteria 6408074
720 8057877342 8057874678 Bacteria 7494653
721 rootL2_10144624
722 JGI25158J39367_1000129
723 JGI25158J39367_1000221
724 JGI25158J39367_1000877
725 JGI25152J39213_1002299
726 JGI25152J39213_1002640
727 JGI25150J39212_1000165
728 JGI25150J39212_1005368
729 JGI25150J39212_1009032
730 JGI25150J39212_1011152
731 JGI25159J45721_1000914
732 JGI25159J45721_1006700
733 JGI25151J46595_10000329
734 JGI25151J46595_10001052
735 JGI25151J46595_10027272
736 JGI25153J46596_10003106
737 JGI25153J46596_10009303
738 rootL2_10021691
739 rootL2_10021692
740 rootL2_10042496
741 rootL2_10094471
742 JGI25161J50226_1000099
743 JGI25161J50226_1000140
744 JGI25161J50226_1000162
745 JGI25161J50226_1000840
746 Ga0055529_1000097
747 Ga0055526_1000030
748 Ga0055526_1000125
749 Ga0055526_1000163
750 Ga0055526_1000269
751 Ga0055526_1000326
752 Ga0055526_1000484
753 Ga0055526_1003173
754 Ga0055526_1006325
755 Ga0055537_1000120
756 Ga0055537_1000122
757 Ga0055537_1004192
758 Ga0055524_1000010
759 Ga0055524_1000049
760 Ga0055524_1003087
761 Ga0055524_1008650
762 Ga0055534_1000170
763 Ga0055534_1000261
764 Ga0055534_1004648
765 Ga0055528_1000042
766 Ga0055528_1000379
767 Ga0055528_1000774
768 Ga0055528_1013285
769 Ga0055530_10000057
770 Ga0055530_10006222
771 Ga0055530_10009376
772 Ga0055540_1000283
773 Ga0055540_1005136
774 Ga0055531_10015789
775 Ga0055531_10027074
776 Ga0055543_1000111
777 Ga0055543_1000128
778 Ga0055543_1002795
779 Ga0055543_1003432
780 Ga0065165_1000003
781 Ga0065165_1000351
782 Ga0065165_1000364
783 Ga0065165_1017006
784 Ga0070665_100157423
785 Ga0075365_10003176
786 Ga0075367_10008091
787 Ga0075369_10000132
788 Ga0075370_10012069
789 Ga0079104_1006300
790 Ga0099826_10000002
791 Ga0099826_10000005
792 Ga0105244_10000853
793 Ga0105244_10001794
794 Ga0123342_1029639
795 Ga0123342_1042666
796 Ga0182008_10005451
797 Ga0182006_1000019
798 Ga0182006_1000102
799 Ga0182006_1008522
800 Ga0182007_10002852
801 Ga0182005_1000005
802 Ga0182005_1000006
803 Ga0182005_1000238
804 Ga0213872_10000040
805 Ga0213872_10000059
806 Ga0209436_100005
807 Ga0209436_100029
808 Ga0209436_100524
809 Ga0209437_108305
810 Ga0207425_1000024
811 Ga0207425_1000085
812 Ga0207425_1000633
813 Ga0207425_1001990
814 Ga0209646_1000049
815 Ga0209646_1000247
816 Ga0209129_1000146
817 Ga0209129_1000384
818 Ga0209129_1000656
819 Ga0209129_1001961
820 Ga0209129_1002689
821 Ga0209129_1004653
822 Ga0209565_1000009
823 Ga0209565_1000018
824 Ga0209565_1001544
825 Ga0209565_1006293
826 Ga0209455_1000031
827 Ga0209673_1000006
828 Ga0209673_1000019
829 Ga0209673_1000384
830 Ga0209673_1000977
831 Ga0209673_1002902
832 Ga0209673_1005401
833 Ga0209130_1000020
834 Ga0209130_1000036
835 Ga0209130_1000055
836 Ga0209130_1000240
837 Ga0209130_1001310
838 Ga0209130_1003245
839 Ga0209675_1000005
840 Ga0209675_1000013
841 Ga0209675_1000634
842 Ga0209675_1014380
843 Ga0209676_1021853
844 Ga0209025_1000050
845 Ga0209025_1000058
846 Ga0209025_1001479
847 Ga0209564_1000010
848 Ga0209564_1000078
849 Ga0209564_1000124
850 Ga0209564_1000240
851 Ga0209564_1000388
852 Ga0209564_1000464
853 Ga0209564_1000512
854 Ga0209564_1001530
855 Ga0209564_1007537
856 Ga0209564_1012645
857 Ga0209564_1022454
858 Ga0209758_1000083
859 Ga0209758_1000960
