F477295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 720 | 388 | 1440 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300005840|Ga0068870_10219672|Ga0068870_102196722 |
| Length | 216 |
| Sequence | MKKIVIATNNVGKLNEIGAILAPLDIEIVAQSTLGVTEAAEPHCTFIENALAKARHASAQTGLPALADDSGICVDALNGAPGVHSARFAGESAQAAGGRASQDARNNQKLLDALAHETNRNAHYYCVIVLTRRADDPQPLVCEAEWHGEIVKTPRGSGGFGYDPLFLIPALNKTGAELGPEEKNRISHRGQALAALSAKLAGSRIEDRGSRTPRRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 82 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 169 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 170 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 210 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 213 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 214 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 219 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 220 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 221 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 224 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 225 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 228 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 229 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 230 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 231 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 232 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 233 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 236 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 239 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 321 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 325 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 327 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 329 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 331 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 333 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 337 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 340 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 341 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 342 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 343 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 344 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 345 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 346 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 347 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 348 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 349 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 350 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 351 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 352 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 353 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 354 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 355 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 356 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 357 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 358 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 359 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 360 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 361 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 362 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 363 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 364 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 365 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 366 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 367 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 368 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 369 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 370 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 371 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 372 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 373 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 374 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 375 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 376 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 377 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 378 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 379 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 380 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 381 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 382 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 383 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 384 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 385 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 386 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 387 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 388 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.06 |
| Metatranscriptomes | 0.56 |
| Isolates | 6.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.53 |
| Nodule | 0.56 |
| Rhizoplane | 1.94 |
| Rhizosphere | 60.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068870_10219672 | 3300005840 | Bacteria | 1162 |
| 2 | JGI24740J21852_10014457 | 3300001979 | Bacteria | 2911 |
| 3 | JGI25152J39213_1001872 | 3300002773 | Bacteria | 8458 |
| 4 | JGI25152J39213_1013199 | 3300002773 | Bacteria | 1732 |
| 5 | JGI25150J39212_1000863 | 3300002774 | Bacteria | 10077 |
| 6 | JGI25150J39212_1005077 | 3300002774 | Bacteria | 2845 |
| 7 | JGI25159J45721_1001848 | 3300002987 | Bacteria | 8458 |
| 8 | JGI25159J45721_1011405 | 3300002987 | Bacteria | 2181 |
| 9 | JGI25151J46595_10000224 | 3300003187 | Bacteria | 67033 |
| 10 | JGI25151J46595_10003612 | 3300003187 | Bacteria | 8458 |
| 11 | JGI25151J46595_10055825 | 3300003187 | Bacteria | 1300 |
| 12 | JGI25153J46596_10000570 | 3300003215 | Bacteria | 22743 |
| 13 | JGI25153J46596_10045861 | 3300003215 | Bacteria | 1300 |
| 14 | JGI25160J50197_1002537 | 3300003354 | Bacteria | 8458 |
| 15 | JGI25160J50197_1010940 | 3300003354 | Bacteria | 3252 |
| 16 | JGI25161J50226_1004265 | 3300003374 | Bacteria | 3032 |
| 17 | JGI25161J50226_1004510 | 3300003374 | Bacteria | 2903 |
| 18 | Ga0006562J51391_1130119 | 3300003578 | Bacteria | 1680 |
| 19 | Ga0006562J51391_1130120 | 3300003578 | Bacteria | 800 |
| 20 | Ga0006562J51391_1140775 | 3300003578 | Bacteria | 4680 |
| 21 | Ga0006562J51391_1140777 | 3300003578 | Bacteria | 4120 |
| 22 | Ga0055532_1009987 | 3300003758 | Bacteria | 1143 |
| 23 | Ga0055535_1000750 | 3300003761 | Bacteria | 24203 |
| 24 | Ga0055542_1000583 | 3300003762 | Bacteria | 31637 |
| 25 | Ga0055529_1001011 | 3300003763 | Bacteria | 13521 |
| 26 | Ga0055526_1003328 | 3300003771 | Bacteria | 10278 |
| 27 | Ga0055526_1006106 | 3300003771 | Bacteria | 6650 |
| 28 | Ga0055537_1000049 | 3300003773 | Bacteria | 87244 |
| 29 | Ga0055537_1002248 | 3300003773 | Bacteria | 6650 |
| 30 | Ga0055537_1014400 | 3300003773 | Bacteria | 1438 |
| 31 | Ga0055524_1002965 | 3300003775 | Bacteria | 8458 |
| 32 | Ga0055524_1003751 | 3300003775 | Bacteria | 7250 |
| 33 | Ga0055536_1002470 | 3300003781 | Bacteria | 10381 |
| 34 | Ga0055536_1008143 | 3300003781 | Bacteria | 4563 |
| 35 | Ga0055536_1008959 | 3300003781 | Bacteria | 4217 |
| 36 | Ga0055536_1057229 | 3300003781 | Bacteria | 823 |
| 37 | Ga0055534_1000049 | 3300003784 | Bacteria | 92974 |
| 38 | Ga0055534_1000343 | 3300003784 | Bacteria | 30091 |
