F477290

General Info

Members Datasets Scaffolds Average Seq Length
720 337 1440 322

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100072441|Ga0068868_1000724412
Length 384
Sequence MPHARWPAPLDRVSLGLGSGSPFNSILRHDADRVNYRVVDIRAFRTAEKTKLAGGGGRNSMRVYTGCAFVILALAVPVAADVHAADYPERNITVVVPFPPGGASDVTARLTSNKLSERVGKSVIIENRAGANGGLGAAGVKSATPDGYTVLIGSIGVYAINPGLYKNLKYDPLKDFDLLSLLVRTPNVLVTSPDFPVNTAADLIAHLKKNPNQVTFASSGIGSSDHLTAALFWQKTGTTGVHVPYKGGGPAINDLMGSHANASFQNLGAVAQHIRAGKLKALAVTGEKRAAALPDVPTTAEAGIVDLVVYSWQAAAAPKGLPPDIRTRLESEIAAAINSPEATKQFNDIGFDVVASNGAQFAEFLAAETQRWKKVIEAGNIVAE

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
336 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
337 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0
Rhizoplane 7.5
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100072441 3300005338 Bacteria 2749
2 MBSR1b_contig_12525042 2162886012 Bacteria 1394
3 MBSR1b_contig_8291354 2162886012 Bacteria 1396
4 JGI24737J22298_10000128 3300001990 Bacteria 23154
5 JGI24750J21931_1000649 3300002070 Bacteria 5184
6 JGI24745J21846_1005664 3300002073 Bacteria 1368
7 JGI24749J21850_1003177 3300002076 Bacteria 2292
8 JGI24034J26672_10003637 3300002239 Bacteria 2155
9 JGI24742J22300_10000627 3300002244 Bacteria 5312
10 JGI25151J46595_10008704 3300003187 Bacteria 4858
11 Ga0055529_1001290 3300003763 Bacteria 8744
12 Ga0065712_10083320 3300005290 Bacteria 2846
13 Ga0065715_10000316 3300005293 Bacteria 15085
14 Ga0065707_10109562 3300005295 Bacteria 2464
15 Ga0070658_10234335 3300005327 Bacteria 1555
16 Ga0070676_10081833 3300005328 Bacteria 1960
17 Ga0070683_100062863 3300005329 Bacteria 3452
18 Ga0070683_100151556 3300005329 Bacteria 2198
19 Ga0070683_100299960 3300005329 Bacteria 1528
20 Ga0070690_100012877 3300005330 Bacteria 4929
21 Ga0070690_100015216 3300005330 Bacteria 4584
22 Ga0070690_100031756 3300005330 Bacteria 3292
23 Ga0070670_100058509 3300005331 Bacteria 3309
24 Ga0070670_100087040 3300005331 Bacteria 2685
25 Ga0068869_100096232 3300005334 Bacteria 2234
26 Ga0070666_10151942 3300005335 Bacteria 1615
27 Ga0070680_100032729 3300005336 Bacteria 4185
28 Ga0070682_100010445 3300005337 Bacteria 5270
29 Ga0068868_100003792 3300005338 Bacteria 10550
30 Ga0068868_100030534 3300005338 Bacteria 4132
31 Ga0068868_100340058 3300005338 Bacteria 1283
32 Ga0070660_100028771 3300005339 Bacteria 4160
33 Ga0070689_100005281 3300005340 Bacteria 8801
34 Ga0070689_100016400 3300005340 Bacteria 5421
35 Ga0070691_10040711 3300005341 Bacteria 2196
36 Ga0070691_10049803 3300005341 Bacteria 1997
37 Ga0070687_100009289 3300005343 Bacteria 4207
38 Ga0070687_100203638 3300005343 Bacteria 1201
39 Ga0070661_100109835 3300005344 Bacteria 2058
40 Ga0070692_10005396 3300005345 Bacteria 5448
41 Ga0070692_10049948 3300005345 Bacteria 2171
42 Ga0070668_100046191 3300005347 Bacteria 3343
43 Ga0070668_100087946 3300005347 Bacteria 2445
44 Ga0070668_100106445 3300005347 Bacteria 2228
45 Ga0070668_100159305 3300005347 Bacteria 1830
46 Ga0070669_100005422 3300005353 Bacteria 9201
47 Ga0070675_100013950 3300005354 Bacteria 6324
48 Ga0070675_100120432 3300005354 Bacteria 2229
49 Ga0070675_100445382 3300005354 Bacteria 1161
50 Ga0070671_100000362 3300005355 Bacteria 31320
51 Ga0070671_100008528 3300005355 Bacteria 8216
52 Ga0070671_100081968 3300005355 Bacteria 2697
53 Ga0070674_100017488 3300005356 Bacteria 4512
54 Ga0070674_100023908 3300005356 Bacteria 3962
55 Ga0070674_100174462 3300005356 Unclassified 1642
56 Ga0070674_100185713 3300005356 Bacteria 1595
57 Ga0070673_100017778 3300005364 Bacteria 5066
58 Ga0070673_100082987 3300005364 Bacteria 2603
59 Ga0070688_100004174 3300005365 Bacteria 7499
60 Ga0070688_100026827 3300005365 Bacteria 3426
61 Ga0070659_100032683 3300005366 Bacteria 4037
62 Ga0070659_100127257 3300005366 Bacteria 2067
63 Ga0070659_100128014 3300005366 Bacteria 2061
64 Ga0070667_100003565 3300005367 Bacteria 13258
65 Ga0070667_100005108 3300005367 Bacteria 10982
66 Ga0070709_10003008 3300005434 Bacteria 9076
67 Ga0070714_100052522 3300005435 Bacteria 3476
68 Ga0070714_100199196 3300005435 Unclassified 1831
69 Ga0070713_100005507 3300005436 Bacteria 8668
70 Ga0070713_100006880 3300005436 Bacteria 7930
71 Ga0070713_100318516 3300005436 Bacteria 1436
72 Ga0070710_10005760 3300005437 Bacteria 5902
73 Ga0070710_10013256 3300005437 Bacteria 4123
74 Ga0070710_10147420 3300005437 Bacteria 1449
75 Ga0070701_10010054 3300005438 Bacteria 4170
76 Ga0070701_10088246 3300005438 Bacteria 1694
77 Ga0070711_100027108 3300005439 Bacteria 3759
78 Ga0070711_100053932 3300005439 Bacteria 2773
79 Ga0070711_100199928 3300005439 Bacteria 1541
80 Ga0070705_100009669 3300005440 Bacteria 4800
81 Ga0070700_100005149 3300005441 Bacteria 6906
82 Ga0070700_100017039 3300005441 Bacteria 4149
83 Ga0070700_100017167 3300005441 Bacteria 4133
84 Ga0070700_100189241 3300005441 Bacteria 1438
85 Ga0070700_100218260 3300005441 Bacteria 1349
86 Ga0070694_100001413 3300005444 Bacteria 14055
87 Ga0070694_100002838 3300005444 Bacteria 10289
88 Ga0070694_100081521 3300005444 Bacteria 2251
89 Ga0070708_100118541 3300005445 Bacteria 2439
90 Ga0070663_100019879 3300005455 Bacteria 4435
91 Ga0070663_100050037 3300005455 Bacteria 2970
92 Ga0070678_100036533 3300005456 Bacteria 3440
93 Ga0070678_100038381 3300005456 Bacteria 3371
94 Ga0070678_100403711 3300005456 Bacteria 1188
95 Ga0070662_100030150 3300005457 Bacteria 3792
96 Ga0070662_100174710 3300005457 Bacteria 1689
97 Ga0070681_10000228 3300005458 Bacteria 44234
98 Ga0070681_10152217 3300005458 Bacteria 2239
99 Ga0068867_100001971 3300005459 Bacteria 14316
100 Ga0068867_100004618 3300005459 Bacteria 9690
101 Ga0068867_100115912 3300005459 Bacteria 2064
102 Ga0070685_10004947 3300005466 Bacteria 6745
103 Ga0070685_10037344 3300005466 Bacteria 2750
104 Ga0070706_100014265 3300005467 Bacteria 7344
105 Ga0070707_100010252 3300005468 Bacteria 8726
106 Ga0070699_100009515 3300005518 Bacteria 8420
107 Ga0070679_100032834 3300005530 Bacteria 5137
108 Ga0070679_100107866 3300005530 Bacteria 2770
109 Ga0070684_100023069 3300005535 Bacteria 5197
110 Ga0070684_100110703 3300005535 Bacteria 2462
111 Ga0070697_100001006 3300005536 Bacteria 21260
112 Ga0068853_100366138 3300005539 Bacteria 1344
113 Ga0070672_100000929 3300005543 Bacteria 17621
114 Ga0070686_100009668 3300005544 Bacteria 5421
115 Ga0070686_100014809 3300005544 Bacteria 4500
116 Ga0070686_100112315 3300005544 Bacteria 1858
117 Ga0070686_100132673 3300005544 Bacteria 1724
118 Ga0070695_100108285 3300005545 Bacteria 1881
119 Ga0070695_100251142 3300005545 Bacteria 1287
120 Ga0070696_100007921 3300005546 Bacteria 7093
121 Ga0070696_100223561 3300005546 Bacteria 1413
122 Ga0070696_100320832 3300005546 Bacteria 1192
123 Ga0070693_100042527 3300005547 Bacteria 2560