860 Ga0209758_1001497
861 Ga0209758_1003320
862 Ga0209758_1011348
863 Ga0209050_1000304
864 Ga0209050_1000360
865 Ga0209050_1001621
866 Ga0209050_1003737
867 Ga0209050_1004042
868 Ga0209256_1000007
869 Ga0209256_1000040
870 Ga0209256_1000052
871 Ga0209256_1000070
872 Ga0209256_1000738
873 Ga0209256_1000778
874 Ga0209256_1003086
875 Ga0209256_1003337
876 Ga0209256_1006190
877 Ga0209256_1007396
878 Ga0209256_1016254
879 Ga0207426_1000008
880 Ga0207426_1001525
881 Ga0209051_1000308
882 Ga0209051_1003270
883 Ga0209257_1000853
884 Ga0209257_1001683
885 Ga0209257_1018341
886 Ga0207655_1006700
887 Ga0207655_1040622
888 Ga0207711_10065806
889 Ga0209281_1008839
890 Ga0209281_1011402
891 Ga0209282_1000001
892 Ga0209282_1000003
893 Ga0209813_10021420
894 Ga0307515_10035804
895 Ga0316181_1068628
896 Ga0307408_100000022
897 Ga0307408_100003823
898 Ga0307408_100009899
899 Ga0307408_100019273
900 Ga0307408_100035811
901 Ga0307405_10009630
902 Ga0307518_10010757
903 Ga0307406_10013649
904 Ga0307412_10013523
905 Ga0395899_0001133
906 Ga0395900_0007781
907 Ga0395905_0001288
908 Ga0395905_0020053
909 Ga0395901_0032091
910 Ga0436361_0173203
911 Ga0436361_0993359
912 Ga0439465_0001522
913 Ga0451787_341380
914 Ga0451833_1382245
915 Ga0451839_0067884
916 Ga0451841_0994005
917 Ga0451847_0315990
918 Ga0451853_2236988
919 Ga0466967_0197284
920 Ga0495617_000157
921 Ga0495617_000223
922 Ga0495617_000979
923 Ga0495617_010003
924 Ga0495627_000004
925 Ga0495590_0000014
926 Ga0495638_0000064
927 Ga0495638_0011865
928 Ga0495638_0013142
929 Ga0495638_0029176
930 Ga0495638_0119192
931 Ga0495653_0000056
932 Ga0495653_0008446
933 Ga0495650_0000317
934 Ga0495650_0000328
935 Ga0495650_0000368
936 Ga0495650_0000918
937 Ga0495650_0001126
938 Ga0495650_0001529
939 Ga0495650_0003117
940 Ga0495605_0000267
941 Ga0495605_0000906
942 Ga0495584_0000026
943 Ga0495584_0000683
944 Ga0495584_0002580
945 Ga0495585_0000352
946 Ga0495585_0003835
947 Ga0495585_0007906
948 Ga0495585_0020995
949 Ga0495585_0051231
950 Ga0495596_0007147
951 Ga0495607_0000295
952 Ga0495607_0002318
953 Ga0495607_0002600
954 Ga0495607_0016919
955 Ga0495607_0022274
956 Ga0495607_0064155
957 Ga0495607_0065930
958 Ga0495607_0101034
959 Ga0495583_0000014
960 Ga0495583_0000108
961 Ga0495583_0000287
962 Ga0495583_0001630
963 Ga0495606_0000757
964 Ga0495606_0000880
965 Ga0495606_0000897
966 Ga0495606_0001004
967 Ga0495606_0001694
968 Ga0495606_0002140
969 Ga0495606_0002897
970 Ga0495606_0004118
971 Ga0495606_0004694
972 Ga0495606_0006620
973 Ga0495606_0036949
974 Ga0495606_0039895
975 Ga0495610_0000027
976 Ga0495610_0001253
977 Ga0495610_0001490
978 Ga0495610_0011927
979 Ga0495610_0026583
980 Ga0495610_0036071
981 Ga0495616_0002237
982 Ga0495616_0005272
983 Ga0495616_0005336
984 Ga0495620_0033526
985 Ga0495631_0018007
986 Ga0495637_0000240
987 Ga0495637_0000634
988 Ga0495643_0000108
989 Ga0495643_0000153
990 Ga0495643_0000471
991 Ga0495643_0003818
992 Ga0495643_0017752
993 Ga0495643_0027141
994 Ga0495643_0103953
995 Ga0495644_0000244
996 Ga0495644_0000399
997 Ga0495644_0022630
998 Ga0495644_0053451
999 Ga0495648_0000006
1000 Ga0495648_0001600
1001 Ga0495648_0003425
1002 Ga0495648_0004553
1003 Ga0495648_0005550
1004 Ga0495648_0006664
1005 Ga0495648_0012448
1006 Ga0495648_0015110