| 39 | Ga0055534_1002329 | 3300003784 | Bacteria | 6650 |
| 40 | Ga0055534_1003905 | 3300003784 | Bacteria | 4518 |
| 41 | Ga0055528_1001187 | 3300003790 | Bacteria | 16830 |
| 42 | Ga0055528_1004551 | 3300003790 | Bacteria | 6650 |
| 43 | Ga0055528_1030326 | 3300003790 | Bacteria | 1438 |
| 44 | Ga0055530_10000318 | 3300003791 | Bacteria | 43641 |
| 45 | Ga0055530_10027635 | 3300003791 | Bacteria | 1546 |
| 46 | Ga0055530_10031974 | 3300003791 | Bacteria | 1374 |
| 47 | Ga0055540_1001928 | 3300003792 | Bacteria | 11588 |
| 48 | Ga0055540_1003384 | 3300003792 | Bacteria | 7728 |
| 49 | Ga0055540_1004195 | 3300003792 | Bacteria | 6636 |
| 50 | Ga0055540_1006573 | 3300003792 | Bacteria | 4583 |
| 51 | Ga0055540_1007675 | 3300003792 | Bacteria | 4022 |
| 52 | Ga0055540_1025065 | 3300003792 | Bacteria | 1467 |
| 53 | Ga0055540_1037495 | 3300003792 | Bacteria | 1068 |
| 54 | Ga0055531_10000738 | 3300003794 | Bacteria | 27594 |
| 55 | Ga0055531_10002357 | 3300003794 | Bacteria | 12698 |
| 56 | Ga0055531_10007991 | 3300003794 | Bacteria | 5658 |
| 57 | Ga0055531_10021737 | 3300003794 | Bacteria | 2475 |
| 58 | Ga0055543_1001645 | 3300004625 | Bacteria | 8512 |
| 59 | Ga0055543_1002190 | 3300004625 | Bacteria | 6700 |
| 60 | Ga0065165_1003399 | 3300005262 | Bacteria | 11243 |
| 61 | Ga0065714_10003219 | 3300005288 | Bacteria | 12731 |
| 62 | Ga0065704_10275364 | 3300005289 | Bacteria | 934 |
| 63 | Ga0070658_10220642 | 3300005327 | Bacteria | 1603 |
| 64 | Ga0070676_10304541 | 3300005328 | Bacteria | 1081 |
| 65 | Ga0070670_100194010 | 3300005331 | Bacteria | 1764 |
| 66 | Ga0070670_100465219 | 3300005331 | Bacteria | 1122 |
| 67 | Ga0070670_100570772 | 3300005331 | Bacteria | 1010 |
| 68 | Ga0068869_100821021 | 3300005334 | Bacteria | 800 |
| 69 | Ga0068868_100014255 | 3300005338 | Bacteria | 5854 |
| 70 | Ga0068868_100164794 | 3300005338 | Bacteria | 1832 |
| 71 | Ga0070661_100068133 | 3300005344 | Bacteria | 2616 |
| 72 | Ga0070692_10292517 | 3300005345 | Bacteria | 991 |
| 73 | Ga0070668_100111555 | 3300005347 | Bacteria | 2177 |
| 74 | Ga0070668_100130668 | 3300005347 | Bacteria | 2015 |
| 75 | Ga0070669_100043608 | 3300005353 | Bacteria | 3268 |
| 76 | Ga0070669_100131849 | 3300005353 | Bacteria | 1918 |
| 77 | Ga0070669_100262967 | 3300005353 | Bacteria | 1377 |
| 78 | Ga0070669_100361837 | 3300005353 | Bacteria | 1180 |
| 79 | Ga0070675_100041967 | 3300005354 | Bacteria | 3737 |
| 80 | Ga0070671_100129474 | 3300005355 | Bacteria | 2125 |
| 81 | Ga0070674_100318253 | 3300005356 | Bacteria | 1246 |
| 82 | Ga0070674_100612924 | 3300005356 | Bacteria | 921 |
| 83 | Ga0070673_100365501 | 3300005364 | Bacteria | 1283 |
| 84 | Ga0070667_100290148 | 3300005367 | Bacteria | 1471 |
| 85 | Ga0070701_10007392 | 3300005438 | Bacteria | 4691 |
| 86 | Ga0070700_100612691 | 3300005441 | Bacteria | 854 |
| 87 | Ga0070663_100197648 | 3300005455 | Bacteria | 1568 |
| 88 | Ga0070678_100028025 | 3300005456 | Bacteria | 3834 |
| 89 | Ga0070678_100049560 | 3300005456 | Bacteria | 3031 |
| 90 | Ga0070678_100052297 | 3300005456 | Bacteria | 2965 |
| 91 | Ga0070678_100454674 | 3300005456 | Bacteria | 1122 |
| 92 | Ga0070678_100506453 | 3300005456 | Bacteria | 1066 |
| 93 | Ga0070662_100026306 | 3300005457 | Bacteria | 4028 |
| 94 | Ga0068867_100168784 | 3300005459 | Bacteria | 1731 |
| 95 | Ga0068867_100259949 | 3300005459 | Bacteria | 1415 |
| 96 | Ga0068867_100423233 | 3300005459 | Bacteria | 1128 |
| 97 | Ga0068867_100687106 | 3300005459 | Bacteria | 902 |
| 98 | Ga0070685_10113354 | 3300005466 | Bacteria | 1674 |
| 99 | Ga0070706_100059087 | 3300005467 | Bacteria | 3539 |
| 100 | Ga0070698_100552296 | 3300005471 | Bacteria | 1091 |