124 Ga0070693_100162252 3300005547 Bacteria 1424
125 Ga0070693_100339244 3300005547 Bacteria 1025
126 Ga0070665_100013865 3300005548 Bacteria 8107
127 Ga0070665_100092128 3300005548 Bacteria 3035
128 Ga0070665_100392040 3300005548 Unclassified 1396
129 Ga0070704_100008296 3300005549 Bacteria 6220
130 Ga0070704_100052449 3300005549 Bacteria 2877
131 Ga0070704_100075230 3300005549 Bacteria 2466
132 Ga0070704_100165637 3300005549 Bacteria 1752
133 Ga0068855_100015817 3300005563 Bacteria 9077
134 Ga0068855_100289188 3300005563 Bacteria 1817
135 Ga0070664_100165466 3300005564 Bacteria 1959
136 Ga0070664_100281010 3300005564 Bacteria 1501
137 Ga0068857_100001264 3300005577 Bacteria 19809
138 Ga0068857_100404424 3300005577 Bacteria 1271
139 Ga0068856_100010211 3300005614 Bacteria 9128
140 Ga0068856_100118077 3300005614 Bacteria 2653
141 Ga0068856_100171484 3300005614 Bacteria 2182
142 Ga0068856_100597063 3300005614 Bacteria 1125
143 Ga0070702_100002036 3300005615 Bacteria 8546
144 Ga0070702_100067642 3300005615 Bacteria 2099
145 Ga0068852_100004675 3300005616 Bacteria 9708
146 Ga0068859_100011543 3300005617 Bacteria 8883
147 Ga0068859_100051164 3300005617 Bacteria 4151
148 Ga0068859_100064701 3300005617 Bacteria 3690
149 Ga0068859_100102696 3300005617 Bacteria 2917
150 Ga0068864_100007127 3300005618 Bacteria 9184
151 Ga0068864_100013882 3300005618 Bacteria 6677
152 Ga0068864_100042578 3300005618 Bacteria 3886
153 Ga0068866_10012941 3300005718 Bacteria 3646
154 Ga0068866_10047184 3300005718 Bacteria 2171
155 Ga0068866_10200538 3300005718 Unclassified 1192
156 Ga0068861_100000408 3300005719 Bacteria 24852
157 Ga0068861_100026209 3300005719 Bacteria 4237
158 Ga0068861_100122948 3300005719 Bacteria 2096
159 Ga0068861_100311890 3300005719 Bacteria 1367
160 Ga0068870_10000147 3300005840 Bacteria 24823
161 Ga0068870_10044651 3300005840 Bacteria 2317
162 Ga0068863_100005958 3300005841 Bacteria 11956
163 Ga0068863_100008688 3300005841 Bacteria 9921
164 Ga0068863_100110624 3300005841 Bacteria 2616
165 Ga0068863_100163610 3300005841 Bacteria 2133
166 Ga0068858_100000393 3300005842 Bacteria 45778
167 Ga0068858_100026614 3300005842 Bacteria 5372
168 Ga0068858_100026951 3300005842 Bacteria 5338
169 Ga0068862_100004593 3300005844 Bacteria 11632
170 Ga0068862_100151656 3300005844 Bacteria 2063
171 Ga0068862_100579522 3300005844 Bacteria 1075
172 Ga0081455_10000007 3300005937 Bacteria 269394
173 Ga0081455_10003576 3300005937 Bacteria 17837
174 Ga0081540_1000085 3300005983 Bacteria 99716
175 Ga0081540_1013408 3300005983 Bacteria 5328
176 Ga0081540_1025125 3300005983 Bacteria 3438
177 Ga0081539_10002865 3300005985 Bacteria 22915
178 Ga0070717_10000199 3300006028 Bacteria 41940
179 Ga0075365_10031431 3300006038 Bacteria 3406
180 Ga0075365_10121701 3300006038 Bacteria 1800
181 Ga0075363_100028930 3300006048 Bacteria 2856
182 Ga0075364_10006529 3300006051 Bacteria 6858
183 Ga0075364_10049243 3300006051 Bacteria 2747
184 Ga0075364_10275734 3300006051 Bacteria 1144
185 Ga0075432_10007068 3300006058 Bacteria 3824
186 Ga0075432_10011987 3300006058 Bacteria 2946
187 Ga0070715_10125219 3300006163 Bacteria 1230
188 Ga0070716_100004396 3300006173 Bacteria 6736
189 Ga0070712_100262713 3300006175 Bacteria 1384
190 Ga0075362_10017197 3300006177 Bacteria 2976
191 Ga0075367_10006838 3300006178 Bacteria 5798
192 Ga0075367_10019321 3300006178 Bacteria 3777
193 Ga0075367_10131808 3300006178 Bacteria 1545
194 Ga0075369_10007375 3300006186 Bacteria 4186
195 Ga0075369_10039671 3300006186 Bacteria 2011
196 Ga0075427_10005975 3300006194 Bacteria 1750
197 Ga0075366_10003688 3300006195 Bacteria 8127
198 Ga0075366_10025397 3300006195 Bacteria 3460
199 Ga0097621_100000528 3300006237 Bacteria 26790
200 Ga0097621_100004347 3300006237 Bacteria 9850
201 Ga0097621_100100649 3300006237 Bacteria 2431
202 Ga0075370_10105960 3300006353 Bacteria 1630
203 Ga0068871_100012198 3300006358 Bacteria 6327
204 Ga0068871_100185526 3300006358 Bacteria 1789
205 Ga0075430_100000160 3300006846 Bacteria 44139
206 Ga0075430_100001022 3300006846 Bacteria 22142
207 Ga0075430_100001274 3300006846 Bacteria 20299
208 Ga0075430_100023692 3300006846 Bacteria 5227
209 Ga0075430_100067122 3300006846 Bacteria 3011
210 Ga0075431_100056828 3300006847 Bacteria 4035
211 Ga0075431_100093412 3300006847 Bacteria 3104
212 Ga0075431_100401016 3300006847 Bacteria 1373
213 Ga0075433_10069782 3300006852 Bacteria 3087
214 Ga0075433_10140481 3300006852 Bacteria 2147
215 Ga0075433_10146405 3300006852 Bacteria 2100
216 Ga0075433_10295363 3300006852 Bacteria 1435
217 Ga0075434_100000771 3300006871 Bacteria 25327
218 Ga0075434_100015591 3300006871 Bacteria 7294
219 Ga0075434_100021105 3300006871 Bacteria 6329
220 Ga0075434_100024495 3300006871 Bacteria 5899
221 Ga0075434_100166932 3300006871 Unclassified 2221
222 Ga0075434_100427943 3300006871 Bacteria 1345
223 Ga0075429_100000941 3300006880 Bacteria 23046
224 Ga0075429_100029495 3300006880 Bacteria 4764
225 Ga0075429_100236282 3300006880 Bacteria 1601
226 Ga0068865_100002207 3300006881 Bacteria 11472
227 Ga0068865_100002612 3300006881 Bacteria 10707
228 Ga0068865_100017305 3300006881 Bacteria 4634
229 Ga0068865_100087522 3300006881 Bacteria 2252
230 Ga0068865_100386243 3300006881 Bacteria 1143
231 Ga0075436_100002496 3300006914 Bacteria 12654
232 Ga0075436_100069953 3300006914 Bacteria 2425
233 Ga0075436_100098777 3300006914 Bacteria 2032
234 Ga0097620_100011543 3300006931 Bacteria 8883
235 Ga0097620_100051161 3300006931 Bacteria 4151
236 Ga0097620_100064700 3300006931 Bacteria 3690
237 Ga0097620_100102694 3300006931 Bacteria 2917
238 Ga0075435_100017223 3300007076 Bacteria 5463
239 Ga0075435_100148086 3300007076 Bacteria 1972
240 Ga0075435_100304320 3300007076 Bacteria 1364
241 Ga0105251_10015417 3300009011 Bacteria 4178
242 Ga0105250_10058799 3300009092 Unclassified 1543
243 Ga0111539_10023762 3300009094 Bacteria 7531
244 Ga0111539_10140136 3300009094 Bacteria 2831
245 Ga0105245_10001434 3300009098 Bacteria 21608
246 Ga0105245_10021856 3300009098 Bacteria 5615
247 Ga0105245_10032595 3300009098 Bacteria 4613
248 Ga0105245_10408796 3300009098 Bacteria 1358
249 Ga0105245_10416279 3300009098 Bacteria 1346
250 Ga0105245_10514019 3300009098 Bacteria 1215
251 Ga0105247_10001834 3300009101 Bacteria 14882
252 Ga0105247_10007035 3300009101 Bacteria 6921
253 Ga0105247_10008850 3300009101 Bacteria 6137
254 Ga0114129_10001230 3300009147 Bacteria 34074
255 Ga0114129_10243180 3300009147 Bacteria 2419
256 Ga0114129_10537898 3300009147 Bacteria 1521
257 Ga0114129_10658324 3300009147 Bacteria 1351
258 Ga0105243_10012985 3300009148 Bacteria 6293
259 Ga0105243_10013581 3300009148 Bacteria 6161
260 Ga0105243_10040050 3300009148 Bacteria 3657
261 Ga0105243_10181338 3300009148 Bacteria 1831