1007 Ga0495642_0000740
1008 Ga0495642_0000946
1009 Ga0495652_0003647
1010 Ga0495654_0000131
1011 Ga0495654_0001470
1012 Ga0495609_0000207
1013 Ga0495609_0000464
1014 Ga0495609_0000876
1015 Ga0495609_0000944
1016 Ga0495609_0005406
1017 Ga0495609_0009785
1018 Ga0495597_0000043
1019 Ga0495597_0000648
1020 Ga0495597_0001867
1021 Ga0495597_0006327
1022 Ga0495597_0014350
1023 Ga0495597_0020464
1024 Ga0495622_0000061
1025 Ga0495622_0000155
1026 Ga0495622_0000208
1027 Ga0495622_0049391
1028 Ga0495633_0000132
1029 Ga0495633_0000469
1030 Ga0495633_0000535
1031 Ga0495633_0000693
1032 Ga0495633_0002795
1033 Ga0495633_0004214
1034 Ga0495633_0005638
1035 Ga0495633_0012668
1036 Ga0495633_0017351
1037 Ga0495633_0084719
1038 Ga0495656_0013284
1039 Ga0495668_0000046
1040 Ga0495668_0000063
1041 Ga0495668_0000209
1042 Ga0495668_0000911
1043 Ga0495668_0001057
1044 Ga0495668_0016872
1045 Ga0495611_0001871
1046 Ga0495611_0002677
1047 Ga0495611_0007893
1048 Ga0495611_0013478
1049 Ga0495625_0000780
1050 Ga0495625_0001523
1051 Ga0495625_0002153
1052 Ga0495625_0004626
1053 Ga0495625_0005455
1054 Ga0495625_0010304
1055 Ga0495625_0035514
1056 Ga0495625_0058504
1057 Ga0495625_0074345
1058 Ga0495625_0113987
1059 Ga0495625_0117376
1060 Ga0495659_0000043
1061 Ga0495659_0000398
1062 Ga0495659_0002842
1063 Ga0495659_0003193
1064 Ga0495661_0002960
1065 Ga0495661_0016467
1066 Ga0495661_0018493
1067 Ga0495661_0083396
1068 Ga0495588_0000062
1069 Ga0495646_0081763
1070 Ga0495669_0000224
1071 Ga0495669_0021410
1072 Ga0495670_0000177
1073 Ga0495670_0000447
1074 Ga0495670_0010900
1075 Ga0495670_0018740
1076 Ga0495670_0042648
1077 Ga0495671_0000106
1078 Ga0495671_0000251
1079 Ga0495671_0001329
1080 Ga0495671_0028514
1081 Ga0495671_0053799
1082 Ga0495649_0007163
1083 Ga0495649_0039513
1084 Ga0495589_0003437
1085 Ga0495589_0011802
1086 Ga0495589_0059732
1087 Ga0495600_0048506
1088 Ga0495660_0000057
1089 Ga0495660_0000791
1090 Ga0495660_0001583
1091 Ga0495660_0002052
1092 Ga0495660_0009640
1093 Ga0495636_0000858
1094 Ga0495636_0010416
1095 Ga0495672_0000023
1096 Ga0495672_0000161
1097 Ga0495672_0000399
1098 Ga0495672_0003147
1099 Ga0495672_0028406
1100 Ga0495672_0033209
1101 Ga0495683_0002452
1102 Ga0495683_0009295
1103 Ga0495683_0021122
1104 Ga0495687_000036
1105 Ga0495687_000740
1106 Ga0495687_000904
1107 Ga0495687_004099
1108 Ga0495687_004228
1109 Ga0495687_021336
1110 Ga0495677_0001180
1111 Ga0495677_0001797
1112 Ga0495677_0004812
1113 Ga0495677_0005292
1114 Ga0495677_0020255
1115 Ga0495677_0022924
1116 Ga0495679_003595
1117 Ga0495679_018385
1118 Ga0495685_000020
1119 Ga0495685_000168
1120 Ga0495685_011249
1121 Ga0495673_0000008
1122 Ga0495673_0000009
1123 Ga0495673_0000185
1124 Ga0495673_0008065
1125 Ga0495673_0066843
1126 Ga0495681_0004313
1127 Ga0495681_0006959
1128 Ga0495681_0017431
1129 Ga0495686_0000830
1130 Ga0495686_0001620
1131 Ga0495686_0016979
1132 Ga0495686_0048047
1133 Ga0495686_0067393
1134 Ga0495626_0000017
1135 Ga0495626_0002878
1136 Ga0496102_0105349
1137 Ga0496103_0003227
1138 Ga0496103_0006047
1139 Ga0496103_0107024
1140 Ga0496105_0159422
1141 Ga0496116_0002238
1142 Ga0496116_0014414
1143 Ga0496116_0024138
1144 Ga0496116_0030817
1145 Ga0496116_0033083
1146 Ga0496117_0006678
1147 Ga0496117_0021190