| 101 | Ga0068853_100823620 | 3300005539 | Bacteria | 889 |
| 102 | Ga0070672_100295833 | 3300005543 | Bacteria | 1371 |
| 103 | Ga0070693_100830647 | 3300005547 | Bacteria | 687 |
| 104 | Ga0070665_100234720 | 3300005548 | Bacteria | 1834 |
| 105 | Ga0070665_100488021 | 3300005548 | Bacteria | 1243 |
| 106 | Ga0070665_100662473 | 3300005548 | Bacteria | 1057 |
| 107 | Ga0070704_100011744 | 3300005549 | Bacteria | 5383 |
| 108 | Ga0070704_100085589 | 3300005549 | Bacteria | 2333 |
| 109 | Ga0068855_100112017 | 3300005563 | Bacteria | 3131 |
| 110 | Ga0068855_100175809 | 3300005563 | Bacteria | 2423 |
| 111 | Ga0070664_100067201 | 3300005564 | Bacteria | 3064 |
| 112 | Ga0068857_100064951 | 3300005577 | Bacteria | 3245 |
| 113 | Ga0068854_100194092 | 3300005578 | Bacteria | 1592 |
| 114 | Ga0068854_100244746 | 3300005578 | Bacteria | 1430 |
| 115 | Ga0068856_100334978 | 3300005614 | Bacteria | 1531 |
| 116 | Ga0068864_100444163 | 3300005618 | Bacteria | 1239 |
| 117 | Ga0068864_100555712 | 3300005618 | Bacteria | 1110 |
| 118 | Ga0068866_10362257 | 3300005718 | Bacteria | 924 |
| 119 | Ga0068861_100026271 | 3300005719 | Bacteria | 4232 |
| 120 | Ga0068851_10011783 | 3300005834 | Bacteria | 4107 |
| 121 | Ga0068863_100047683 | 3300005841 | Bacteria | 4063 |
| 122 | Ga0068863_100132321 | 3300005841 | Bacteria | 2381 |
| 123 | Ga0068863_100155513 | 3300005841 | Bacteria | 2189 |
| 124 | Ga0068860_100114582 | 3300005843 | Bacteria | 2577 |
| 125 | Ga0068862_100109907 | 3300005844 | Bacteria | 2419 |
| 126 | Ga0068862_100427324 | 3300005844 | Bacteria | 1244 |
| 127 | Ga0075363_100017180 | 3300006048 | Bacteria | 3584 |
| 128 | Ga0075363_100065074 | 3300006048 | Bacteria | 1970 |
| 129 | Ga0075363_100171738 | 3300006048 | Bacteria | 1231 |
| 130 | Ga0075363_100264430 | 3300006048 | Bacteria | 993 |
| 131 | Ga0075363_100280042 | 3300006048 | Bacteria | 965 |
| 132 | Ga0075432_10074273 | 3300006058 | Bacteria | 1225 |
| 133 | Ga0075432_10108319 | 3300006058 | Bacteria | 1033 |
| 134 | Ga0075362_10002978 | 3300006177 | Bacteria | 5825 |
| 135 | Ga0075362_10013006 | 3300006177 | Bacteria | 3320 |
| 136 | Ga0075362_10019237 | 3300006177 | Bacteria | 2837 |
| 137 | Ga0075369_10218994 | 3300006186 | Bacteria | 881 |
| 138 | Ga0075366_10072694 | 3300006195 | Bacteria | 2049 |
| 139 | Ga0075366_10080886 | 3300006195 | Bacteria | 1940 |
| 140 | Ga0075366_10100065 | 3300006195 | Bacteria | 1739 |
| 141 | Ga0075366_10105913 | 3300006195 | Bacteria | 1690 |
| 142 | Ga0075366_10124003 | 3300006195 | Bacteria | 1558 |
| 143 | Ga0075366_10190135 | 3300006195 | Bacteria | 1248 |
| 144 | Ga0097621_100030530 | 3300006237 | Bacteria | 4267 |
| 145 | Ga0097621_100246691 | 3300006237 | Bacteria | 1563 |
| 146 | Ga0097621_100797262 | 3300006237 | Bacteria | 875 |
| 147 | Ga0075370_10001034 | 3300006353 | Bacteria | 11554 |
| 148 | Ga0075370_10003779 | 3300006353 | Bacteria | 7244 |
| 149 | Ga0075370_10023982 | 3300006353 | Bacteria | 3365 |
| 150 | Ga0075370_10065741 | 3300006353 | Bacteria | 2068 |
| 151 | Ga0075370_10071851 | 3300006353 | Bacteria | 1980 |
| 152 | Ga0068871_100033921 | 3300006358 | Bacteria | 4045 |
| 153 | Ga0068871_100615614 | 3300006358 | Bacteria | 989 |
| 154 | Ga0075430_100101548 | 3300006846 | Bacteria | 2401 |
| 155 | Ga0075431_100299414 | 3300006847 | Bacteria | 1625 |
| 156 | Ga0075434_100053749 | 3300006871 | Bacteria | 4002 |
| 157 | Ga0075429_100782157 | 3300006880 | Bacteria | 836 |
| 158 | Ga0075436_100622679 | 3300006914 | Bacteria | 796 |
| 159 | Ga0099826_10114653 | 3300006948 | Bacteria | 1599 |
| 160 | Ga0105244_10036366 | 3300009036 | Bacteria | 2580 |
| 161 | Ga0105244_10166189 | 3300009036 | Bacteria | 1052 |