262 Ga0105243_10432785 3300009148 Bacteria 1230
263 Ga0105241_10006730 3300009174 Bacteria 8457
264 Ga0105241_10040313 3300009174 Bacteria 3525
265 Ga0105242_10001717 3300009176 Bacteria 17291
266 Ga0105242_10019084 3300009176 Bacteria 5371
267 Ga0105248_10013924 3300009177 Bacteria 8850
268 Ga0105248_10041206 3300009177 Bacteria 5177
269 Ga0105248_10551657 3300009177 Bacteria 1300
270 Ga0105237_10011426 3300009545 Bacteria 9392
271 Ga0105237_10278283 3300009545 Bacteria 1676
272 Ga0105249_10023826 3300009553 Bacteria 5498
273 Ga0105249_10042306 3300009553 Bacteria 4143
274 Ga0105249_10189296 3300009553 Bacteria 2007
275 Ga0105246_10013167 3300011119 Bacteria 5179
276 Ga0105246_10044003 3300011119 Bacteria 3032
277 Ga0157373_10090807 3300013100 Bacteria 2151
278 Ga0157371_10041958 3300013102 Bacteria 3263
279 Ga0157374_10007601 3300013296 Bacteria 9249
280 Ga0157374_10013978 3300013296 Bacteria 7017
281 Ga0157374_10221678 3300013296 Bacteria 1856
282 Ga0157378_10014502 3300013297 Bacteria 6899
283 Ga0157378_10065901 3300013297 Bacteria 3242
284 Ga0163162_10020950 3300013306 Bacteria 6431
285 Ga0163162_10031555 3300013306 Bacteria 5256
286 Ga0163162_10088252 3300013306 Bacteria 3181
287 Ga0157372_10035733 3300013307 Bacteria 5472
288 Ga0157375_10022692 3300013308 Bacteria 5779
289 Ga0157375_10025609 3300013308 Bacteria 5485
290 Ga0157375_10141162 3300013308 Bacteria 2536
291 Ga0157375_10156453 3300013308 Bacteria 2418
292 Ga0157375_10573914 3300013308 Bacteria 1288
293 Ga0163163_10003403 3300014325 Bacteria 13509
294 Ga0163163_10006770 3300014325 Bacteria 10050
295 Ga0163163_10023975 3300014325 Bacteria 5803
296 Ga0163163_10105854 3300014325 Bacteria 2839
297 Ga0163163_10171203 3300014325 Bacteria 2218
298 Ga0163163_10534237 3300014325 Unclassified 1235
299 Ga0157380_10010848 3300014326 Bacteria 6569
300 Ga0157380_10036990 3300014326 Bacteria 3781
301 Ga0157380_10038719 3300014326 Bacteria 3704
302 Ga0157380_10134688 3300014326 Bacteria 2113
303 Ga0157377_10007997 3300014745 Bacteria 5138
304 Ga0157377_10009562 3300014745 Bacteria 4764
305 Ga0157379_10004355 3300014968 Bacteria 12108
306 Ga0157379_10004986 3300014968 Bacteria 11394
307 Ga0157379_10050328 3300014968 Bacteria 3719
308 Ga0157379_10184618 3300014968 Bacteria 1884
309 Ga0157376_10011774 3300014969 Bacteria 6462
310 Ga0157376_10022234 3300014969 Bacteria 4939
311 Ga0163161_10117279 3300017792 Bacteria 1996
312 Ga0163161_10187882 3300017792 Bacteria 1587
313 Ga0207666_1000623 3300025271 Bacteria 4238
314 Ga0209455_1004777 3300025272 Bacteria 4342
315 Ga0207673_1000052 3300025290 Bacteria 9700
316 Ga0209675_1004007 3300025291 Bacteria 6721
317 Ga0209025_1000113 3300025294 Bacteria 218943
318 Ga0207697_10000044 3300025315 Bacteria 48337
319 Ga0207697_10076744 3300025315 Bacteria 1404
320 Ga0207653_10009231 3300025885 Bacteria 3072
321 Ga0207682_10003035 3300025893 Bacteria 7368
322 Ga0207692_10004839 3300025898 Bacteria 5357
323 Ga0207692_10022956 3300025898 Bacteria 2879
324 Ga0207642_10000997 3300025899 Bacteria 8854
325 Ga0207642_10007111 3300025899 Bacteria 3761
326 Ga0207642_10034290 3300025899 Bacteria 2157
327 Ga0207642_10216218 3300025899 Unclassified 1068
328 Ga0207710_10001863 3300025900 Bacteria 10146
329 Ga0207710_10003378 3300025900 Bacteria 7136
330 Ga0207710_10004544 3300025900 Bacteria 6029
331 Ga0207710_10048834 3300025900 Bacteria 1895
332 Ga0207688_10000209 3300025901 Bacteria 26031
333 Ga0207688_10004933 3300025901 Bacteria 7265
334 Ga0207688_10126680 3300025901 Bacteria 1494
335 Ga0207680_10030052 3300025903 Bacteria 3059
336 Ga0207680_10033205 3300025903 Bacteria 2941
337 Ga0207647_10015121 3300025904 Bacteria 5301
338 Ga0207699_10006772 3300025906 Bacteria 5570
339 Ga0207645_10000344 3300025907 Bacteria 38826
340 Ga0207643_10000508 3300025908 Bacteria 24866
341 Ga0207684_10098232 3300025910 Bacteria 2500
342 Ga0207654_10016860 3300025911 Bacteria 3811
343 Ga0207707_10009283 3300025912 Bacteria 8528
344 Ga0207707_10163791 3300025912 Bacteria 1943
345 Ga0207707_10355519 3300025912 Bacteria 1262
346 Ga0207671_10134396 3300025914 Bacteria 1901
347 Ga0207693_10030401 3300025915 Bacteria 4265
348 Ga0207693_10087692 3300025915 Bacteria 2439
349 Ga0207663_10035933 3300025916 Bacteria 2977
350 Ga0207663_10249068 3300025916 Bacteria 1306
351 Ga0207660_10012393 3300025917 Bacteria 5578
352 Ga0207662_10006590 3300025918 Bacteria 6268
353 Ga0207662_10049514 3300025918 Bacteria 2493
354 Ga0207662_10183371 3300025918 Bacteria 1348
355 Ga0207657_10001540 3300025919 Bacteria 24693
356 Ga0207657_10177576 3300025919 Bacteria 1723
357 Ga0207649_10001391 3300025920 Bacteria 14322
358 Ga0207649_10032133 3300025920 Bacteria 3126
359 Ga0207652_10003827 3300025921 Bacteria 12342
360 Ga0207652_10202787 3300025921 Bacteria 1785
361 Ga0207646_10047985 3300025922 Bacteria 3828
362 Ga0207681_10006541 3300025923 Bacteria 7148
363 Ga0207681_10008486 3300025923 Bacteria 6278
364 Ga0207681_10228948 3300025923 Bacteria 1442
365 Ga0207650_10029169 3300025925 Bacteria 3963
366 Ga0207650_10043620 3300025925 Bacteria 3293
367 Ga0207650_10074409 3300025925 Bacteria 2560
368 Ga0207659_10001162 3300025926 Bacteria 15693
369 Ga0207659_10012178 3300025926 Bacteria 5458
370 Ga0207687_10002835 3300025927 Bacteria 11759
371 Ga0207687_10015465 3300025927 Bacteria 5005
372 Ga0207687_10055322 3300025927 Bacteria 2780
373 Ga0207700_10004180 3300025928 Bacteria 8477
374 Ga0207700_10012402 3300025928 Bacteria 5495
375 Ga0207664_10039920 3300025929 Bacteria 3646
376 Ga0207664_10154138 3300025929 Bacteria 1954
377 Ga0207644_10001464 3300025931 Bacteria 15216
378 Ga0207644_10009755 3300025931 Bacteria 6313
379 Ga0207690_10040153 3300025932 Bacteria 3057
380 Ga0207690_10046681 3300025932 Bacteria 2870
381 Ga0207690_10061905 3300025932 Bacteria 2546
382 Ga0207706_10000982 3300025933 Bacteria 29024
383 Ga0207706_10031018 3300025933 Bacteria 4764
384 Ga0207706_10074550 3300025933 Bacteria 2984
385 Ga0207686_10001430 3300025934 Bacteria 13528
386 Ga0207686_10029752 3300025934 Bacteria 3226
387 Ga0207709_10001557 3300025935 Bacteria 15725
388 Ga0207709_10005753 3300025935 Bacteria 7003
389 Ga0207709_10031363 3300025935 Bacteria 3103
390 Ga0207709_10035897 3300025935 Bacteria 2935
391 Ga0207709_10094353 3300025935 Bacteria 1964
392 Ga0207670_10000601 3300025936 Bacteria 19683
393 Ga0207670_10014883 3300025936 Bacteria 4632
394 Ga0207670_10039677 3300025936 Bacteria 3085
395 Ga0207670_10327955 3300025936 Unclassified 1206
396 Ga0207669_10003071 3300025937 Bacteria 7187
397 Ga0207669_10020428 3300025937 Bacteria 3474
398 Ga0207669_10069767 3300025937 Bacteria 2200
399 Ga0207669_10073428 3300025937 Bacteria 2158
400 Ga0207704_10001785 3300025938 Bacteria 9636
401 Ga0207704_10005085 3300025938 Bacteria 6051