1148 Ga0496118_0006625
1149 Ga0496118_0016280
1150 Ga0496118_0033179
1151 Ga0496119_0013948
1152 Ga0496119_0019374
1153 Ga0496120_0005731
1154 Ga0496120_0032669
1155 Ga0496121_0018620
1156 Ga0496121_0018883
1157 Ga0496121_0022429
1158 Ga0496121_0024515
1159 Ga0496122_0016168
1160 Ga0496122_0017792
1161 Ga0496122_0030204
1162 Ga0496122_0031324
1163 Ga0496122_0037458
1164 Ga0496122_0037962
1165 Ga0496122_0048896
1166 Ga0496123_0001273
1167 Ga0496123_0007309
1168 Ga0496123_0017919
1169 Ga0496123_0026440
1170 Ga0496124_0018466
1171 Ga0496124_0020362
1172 Ga0496124_0031055
1173 Ga0496124_0271332
1174 Ga0496125_0007334
1175 Ga0496125_0015030
1176 Ga0496125_0110981
1177 Ga0496126_0021335
1178 Ga0496126_0130562
1179 Ga0495678_000001
1180 Ga0495678_000149
1181 Ga0495678_000297
1182 Ga0495678_003375
1183 Ga0495678_003562
1184 Ga0495678_007024
1185 Ga0495682_0000013
1186 Ga0495682_0000016
1187 Ga0495682_0004213
1188 Ga0495682_0004216
1189 Ga0501032_0086844
1190 Ga0501034_0117427
1191 Ga0501036_0076671
1192 Ga0501037_0080904
1193 Ga0501043_0012696
1194 Ga0501047_0173272
1195 Ga0501073_0061685
1196 Ga0501080_0049516
1197 Ga0501083_0090339
1198 Ga0501269_000353
1199 nmdc:mga07m45_94237_c1
1200 nmdc:mga0sz30_23305_c1
1201 Ga0500569_023506
1202 Ga0500595_000960
1203 Ga0500618_000103
1204 Ga0500658_0000529
1205 Ga0500658_0027527
1206 Ga0500568_0002595
1207 Ga0500586_000093
1208 Ga0500586_000535
1209 Ga0500616_0003835
1210 Ga0500619_000510
1211 Ga0500622_0000899
1212 Ga0501082_0039279
1213 2509392155
1214 2509445798
1215 2509446900
1216 2510133854
1217 2510895274
1218 2512037795
1219 2513573671
1220 2513576845
1221 2513629500
1222 2513708148
1223 2513909202
1224 2513925471
1225 2514020107
1226 2515112899
1227 2515636423
1228 2515640861
1229 2515655455
1230 2515739384
1231 2517036601
1232 2517076964
1233 2517095732
1234 2517407301
1235 2530646054
1236 2535516784
1237 2585200521
1238 2585222731
1239 2585254998
1240 2585527344
1241 2585545314
1242 2585822827
1243 2585843083
1244 2599417386
1245 2601667956
1246 2616293455
1247 2643786889
1248 2643798779
1249 2644212638
1250 2644250113
1251 2644360019
1252 2644471126
1253 2671692584
1254 2719181716
1255 2719386238
1256 2719666059
1257 2719732380
1258 2720492479
1259 2720613917
1260 2720620721
1261 2720632044
1262 2720775772
1263 2721147807
1264 2721159256
1265 2721164643
1266 2721400020
1267 2722840813
1268 2723027379
1269 2723560998
1270 2723567591
1271 2724038833
1272 2724045136
1273 2724090379
1274 2724104856
1275 2724110661
1276 2725952660
1277 2730108315
1278 2730164951
1279 2730298888
1280 2738737544
1281 2738742847
1282 2738799994
1283 2738826668
1284 2738841736
1285 2738846829
1286 2739032743
1287 2739150465
1288 2739151154
1289 2739192384
1290 2739193073
1291 2739272608
1292 2739277717
1293 2739318861
1294 2739319550
1295 2739337102
1296 2739337791
1297 2739341652
1298 2739346760
1299 2766065767
1300 2793294532
1301 2793314634
1302 2793320460
1303 2793330536
1304 2793336815
1305 2793339106
1306 2793348790
1307 2793351928
1308 2793363601
1309 2793370273
1310 2805931398
1311 2805937405
1312 2806043723
1313 2806064544
1314 2806071811
1315 2819541712
1316 2821134715
1317 2821135385
1318 2838017750
1319 2838028377
1320 2838038410
1321 2838043870