402 Ga0207704_10006963 3300025938 Bacteria 5308
403 Ga0207704_10243250 3300025938 Bacteria 1346
404 Ga0207665_10008407 3300025939 Bacteria 6808
405 Ga0207665_10021282 3300025939 Bacteria 4264
406 Ga0207665_10140274 3300025939 Bacteria 1723
407 Ga0207691_10000256 3300025940 Bacteria 52748
408 Ga0207711_10006651 3300025941 Bacteria 9737
409 Ga0207711_10024855 3300025941 Bacteria 5026
410 Ga0207711_10081243 3300025941 Bacteria 2832
411 Ga0207689_10000565 3300025942 Bacteria 35394
412 Ga0207689_10050873 3300025942 Bacteria 3415
413 Ga0207689_10184328 3300025942 Bacteria 1721
414 Ga0207661_10137930 3300025944 Bacteria 2096
415 Ga0207661_10172941 3300025944 Bacteria 1881
416 Ga0207661_10249797 3300025944 Bacteria 1576
417 Ga0207679_10000196 3300025945 Bacteria 48433
418 Ga0207679_10110514 3300025945 Bacteria 2168
419 Ga0207667_10263406 3300025949 Bacteria 1763
420 Ga0207651_10010675 3300025960 Bacteria 5102
421 Ga0207651_10042312 3300025960 Bacteria 3031
422 Ga0207712_10002825 3300025961 Bacteria 11126
423 Ga0207712_10010368 3300025961 Bacteria 5916
424 Ga0207712_10011515 3300025961 Bacteria 5637
425 Ga0207712_10320272 3300025961 Unclassified 1279
426 Ga0207668_10002319 3300025972 Bacteria 11111
427 Ga0207668_10007934 3300025972 Bacteria 6314
428 Ga0207668_10022710 3300025972 Bacteria 4021
429 Ga0207640_10003026 3300025981 Bacteria 9048
430 Ga0207640_10035322 3300025981 Bacteria 3127
431 Ga0207640_10365597 3300025981 Bacteria 1164
432 Ga0207658_10007060 3300025986 Bacteria 7647
433 Ga0207658_10015965 3300025986 Bacteria 5158
434 Ga0207677_10033895 3300026023 Bacteria 3300
435 Ga0207677_10073137 3300026023 Bacteria 2426
436 Ga0207677_10088901 3300026023 Bacteria 2241
437 Ga0207703_10007434 3300026035 Bacteria 8701
438 Ga0207703_10020245 3300026035 Bacteria 5202
439 Ga0207703_10023527 3300026035 Bacteria 4841
440 Ga0207703_10245855 3300026035 Bacteria 1610
441 Ga0207639_10030311 3300026041 Bacteria 3967
442 Ga0207678_10028621 3300026067 Bacteria 4863
443 Ga0207678_10076753 3300026067 Bacteria 2862
444 Ga0207678_10139794 3300026067 Bacteria 2066
445 Ga0207708_10000365 3300026075 Bacteria 35380
446 Ga0207708_10017266 3300026075 Bacteria 5432
447 Ga0207702_10007105 3300026078 Bacteria 9578
448 Ga0207702_10281074 3300026078 Bacteria 1573
449 Ga0207641_10002439 3300026088 Bacteria 17192
450 Ga0207641_10037826 3300026088 Bacteria 4032
451 Ga0207641_10136555 3300026088 Bacteria 2208
452 Ga0207648_10000341 3300026089 Bacteria 51269
453 Ga0207648_10068124 3300026089 Bacteria 3101
454 Ga0207648_10132301 3300026089 Bacteria 2196
455 Ga0207648_10136961 3300026089 Bacteria 2157
456 Ga0207676_10003881 3300026095 Bacteria 10557
457 Ga0207676_10004327 3300026095 Bacteria 10043
458 Ga0207676_10092126 3300026095 Bacteria 2491
459 Ga0207674_10001078 3300026116 Bacteria 35464
460 Ga0207674_10381991 3300026116 Bacteria 1362
461 Ga0207675_100006126 3300026118 Bacteria 11434
462 Ga0207675_100007800 3300026118 Bacteria 10098
463 Ga0207675_100009351 3300026118 Bacteria 9186
464 Ga0207675_100059474 3300026118 Bacteria 3566
465 Ga0207675_100325285 3300026118 Bacteria 1502
466 Ga0207675_100343709 3300026118 Bacteria 1461
467 Ga0207683_10000006 3300026121 Bacteria 181260
468 Ga0207683_10061781 3300026121 Bacteria 3298
469 Ga0207683_10071429 3300026121 Bacteria 3068
470 Ga0207683_10242414 3300026121 Bacteria 1644
471 Ga0207698_10003310 3300026142 Bacteria 9684
472 Ga0209999_1013861 3300027543 Bacteria 1461
473 Ga0209974_10004831 3300027876 Bacteria 4775
474 Ga0207428_10000165 3300027907 Bacteria 91701
475 Ga0207428_10000415 3300027907 Bacteria 53058
476 Ga0268266_10058164 3300028379 Bacteria 3328
477 Ga0268266_10307071 3300028379 Bacteria 1481
478 Ga0268265_10001168 3300028380 Bacteria 23015
479 Ga0268265_10083573 3300028380 Bacteria 2528
480 Ga0268264_10010388 3300028381 Bacteria 7696
481 Ga0268264_10087694 3300028381 Bacteria 2676
482 Ga0307408_100150055 3300031548 Bacteria 1839
483 Ga0307416_100030311 3300032002 Bacteria 4057
484 Ga0307416_100060304 3300032002 Bacteria 3089
485 Ga0307411_10163385 3300032005 Bacteria 1671
486 Ga0373930_0001450 3300034816 Bacteria 3533
487 Ga0373926_0009242 3300035083 Bacteria 3291
488 Ga0373928_0001039 3300035084 Bacteria 5469
489 Ga0373928_0003745 3300035084 Bacteria 2902
490 Ga0373929_0017828 3300035085 Bacteria 1405
491 Ga0373929_0033451 3300035085 Bacteria 1111
492 Ga0373951_0006412 3300035091 Bacteria 2691
493 Ga0373952_0004318 3300035092 Bacteria 2575
494 Ga0373932_0031027 3300035112 Bacteria 1486
495 Ga0373941_0002878 3300035115 Bacteria 3838
496 Ga0373941_0061733 3300035115 Bacteria 1221
497 Ga0373945_0030110 3300035116 Bacteria 1911
498 Ga0373954_0003728 3300035118 Bacteria 6494
499 Ga0373960_0001318 3300035121 Bacteria 5470
500 Ga0373943_0010585 3300035170 Bacteria 4136
501 Ga0373943_0021717 3300035170 Bacteria 2966
502 Ga0373943_0162643 3300035170 Bacteria 1216
503 Ga0373946_0006801 3300035171 Bacteria 4160
504 Ga0373946_0099271 3300035171 Bacteria 1303
505 Ga0373962_0006603 3300035242 Bacteria 2811
506 Ga0373931_0000580 3300035691 Bacteria 15093
507 Ga0373931_0058372 3300035691 Bacteria 2072
508 Ga0373935_0006037 3300035692 Bacteria 7195
509 Ga0373935_0014777 3300035692 Bacteria 4712
510 Ga0373935_0161377 3300035692 Bacteria 1528
511 Ga0373935_0215917 3300035692 Bacteria 1331
512 Ga0373927_0005431 3300035695 Bacteria 8791
513 Ga0373927_0039784 3300035695 Bacteria 3051
514 Ga0373927_0045302 3300035695 Bacteria 2845
515 Ga0373927_0048038 3300035695 Bacteria 2760
516 Ga0373933_0011447 3300035724 Bacteria 4890
517 Ga0373947_0007452 3300035725 Bacteria 6334
518 Ga0373947_0017425 3300035725 Bacteria 4131
519 Ga0373937_0001178 3300036401 Bacteria 21984
520 Ga0373925_0020056 3300037068 Bacteria 4864
521 Ga0373925_0055026 3300037068 Bacteria 2977
522 Ga0373925_0062758 3300037068 Bacteria 2794
523 Ga0373925_0254322 3300037068 Bacteria 1409
524 Ga0439465_0049140 3300041413 Bacteria 1377
525 Ga0439441_002230 3300042001 Bacteria 2699
526 Ga0439443_005564 3300042003 Bacteria 1690
527 Ga0439435_0003687 3300042436 Bacteria 3213
528 Ga0439460_0005359 3300042461 Bacteria 3145
529 Ga0451577_0274113 3300042876 Bacteria 1528
530 Ga0451576_0064534 3300045051 Bacteria 3814
531 Ga0451576_0214087 3300045051 Bacteria 2012
532 Ga0451576_0395307 3300045051 Bacteria 1449
533 Ga0495603_0030879 3300046455 Bacteria 3226
534 Ga0495629_0000535 3300046459 Bacteria 31312
535 Ga0495629_0019635 3300046459 Bacteria 4825
536 Ga0495641_0028698 3300046461 Bacteria 2689
537 Ga0495580_0160460 3300046472 Bacteria 1556
538 Ga0495582_0015897 3300046473 Bacteria 4126
539 Ga0495582_0087189 3300046473 Bacteria 1738
540 Ga0495639_0018895 3300046475 Bacteria 3004
541 Ga0495662_0021146 3300046476 Bacteria 3147
542 Ga0495662_0045043 3300046476 Bacteria 2129
543 Ga0495662_0050517 3300046476 Bacteria 2007
544 Ga0495664_0047121 3300046477 Bacteria 2557
545 Ga0495584_0027816 3300046491 Bacteria 2865
546 Ga0495585_0013462 3300046492 Bacteria 4786
547 Ga0495607_0023296 3300046501 Bacteria 3876
548 Ga0495608_0128802 3300046511 Bacteria 1620
549 Ga0495616_0105228 3300046513 Unclassified 1318
550 Ga0495618_0186000 3300046514 Unclassified 1319
551 Ga0495628_0068300 3300046516 Bacteria 2774
552 Ga0495628_0119581 3300046516 Bacteria 2022
553 Ga0495628_0302595 3300046516 Bacteria 1183
554 Ga0495630_0019795 3300046517 Bacteria 4952
555 Ga0495631_0044306 3300046518 Unclassified 1961
556 Ga0495637_0022240 3300046520 Bacteria 2895
557 Ga0495644_0026607 3300046523 Unclassified 2194
558 Ga0495663_0043465 3300046525 Bacteria 1372
559 Ga0495666_0126932 3300046526 Bacteria 1193
560 Ga0495640_0022005 3300046533 Bacteria 4668
561 Ga0495640_0076927 3300046533 Bacteria 2226
562 Ga0495586_0016390 3300046535 Bacteria 3942
563 Ga0495586_0048031 3300046535 Bacteria 2305
564 Ga0495586_0077213 3300046535 Bacteria 1826
565 Ga0495598_0001243 3300046537 Bacteria 4958
566 Ga0495645_0114389 3300046543 Bacteria 1907
567 Ga0495645_0173101 3300046543 Bacteria 1485
568 Ga0495667_0007100 3300046559 Bacteria 7597
569 Ga0495656_0001903 3300046615 Bacteria 6880
570 Ga0495656_0005630 3300046615 Bacteria 4335
571 Ga0495668_0042768 3300046616 Bacteria 2522
572 Ga0495634_0042812 3300046642 Bacteria 3070
573 Ga0495634_0081358 3300046642 Bacteria 2118
574 Ga0495635_0049883 3300046663 Bacteria 2885
575 Ga0495635_0170529 3300046663 Bacteria 1480
576 Ga0495635_0200547 3300046663 Bacteria 1353
577 Ga0495657_0083215 3300046675 Bacteria 2066
578 Ga0495647_0003599 3300046681 Bacteria 4969
579 Ga0495658_0000788 3300046683 Bacteria 17050
580 Ga0495669_0003590 3300046684 Bacteria 6398
581 Ga0495669_0108241 3300046684 Bacteria 1296
582 Ga0495613_0063589 3300046689 Bacteria 2700
583 Ga0495613_0085135 3300046689 Bacteria 2294
584 Ga0495624_0055958 3300046690 Bacteria 2483
585 Ga0495624_0088714 3300046690 Bacteria 1909
586 Ga0495670_0000291 3300046691 Bacteria 23680
587 Ga0495670_0060155 3300046691 Bacteria 1908
588 Ga0495671_0031492 3300046692 Bacteria 2712
589 Ga0495671_0123747 3300046692 Unclassified 1261
590 Ga0495581_0064793 3300047315 Bacteria 2111
591 Ga0495674_0089947 3300047319 Bacteria 2624
592 Ga0495676_0056206 3300047321 Bacteria 3113
593 Ga0495676_0226774 3300047321 Unclassified 1285
594 Ga0495680_0007298 3300047322 Bacteria 10171
595 Ga0495680_0008545 3300047322 Bacteria 9299
596 Ga0495680_0190355 3300047322 Bacteria 1476
597 Ga0495684_0003380 3300047471 Bacteria 12528
598 Ga0495684_0107457 3300047471 Bacteria 2108
599 Ga0495593_0006385 3300047673 Bacteria 6915
600 Ga0496100_0006309 3300048903 Bacteria 6459
601 Ga0496100_0007706 3300048903 Bacteria 5959
602 Ga0496100_0045416 3300048903 Bacteria 2820
603 Ga0496101_0001492 3300048904 Bacteria 13985
604 Ga0496101_0001713 3300048904 Bacteria 13127
605 Ga0496101_0033689 3300048904 Bacteria 3614
606 Ga0496101_0054286 3300048904 Bacteria 2892
607 Ga0496102_0005642 3300048905 Bacteria 10619
608 Ga0496102_0041914 3300048905 Bacteria 4147
609 Ga0496102_0106068 3300048905 Bacteria 2615
610 Ga0496102_0443136 3300048905 Bacteria 1218
611 Ga0496103_0000674 3300048906 Bacteria 25647
612 Ga0496103_0009957 3300048906 Bacteria 5621
613 Ga0496103_0021458 3300048906 Bacteria 3885
614 Ga0496104_0051662 3300048907 Bacteria 3880
615 Ga0496104_0438177 3300048907 Bacteria 1218
616 Ga0496104_0439181 3300048907 Bacteria 1217
617 Ga0496105_0122306 3300048908 Bacteria 2145
618 Ga0496106_0002632 3300048909 Bacteria 13344
619 Ga0496106_0005033 3300048909 Bacteria 9780
620 Ga0496106_0010404 3300048909 Bacteria 6873
621 Ga0496107_0000538 3300048910 Bacteria 21173
622 Ga0496107_0005561 3300048910 Bacteria 8632
623 Ga0496107_0083285 3300048910 Bacteria 2332
624 Ga0496107_0165983 3300048910 Bacteria 1637
625 Ga0496108_0009625 3300048911 Bacteria 7834
626 Ga0496108_0015093 3300048911 Bacteria 6305
627 Ga0496108_0040093 3300048911 Bacteria 3902
628 Ga0496108_0078308 3300048911 Bacteria 2797
629 Ga0496108_0324951 3300048911 Bacteria 1341
630 Ga0496109_0003832 3300048912 Bacteria 12562
631 Ga0496109_0007287 3300048912 Bacteria 9350
632 Ga0496109_0112514 3300048912 Bacteria 2531
633 Ga0496109_0154735 3300048912 Bacteria 2147
634 Ga0496110_0003895 3300048913 Bacteria 11482
635 Ga0496110_0071256 3300048913 Bacteria 3081
636 Ga0496111_0008557 3300048914 Bacteria 6781
637 Ga0496112_0013537 3300048915 Bacteria 7535
638 Ga0496112_0024733 3300048915 Bacteria 5757
639 Ga0496112_0092058 3300048915 Bacteria 3001
640 Ga0496112_0234611 3300048915 Bacteria 1788
641 Ga0496113_0003379 3300048916 Bacteria 9540
642 Ga0496113_0079943 3300048916 Bacteria 2503
643 Ga0496113_0091885 3300048916 Bacteria 2340
644 Ga0496113_0204208 3300048916 Bacteria 1571
645 Ga0496114_0003020 3300048917 Bacteria 12903
646 Ga0496114_0016625 3300048917 Bacteria 5931
647 Ga0496114_0055425 3300048917 Bacteria 3306
648 Ga0496114_0153366 3300048917 Bacteria 1999
649 Ga0496114_0393582 3300048917 Unclassified 1227
650 Ga0496115_0003755 3300048918 Bacteria 10922
651 Ga0496115_0009832 3300048918 Bacteria 7120
652 Ga0496115_0053473 3300048918 Bacteria 3240
653 Ga0496115_0061065 3300048918 Bacteria 3038
654 Ga0496122_0002702 3300048925 Bacteria 24674
655 Ga0496123_0003286 3300048926 Bacteria 18319
656 Ga0501048_0154479 3300049582 Bacteria 1623
657 Ga0501067_0177048 3300049583 Unclassified 1188
658 Ga0501075_0229330 3300049591 Bacteria 1416
659 Ga0501076_0301391 3300049592 Unclassified 1314
660 nmdc:mga03683_152633_c1 3300050489 Bacteria 1043
661 nmdc:mga00v17_1072_c1 3300050491 Bacteria 14397
662 nmdc:mga00v17_13791_c1 3300050491 Bacteria 4494
663 nmdc:mga00v17_79199_c1 3300050491 Bacteria 2049
664 nmdc:mga0yw44_19727_c1 3300050492 Bacteria 3725
665 nmdc:mga0yw44_38713_c1 3300050492 Bacteria 2823
666 nmdc:mga0yw44_65068_c1 3300050492 Bacteria 2246
667 nmdc:mga0k408_2954_c1 3300050493 Bacteria 9010
668 nmdc:mga0k408_39395_c1 3300050493 Bacteria 2715
669 nmdc:mga06z11_113284_c1 3300050494 Bacteria 1504
670 nmdc:mga07m45_40036_c1 3300050496 Bacteria 2622
671 nmdc:mga05p37_281_c1 3300050507 Bacteria 50198
672 nmdc:mga05p37_290245_c1 3300050507 Bacteria 1947
673 nmdc:mga05p37_938_c1 3300050507 Bacteria 32835
674 nmdc:mga09592_3312_c1 3300050508 Bacteria 13044
675 nmdc:mga09592_46739_c1 3300050508 Bacteria 3646
676 nmdc:mga0qj67_12459_c1 3300050509 Bacteria 6405
677 nmdc:mga0qj67_15384_c1 3300050509 Bacteria 5793
678 nmdc:mga0qj67_360_c1 3300050509 Bacteria 31452
679 nmdc:mga0qj67_64_c1 3300050509 Bacteria 77795
680 nmdc:mga06r32_39213_c1 3300050510 Bacteria 2207
681 nmdc:mga06r32_64124_c1 3300050510 Bacteria 3542
682 nmdc:mga08y16_17462_c1 3300050511 Bacteria 7557