1322 2838051958
1323 2838067425
1324 2838070243
1325 2838661680
1326 2838670263
1327 2838681708
1328 2838687155
1329 2838696280
1330 2838702634
1331 2838710481
1332 2838729873
1333 2838743112
1334 2841852598
1335 2841869895
1336 2842078655
1337 2842114880
1338 2842118836
1339 2842148108
1340 2842157942
1341 2842167508
1342 2842181561
1343 2842198563
1344 2842204492
1345 2842205575
1346 2842217832
1347 2842230388
1348 2842239893
1349 2842244290
1350 2842253174
1351 2842257624
1352 2842266167
1353 2842271307
1354 2842279032
1355 2842285696
1356 2842292317
1357 2842304938
1358 2842315010
1359 2842320612
1360 2842346359
1361 2842369062
1362 2842372275
1363 2842378714
1364 2842385346
1365 2842399980
1366 2842403055
1367 2842409572
1368 2842416224
1369 2842423857
1370 2842430630
1371 2842437383
1372 2842443753
1373 2842453121
1374 2842464773
1375 2842472001
1376 2842496924
1377 2842715259
1378 2842717441
1379 2844458521
1380 2857517538
1381 2857550007
1382 2857556383
1383 2857557935
1384 2857562103
1385 2857564074
1386 2857567890
1387 2857569037
1388 2885081642
1389 2904427850
1390 2919106616
1391 2919476853
1392 2919479551
1393 2932411657
1394 2932418776
1395 2933017490
1396 2933570746
1397 2933591252
1398 2933601049
1399 2935900714
1400 2935902058
1401 2936372144
1402 2936381052
1403 2936382991
1404 2996889125
1405 2996896453
1406 3005414716
1407 3005448341
1408 639649093
1409 8005262278
1410 8005281029
1411 8005283359
1412 8005293540
1413 8005303024
1414 8005312731
1415 8005323652
1416 8005380826
1417 8005385304
1418 8005396222
1419 8005435055
1420 8005463576
1421 8005545510
1422 8005557116
1423 8005567888
1424 8005573565
1425 8005622170
1426 8005632353
1427 8005659122
1428 8005692206
1429 8005697299
1430 8018133995
1431 8018166195
1432 8018181422
1433 8023683270
1434 8024482968
1435 8024504260
1436 8047678335
1437 8054007057
1438 8056378428
1439 8056386626
1440 8057877342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

19

188

0.86

PF07690

MFS_1

Major Facilitator Superfamily

15

331

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8929 19 388
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.876 19 388
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8564 21 389
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8543 19 388
6oom-assembly2.cif.gz_A-2 protein a 0.8534 18 389
ID Description Score Start End Superfamily
af_P76628_9_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9469 17 388 1.20.1250.20
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9344 21 201 1.20.1250.20
af_P76628_9_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9322 17 388 1.20.1250.20
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9214 19 197 1.20.1250.20
af_Q54LA4_481_867_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9174 16 388 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2E9XNC2-F1-model_v4 MFS transporter 0.9354 21 195 GO:0005886
GO:0046943
AF-A0A6N3RVD1-F1-model_v4 deleted 0.9136 19 203
AF-A0A5M9N164-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9106 19 389 GO:0016020
GO:0022857
AF-A0A7J6JC68-F1-model_v4 Efflux pump radE 0.8997 21 332 GO:0005886
GO:0022857
AF-A0A2V9RJV5-F1-model_v4 MFS transporter 0.8859 28 187 GO:0016020
GO:0022857

Map