683 nmdc:mga08y16_533807_c1 3300050511 Bacteria 1189
684 nmdc:mga08y16_66405_c1 3300050511 Bacteria 3765
685 nmdc:mga08y16_72896_c1 3300050511 Bacteria 3579
686 nmdc:mga08y16_79184_c1 3300050511 Bacteria 3425
687 nmdc:mga0n895_144185_c1 3300050512 Bacteria 2411
688 nmdc:mga0n895_172724_c1 3300050512 Bacteria 2193
689 nmdc:mga0n895_233375_c1 3300050512 Unclassified 1867
690 nmdc:mga0n895_264356_c1 3300050512 Bacteria 1746
691 nmdc:mga0n895_3233_c1 3300050512 Bacteria 13056
692 nmdc:mga0n895_480619_c1 3300050512 Bacteria 1253
693 nmdc:mga0n895_59737_c1 3300050512 Bacteria 3762
694 nmdc:mga0n895_7959_c1 3300050512 Bacteria 9141
695 nmdc:mga0rr50_122907_c1 3300050513 Bacteria 2068
696 nmdc:mga0rr50_33190_c1 3300050513 Bacteria 3685
697 nmdc:mga08x19_74750_c1 3300050514 Bacteria 2214
698 nmdc:mga08x19_94095_c1 3300050514 Bacteria 1981
699 nmdc:mga0a205_139893_c1 3300050515 Bacteria 2321
700 nmdc:mga0a205_190143_c1 3300050515 Bacteria 1945
701 nmdc:mga0a205_241126_c1 3300050515 Bacteria 1689
702 nmdc:mga0a205_571_c1 3300050515 Bacteria 29236
703 nmdc:mga0sz30_8257_c1 3300050516 Bacteria 3925
704 Ga0495655_0027785 3300053083 Bacteria 1345
705 Ga0495619_0000375 3300053085 Bacteria 30799
706 Ga0500643_005183 3300053087 Bacteria 5677
707 Ga0500644_0000896 3300053088 Bacteria 9597
708 Ga0500641_0001181 3300053096 Bacteria 9304
709 Ga0500556_0000102 3300053104 Bacteria 76549
710 Ga0500593_006383 3300053117 Bacteria 4715
711 Ga0500595_000002 3300053119 Bacteria 1074388
712 Ga0500616_0000002 3300053153 Bacteria 1611257
713 Ga0500616_0026393 3300053153 Bacteria 3215
714 Ga0500645_000012 3300053730 Bacteria 168579
715 Ga0500645_002615 3300053730 Bacteria 7887
716 Ga0501084_0241406 3300054114 Bacteria 1525
717 Ga0501082_0140671 3300060353 Bacteria 2095
718 2828307626 2828305725 Bacteria 4916900
719 2881928520 2881927736 Bacteria 3993927
720 2919452744 2919450847 Bacteria 5631160
721 Ga0068868_100072441
722 MBSR1b_contig_12525042
723 MBSR1b_contig_8291354
724 JGI24737J22298_10000128
725 JGI24750J21931_1000649
726 JGI24745J21846_1005664
727 JGI24749J21850_1003177
728 JGI24034J26672_10003637
729 JGI24742J22300_10000627
730 JGI25151J46595_10008704
731 Ga0055529_1001290
732 Ga0065712_10083320
733 Ga0065715_10000316
734 Ga0065707_10109562
735 Ga0070658_10234335
736 Ga0070676_10081833
737 Ga0070683_100062863
738 Ga0070683_100151556
739 Ga0070683_100299960
740 Ga0070690_100012877
741 Ga0070690_100015216
742 Ga0070690_100031756
743 Ga0070670_100058509
744 Ga0070670_100087040
745 Ga0068869_100096232
746 Ga0070666_10151942
747 Ga0070680_100032729
748 Ga0070682_100010445
749 Ga0068868_100003792
750 Ga0068868_100030534
751 Ga0068868_100340058
752 Ga0070660_100028771
753 Ga0070689_100005281
754 Ga0070689_100016400
755 Ga0070691_10040711
756 Ga0070691_10049803
757 Ga0070687_100009289
758 Ga0070687_100203638
759 Ga0070661_100109835
760 Ga0070692_10005396
761 Ga0070692_10049948
762 Ga0070668_100046191
763 Ga0070668_100087946
764 Ga0070668_100106445
765 Ga0070668_100159305
766 Ga0070669_100005422
767 Ga0070675_100013950
768 Ga0070675_100120432
769 Ga0070675_100445382
770 Ga0070671_100000362
771 Ga0070671_100008528
772 Ga0070671_100081968
773 Ga0070674_100017488
774 Ga0070674_100023908
775 Ga0070674_100174462
776 Ga0070674_100185713
777 Ga0070673_100017778
778 Ga0070673_100082987
779 Ga0070688_100004174
780 Ga0070688_100026827
781 Ga0070659_100032683
782 Ga0070659_100127257
783 Ga0070659_100128014
784 Ga0070667_100003565
785 Ga0070667_100005108
786 Ga0070709_10003008
787 Ga0070714_100052522
788 Ga0070714_100199196
789 Ga0070713_100005507
790 Ga0070713_100006880
791 Ga0070713_100318516
792 Ga0070710_10005760
793 Ga0070710_10013256
794 Ga0070710_10147420
795 Ga0070701_10010054
796 Ga0070701_10088246
797 Ga0070711_100027108
798 Ga0070711_100053932
799 Ga0070711_100199928
800 Ga0070705_100009669
801 Ga0070700_100005149
802 Ga0070700_100017039
803 Ga0070700_100017167
804 Ga0070700_100189241
805 Ga0070700_100218260
806 Ga0070694_100001413
807 Ga0070694_100002838
808 Ga0070694_100081521
809 Ga0070708_100118541
810 Ga0070663_100019879
811 Ga0070663_100050037
812 Ga0070678_100036533
813 Ga0070678_100038381
814 Ga0070678_100403711
815 Ga0070662_100030150
816 Ga0070662_100174710
817 Ga0070681_10000228
818 Ga0070681_10152217
819 Ga0068867_100001971
820 Ga0068867_100004618
821 Ga0068867_100115912
822 Ga0070685_10004947
823 Ga0070685_10037344
824 Ga0070706_100014265
825 Ga0070707_100010252
826 Ga0070699_100009515
827 Ga0070679_100032834
828 Ga0070679_100107866
829 Ga0070684_100023069
830 Ga0070684_100110703
831 Ga0070697_100001006
832 Ga0068853_100366138
833 Ga0070672_100000929
834 Ga0070686_100009668
835 Ga0070686_100014809
836 Ga0070686_100112315
837 Ga0070686_100132673
838 Ga0070695_100108285
839 Ga0070695_100251142
840 Ga0070696_100007921
841 Ga0070696_100223561
842 Ga0070696_100320832
843 Ga0070693_100042527
844 Ga0070693_100162252
845 Ga0070693_100339244
846 Ga0070665_100013865
847 Ga0070665_100092128
848 Ga0070665_100392040
849 Ga0070704_100008296
850 Ga0070704_100052449
851 Ga0070704_100075230
852 Ga0070704_100165637
853 Ga0068855_100015817
854 Ga0068855_100289188
855 Ga0070664_100165466
856 Ga0070664_100281010
857 Ga0068857_100001264
858 Ga0068857_100404424
859 Ga0068856_100010211
860 Ga0068856_100118077
861 Ga0068856_100171484
862 Ga0068856_100597063
863 Ga0070702_100002036
864 Ga0070702_100067642
865 Ga0068852_100004675
866 Ga0068859_100011543
867 Ga0068859_100051164
868 Ga0068859_100064701
869 Ga0068859_100102696
870 Ga0068864_100007127
871 Ga0068864_100013882
872 Ga0068864_100042578
873 Ga0068866_10012941
874 Ga0068866_10047184
875 Ga0068866_10200538
876 Ga0068861_100000408
877 Ga0068861_100026209
878 Ga0068861_100122948
879 Ga0068861_100311890
880 Ga0068870_10000147
881 Ga0068870_10044651
882 Ga0068863_100005958
883 Ga0068863_100008688
884 Ga0068863_100110624
885 Ga0068863_100163610
886 Ga0068858_100000393
887 Ga0068858_100026614
888 Ga0068858_100026951
889 Ga0068862_100004593
890 Ga0068862_100151656
891 Ga0068862_100579522
892 Ga0081455_10000007
893 Ga0081455_10003576
894 Ga0081540_1000085
895 Ga0081540_1013408
896 Ga0081540_1025125
897 Ga0081539_10002865
898 Ga0070717_10000199
899 Ga0075365_10031431
900 Ga0075365_10121701
901 Ga0075363_100028930
902 Ga0075364_10006529
903 Ga0075364_10049243
904 Ga0075364_10275734
905 Ga0075432_10007068
906 Ga0075432_10011987
907 Ga0070715_10125219
908 Ga0070716_100004396
909 Ga0070712_100262713
910 Ga0075362_10017197
911 Ga0075367_10006838
912 Ga0075367_10019321
913 Ga0075367_10131808
914 Ga0075369_10007375
915 Ga0075369_10039671
916 Ga0075427_10005975
917 Ga0075366_10003688
918 Ga0075366_10025397
919 Ga0097621_100000528
920 Ga0097621_100004347
921 Ga0097621_100100649
922 Ga0075370_10105960
923 Ga0068871_100012198
924 Ga0068871_100185526
925 Ga0075430_100000160
926 Ga0075430_100001022
927 Ga0075430_100001274
928 Ga0075430_100023692
929 Ga0075430_100067122
930 Ga0075431_100056828
931 Ga0075431_100093412
932 Ga0075431_100401016
933 Ga0075433_10069782
934 Ga0075433_10140481
935 Ga0075433_10146405
936 Ga0075433_10295363
937 Ga0075434_100000771
938 Ga0075434_100015591
939 Ga0075434_100021105
940 Ga0075434_100024495
941 Ga0075434_100166932
942 Ga0075434_100427943
943 Ga0075429_100000941
944 Ga0075429_100029495
945 Ga0075429_100236282
946 Ga0068865_100002207
947 Ga0068865_100002612
948 Ga0068865_100017305
949 Ga0068865_100087522
950 Ga0068865_100386243
951 Ga0075436_100002496
952 Ga0075436_100069953
953 Ga0075436_100098777
954 Ga0097620_100011543
955 Ga0097620_100051161
956 Ga0097620_100064700
957 Ga0097620_100102694
958 Ga0075435_100017223
959 Ga0075435_100148086
960 Ga0075435_100304320
961 Ga0105251_10015417
962 Ga0105250_10058799
963 Ga0111539_10023762
964 Ga0111539_10140136
965 Ga0105245_10001434
966 Ga0105245_10021856
967 Ga0105245_10032595
968 Ga0105245_10408796
969 Ga0105245_10416279
970 Ga0105245_10514019
971 Ga0105247_10001834
972 Ga0105247_10007035
973 Ga0105247_10008850
974 Ga0114129_10001230
975 Ga0114129_10243180
976 Ga0114129_10537898
977 Ga0114129_10658324
978 Ga0105243_10012985
979 Ga0105243_10013581
980 Ga0105243_10040050
981 Ga0105243_10181338
982 Ga0105243_10432785
983 Ga0105241_10006730
984 Ga0105241_10040313
985 Ga0105242_10001717
986 Ga0105242_10019084
987 Ga0105248_10013924
988 Ga0105248_10041206
989 Ga0105248_10551657
990 Ga0105237_10011426
991 Ga0105237_10278283
992 Ga0105249_10023826
993 Ga0105249_10042306
994 Ga0105249_10189296
995 Ga0105246_10013167
996 Ga0105246_10044003
997 Ga0157373_10090807
998 Ga0157371_10041958
999 Ga0157374_10007601
1000 Ga0157374_10013978
1001 Ga0157374_10221678
1002 Ga0157378_10014502
1003 Ga0157378_10065901
1004 Ga0163162_10020950
1005 Ga0163162_10031555
1006 Ga0163162_10088252
1007 Ga0157372_10035733
1008 Ga0157375_10022692
1009 Ga0157375_10025609
1010 Ga0157375_10141162
1011 Ga0157375_10156453
1012 Ga0157375_10573914
1013 Ga0163163_10003403
1014 Ga0163163_10006770
1015 Ga0163163_10023975
1016 Ga0163163_10105854
1017 Ga0163163_10171203
1018 Ga0163163_10534237
1019 Ga0157380_10010848
1020 Ga0157380_10036990
1021 Ga0157380_10038719
1022 Ga0157380_10134688
1023 Ga0157377_10007997
1024 Ga0157377_10009562
1025 Ga0157379_10004355
1026 Ga0157379_10004986
1027 Ga0157379_10050328
1028 Ga0157379_10184618
1029 Ga0157376_10011774
1030 Ga0157376_10022234
1031 Ga0163161_10117279
1032 Ga0163161_10187882
1033 Ga0207666_1000623
1034 Ga0209455_1004777
1035 Ga0207673_1000052
1036 Ga0209675_1004007
1037 Ga0209025_1000113
1038 Ga0207697_10000044
1039 Ga0207697_10076744
1040 Ga0207653_10009231
1041 Ga0207682_10003035
1042 Ga0207692_10004839
1043 Ga0207692_10022956
1044 Ga0207642_10000997
1045 Ga0207642_10007111
1046 Ga0207642_10034290
1047 Ga0207642_10216218
1048 Ga0207710_10001863
1049 Ga0207710_10003378
1050 Ga0207710_10004544
1051 Ga0207710_10048834
1052 Ga0207688_10000209
1053 Ga0207688_10004933
1054 Ga0207688_10126680
1055 Ga0207680_10030052
1056 Ga0207680_10033205
1057 Ga0207647_10015121
1058 Ga0207699_10006772
1059 Ga0207645_10000344
1060 Ga0207643_10000508
1061 Ga0207684_10098232
1062 Ga0207654_10016860
1063 Ga0207707_10009283
1064 Ga0207707_10163791
1065 Ga0207707_10355519
1066 Ga0207671_10134396
1067 Ga0207693_10030401
1068 Ga0207693_10087692
1069 Ga0207663_10035933
1070 Ga0207663_10249068
1071 Ga0207660_10012393
1072 Ga0207662_10006590
1073 Ga0207662_10049514
1074 Ga0207662_10183371
1075 Ga0207657_10001540
1076 Ga0207657_10177576
1077 Ga0207649_10001391
1078 Ga0207649_10032133
1079 Ga0207652_10003827
1080 Ga0207652_10202787
1081 Ga0207646_10047985
1082 Ga0207681_10006541
1083 Ga0207681_10008486
1084 Ga0207681_10228948
1085 Ga0207650_10029169
1086 Ga0207650_10043620
1087 Ga0207650_10074409
1088 Ga0207659_10001162
1089 Ga0207659_10012178
1090 Ga0207687_10002835
1091 Ga0207687_10015465
1092 Ga0207687_10055322
1093 Ga0207700_10004180
1094 Ga0207700_10012402
1095 Ga0207664_10039920
1096 Ga0207664_10154138
1097 Ga0207644_10001464
1098 Ga0207644_10009755
1099 Ga0207690_10040153
1100 Ga0207690_10046681
1101 Ga0207690_10061905
1102 Ga0207706_10000982
1103 Ga0207706_10031018
1104 Ga0207706_10074550
1105 Ga0207686_10001430
1106 Ga0207686_10029752
1107 Ga0207709_10001557
1108 Ga0207709_10005753
1109 Ga0207709_10031363
1110 Ga0207709_10035897
1111 Ga0207709_10094353
1112 Ga0207670_10000601
1113 Ga0207670_10014883
1114 Ga0207670_10039677
1115 Ga0207670_10327955
1116 Ga0207669_10003071
1117 Ga0207669_10020428
1118 Ga0207669_10069767
1119 Ga0207669_10073428
1120 Ga0207704_10001785
1121 Ga0207704_10005085
1122 Ga0207704_10006963
1123 Ga0207704_10243250
1124 Ga0207665_10008407
1125 Ga0207665_10021282
1126 Ga0207665_10140274
1127 Ga0207691_10000256
1128 Ga0207711_10006651
1129 Ga0207711_10024855
1130 Ga0207711_10081243
1131 Ga0207689_10000565
1132 Ga0207689_10050873
1133 Ga0207689_10184328
1134 Ga0207661_10137930
1135 Ga0207661_10172941
1136 Ga0207661_10249797
1137 Ga0207679_10000196
1138 Ga0207679_10110514
1139 Ga0207667_10263406
1140 Ga0207651_10010675
1141 Ga0207651_10042312
1142 Ga0207712_10002825
1143 Ga0207712_10010368
1144 Ga0207712_10011515
1145 Ga0207712_10320272
1146 Ga0207668_10002319
1147 Ga0207668_10007934
1148 Ga0207668_10022710
1149 Ga0207640_10003026
1150 Ga0207640_10035322
1151 Ga0207640_10365597
1152 Ga0207658_10007060
1153 Ga0207658_10015965
1154 Ga0207677_10033895
1155 Ga0207677_10073137
1156 Ga0207677_10088901
1157 Ga0207703_10007434
1158 Ga0207703_10020245
1159 Ga0207703_10023527
1160 Ga0207703_10245855
1161 Ga0207639_10030311
1162 Ga0207678_10028621
1163 Ga0207678_10076753
1164 Ga0207678_10139794
1165 Ga0207708_10000365
1166 Ga0207708_10017266
1167 Ga0207702_10007105
1168 Ga0207702_10281074
1169 Ga0207641_10002439
1170 Ga0207641_10037826
1171 Ga0207641_10136555
1172 Ga0207648_10000341
1173 Ga0207648_10068124
1174 Ga0207648_10132301
1175 Ga0207648_10136961
1176 Ga0207676_10003881
1177 Ga0207676_10004327
1178 Ga0207676_10092126
1179 Ga0207674_10001078
1180 Ga0207674_10381991
1181 Ga0207675_100006126
1182 Ga0207675_100007800
1183 Ga0207675_100009351
1184 Ga0207675_100059474
1185 Ga0207675_100325285
1186 Ga0207675_100343709
1187 Ga0207683_10000006
1188 Ga0207683_10061781
1189 Ga0207683_10071429
1190 Ga0207683_10242414
1191 Ga0207698_10003310
1192 Ga0209999_1013861
1193 Ga0209974_10004831
1194 Ga0207428_10000165
1195 Ga0207428_10000415
1196 Ga0268266_10058164
1197 Ga0268266_10307071
1198 Ga0268265_10001168
1199 Ga0268265_10083573
1200 Ga0268264_10010388
1201 Ga0268264_10087694
1202 Ga0307408_100150055
1203 Ga0307416_100030311
1204 Ga0307416_100060304
1205 Ga0307411_10163385
1206 Ga0373930_0001450
1207 Ga0373926_0009242
1208 Ga0373928_0001039
1209 Ga0373928_0003745
1210 Ga0373929_0017828
1211 Ga0373929_0033451
1212 Ga0373951_0006412
1213 Ga0373952_0004318
1214 Ga0373932_0031027
1215 Ga0373941_0002878
1216 Ga0373941_0061733
1217 Ga0373945_0030110
1218 Ga0373954_0003728
1219 Ga0373960_0001318
1220 Ga0373943_0010585
1221 Ga0373943_0021717
1222 Ga0373943_0162643
1223 Ga0373946_0006801
1224 Ga0373946_0099271
1225 Ga0373962_0006603
1226 Ga0373931_0000580
1227 Ga0373931_0058372
1228 Ga0373935_0006037
1229 Ga0373935_0014777
1230 Ga0373935_0161377
1231 Ga0373935_0215917
1232 Ga0373927_0005431
1233 Ga0373927_0039784
1234 Ga0373927_0045302
1235 Ga0373927_0048038
1236 Ga0373933_0011447
1237 Ga0373947_0007452
1238 Ga0373947_0017425
1239 Ga0373937_0001178
1240 Ga0373925_0020056
1241 Ga0373925_0055026
1242 Ga0373925_0062758
1243 Ga0373925_0254322
1244 Ga0439465_0049140
1245 Ga0439441_002230
1246 Ga0439443_005564
1247 Ga0439435_0003687
1248 Ga0439460_0005359
1249 Ga0451577_0274113
1250 Ga0451576_0064534
1251 Ga0451576_0214087
1252 Ga0451576_0395307
1253 Ga0495603_0030879
1254 Ga0495629_0000535
1255 Ga0495629_0019635
1256 Ga0495641_0028698
1257 Ga0495580_0160460
1258 Ga0495582_0015897
1259 Ga0495582_0087189
1260 Ga0495639_0018895
1261 Ga0495662_0021146
1262 Ga0495662_0045043
1263 Ga0495662_0050517
1264 Ga0495664_0047121
1265 Ga0495584_0027816
1266 Ga0495585_0013462
1267 Ga0495607_0023296
1268 Ga0495608_0128802
1269 Ga0495616_0105228
1270 Ga0495618_0186000
1271 Ga0495628_0068300
1272 Ga0495628_0119581
1273 Ga0495628_0302595
1274 Ga0495630_0019795
1275 Ga0495631_0044306
1276 Ga0495637_0022240
1277 Ga0495644_0026607
1278 Ga0495663_0043465
1279 Ga0495666_0126932
1280 Ga0495640_0022005
1281 Ga0495640_0076927
1282 Ga0495586_0016390
1283 Ga0495586_0048031
1284 Ga0495586_0077213
1285 Ga0495598_0001243
1286 Ga0495645_0114389
1287 Ga0495645_0173101
1288 Ga0495667_0007100
1289 Ga0495656_0001903
1290 Ga0495656_0005630
1291 Ga0495668_0042768
1292 Ga0495634_0042812
1293 Ga0495634_0081358
1294 Ga0495635_0049883
1295 Ga0495635_0170529
1296 Ga0495635_0200547
1297 Ga0495657_0083215
1298 Ga0495647_0003599
1299 Ga0495658_0000788
1300 Ga0495669_0003590
1301 Ga0495669_0108241
1302 Ga0495613_0063589
1303 Ga0495613_0085135
1304 Ga0495624_0055958
1305 Ga0495624_0088714
1306 Ga0495670_0000291
1307 Ga0495670_0060155
1308 Ga0495671_0031492
1309 Ga0495671_0123747
1310 Ga0495581_0064793
1311 Ga0495674_0089947
1312 Ga0495676_0056206
1313 Ga0495676_0226774
1314 Ga0495680_0007298
1315 Ga0495680_0008545
1316 Ga0495680_0190355
1317 Ga0495684_0003380
1318 Ga0495684_0107457
1319 Ga0495593_0006385
1320 Ga0496100_0006309
1321 Ga0496100_0007706
1322 Ga0496100_0045416
1323 Ga0496101_0001492
1324 Ga0496101_0001713
1325 Ga0496101_0033689
1326 Ga0496101_0054286
1327 Ga0496102_0005642
1328 Ga0496102_0041914
1329 Ga0496102_0106068
1330 Ga0496102_0443136
1331 Ga0496103_0000674
1332 Ga0496103_0009957
1333 Ga0496103_0021458
1334 Ga0496104_0051662
1335 Ga0496104_0438177
1336 Ga0496104_0439181
1337 Ga0496105_0122306
1338 Ga0496106_0002632
1339 Ga0496106_0005033
1340 Ga0496106_0010404
1341 Ga0496107_0000538
1342 Ga0496107_0005561
1343 Ga0496107_0083285
1344 Ga0496107_0165983
1345 Ga0496108_0009625
1346 Ga0496108_0015093
1347 Ga0496108_0040093
1348 Ga0496108_0078308
1349 Ga0496108_0324951
1350 Ga0496109_0003832
1351 Ga0496109_0007287
1352 Ga0496109_0112514
1353 Ga0496109_0154735
1354 Ga0496110_0003895
1355 Ga0496110_0071256
1356 Ga0496111_0008557
1357 Ga0496112_0013537
1358 Ga0496112_0024733
1359 Ga0496112_0092058
1360 Ga0496112_0234611
1361 Ga0496113_0003379
1362 Ga0496113_0079943
1363 Ga0496113_0091885
1364 Ga0496113_0204208
1365 Ga0496114_0003020
1366 Ga0496114_0016625
1367 Ga0496114_0055425
1368 Ga0496114_0153366
1369 Ga0496114_0393582
1370 Ga0496115_0003755
1371 Ga0496115_0009832
1372 Ga0496115_0053473
1373 Ga0496115_0061065
1374 Ga0496122_0002702
1375 Ga0496123_0003286
1376 Ga0501048_0154479
1377 Ga0501067_0177048
1378 Ga0501075_0229330
1379 Ga0501076_0301391
1380 nmdc:mga03683_152633_c1
1381 nmdc:mga00v17_1072_c1
1382 nmdc:mga00v17_13791_c1
1383 nmdc:mga00v17_79199_c1
1384 nmdc:mga0yw44_19727_c1
1385 nmdc:mga0yw44_38713_c1
1386 nmdc:mga0yw44_65068_c1
1387 nmdc:mga0k408_2954_c1
1388 nmdc:mga0k408_39395_c1
1389 nmdc:mga06z11_113284_c1
1390 nmdc:mga07m45_40036_c1
1391 nmdc:mga05p37_281_c1
1392 nmdc:mga05p37_290245_c1
1393 nmdc:mga05p37_938_c1
1394 nmdc:mga09592_3312_c1
1395 nmdc:mga09592_46739_c1
1396 nmdc:mga0qj67_12459_c1
1397 nmdc:mga0qj67_15384_c1
1398 nmdc:mga0qj67_360_c1
1399 nmdc:mga0qj67_64_c1
1400 nmdc:mga06r32_39213_c1
1401 nmdc:mga06r32_64124_c1
1402 nmdc:mga08y16_17462_c1
1403 nmdc:mga08y16_533807_c1
1404 nmdc:mga08y16_66405_c1
1405 nmdc:mga08y16_72896_c1
1406 nmdc:mga08y16_79184_c1
1407 nmdc:mga0n895_144185_c1
1408 nmdc:mga0n895_172724_c1
1409 nmdc:mga0n895_233375_c1
1410 nmdc:mga0n895_264356_c1
1411 nmdc:mga0n895_3233_c1
1412 nmdc:mga0n895_480619_c1
1413 nmdc:mga0n895_59737_c1
1414 nmdc:mga0n895_7959_c1
1415 nmdc:mga0rr50_122907_c1
1416 nmdc:mga0rr50_33190_c1
1417 nmdc:mga08x19_74750_c1
1418 nmdc:mga08x19_94095_c1
1419 nmdc:mga0a205_139893_c1
1420 nmdc:mga0a205_190143_c1
1421 nmdc:mga0a205_241126_c1
1422 nmdc:mga0a205_571_c1
1423 nmdc:mga0sz30_8257_c1
1424 Ga0495655_0027785
1425 Ga0495619_0000375
1426 Ga0500643_005183
1427 Ga0500644_0000896
1428 Ga0500641_0001181
1429 Ga0500556_0000102
1430 Ga0500593_006383
1431 Ga0500595_000002
1432 Ga0500616_0000002
1433 Ga0500616_0026393
1434 Ga0500645_000012
1435 Ga0500645_002615
1436 Ga0501084_0241406
1437 Ga0501082_0140671
1438 2828307626
1439 2881928520
1440 2919452744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

107

381

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9753 26 322
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9725 30 324
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9662 27 324
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9657 26 322
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.96 27 322
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.956 126 249 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9555 126 244 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9487 126 249 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9478 126 249 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9405 126 249 3.40.190.10
ID Description Score Start End GO Terms
AF-I3UD01-F1-model_v4 Extra-cytoplasmic solute receptor protein 0.9772 16 284
AF-V8QW12-F1-model_v4 ABC transporter substrate-binding protein 0.977 35 324
AF-A0A1W2AMJ1-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9765 18 324
AF-A0A5C8CF86-F1-model_v4 deleted 0.9757 37 324
AF-A0A536ZN56-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9745 18 324

Map