| 162 | Ga0105245_10033012 | 3300009098 | Bacteria | 4584 |
| 163 | Ga0105243_10001140 | 3300009148 | Bacteria | 24116 |
| 164 | Ga0105243_10014072 | 3300009148 | Bacteria | 6054 |
| 165 | Ga0105243_10030230 | 3300009148 | Bacteria | 4168 |
| 166 | Ga0105241_10031745 | 3300009174 | Bacteria | 3955 |
| 167 | Ga0105242_10283450 | 3300009176 | Bacteria | 1506 |
| 168 | Ga0105242_11564768 | 3300009176 | Bacteria | 692 |
| 169 | Ga0105248_10206365 | 3300009177 | Bacteria | 2214 |
| 170 | Ga0105248_10561826 | 3300009177 | Bacteria | 1287 |
| 171 | Ga0105239_10577955 | 3300010375 | Bacteria | 1281 |
| 172 | Ga0105239_11018428 | 3300010375 | Bacteria | 952 |
| 173 | Ga0105246_10069698 | 3300011119 | Bacteria | 2471 |
| 174 | Ga0157347_1009909 | 3300012502 | Bacteria | 993 |
| 175 | Ga0157373_10095661 | 3300013100 | Bacteria | 2091 |
| 176 | Ga0157370_10002450 | 3300013104 | Bacteria | 22388 |
| 177 | Ga0157370_10240479 | 3300013104 | Bacteria | 1675 |
| 178 | Ga0157374_10180187 | 3300013296 | Bacteria | 2063 |
| 179 | Ga0163162_11125515 | 3300013306 | Bacteria | 890 |
| 180 | Ga0157375_10111027 | 3300013308 | Bacteria | 2840 |
| 181 | Ga0157375_10789500 | 3300013308 | Bacteria | 1099 |
| 182 | Ga0157375_10822204 | 3300013308 | Bacteria | 1077 |
| 183 | Ga0163163_10126096 | 3300014325 | Bacteria | 2598 |
| 184 | Ga0163163_10625101 | 3300014325 | Bacteria | 1140 |
| 185 | Ga0163163_10676364 | 3300014325 | Bacteria | 1096 |
| 186 | Ga0157380_10199150 | 3300014326 | Bacteria | 1775 |
| 187 | Ga0182008_10000225 | 3300014497 | Bacteria | 44301 |
| 188 | Ga0182008_10011230 | 3300014497 | Bacteria | 4772 |
| 189 | Ga0182008_10014507 | 3300014497 | Bacteria | 4125 |
| 190 | Ga0182008_10019854 | 3300014497 | Bacteria | 3464 |
| 191 | Ga0182008_10040078 | 3300014497 | Bacteria | 2340 |
| 192 | Ga0182008_10259584 | 3300014497 | Bacteria | 898 |
| 193 | Ga0157379_10014445 | 3300014968 | Bacteria | 6930 |
| 194 | Ga0157379_10512770 | 3300014968 | Bacteria | 1112 |
| 195 | Ga0157376_10038395 | 3300014969 | Bacteria | 3896 |
| 196 | Ga0157376_10082225 | 3300014969 | Bacteria | 2767 |
| 197 | Ga0157376_10354467 | 3300014969 | Bacteria | 1405 |
| 198 | Ga0157376_10405592 | 3300014969 | Bacteria | 1319 |
| 199 | Ga0157376_10940372 | 3300014969 | Bacteria | 884 |
| 200 | Ga0182006_1010162 | 3300015261 | Bacteria | 4195 |
| 201 | Ga0182006_1041803 | 3300015261 | Bacteria | 1798 |
| 202 | Ga0182007_10003534 | 3300015262 | Bacteria | 7361 |
| 203 | Ga0182007_10020624 | 3300015262 | Bacteria | 2353 |
| 204 | Ga0182005_1016595 | 3300015265 | Bacteria | 2046 |
| 205 | Ga0182005_1039584 | 3300015265 | Bacteria | 1282 |
| 206 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 207 | Ga0163161_10000114 | 3300017792 | Bacteria | 76397 |
| 208 | Ga0163161_10051863 | 3300017792 | Bacteria | 2973 |
| 209 | Ga0163161_10101427 | 3300017792 | Bacteria | 2143 |
| 210 | Ga0163161_10232667 | 3300017792 | Bacteria | 1430 |
| 211 | Ga0163161_10241309 | 3300017792 | Bacteria | 1405 |
| 212 | Ga0163161_10288442 | 3300017792 | Bacteria | 1289 |
| 213 | Ga0163161_10679700 | 3300017792 | Bacteria | 855 |
| 214 | Ga0163161_11266573 | 3300017792 | Bacteria | 640 |
| 215 | Ga0213872_10005990 | 3300021361 | Bacteria | 6162 |
| 216 | Ga0209672_100477 | 3300025228 | Bacteria | 22499 |
| 217 | Ga0209147_101499 | 3300025229 | Bacteria | 8245 |
| 218 | Ga0209258_100568 | 3300025242 | Bacteria | 31666 |
| 219 | Ga0207425_1000069 | 3300025245 | Bacteria | 120895 |
| 220 | Ga0207425_1007005 | 3300025245 | Bacteria | 3028 |
| 221 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 222 | Ga0209129_1000233 | 3300025258 | Bacteria | 61174 |
| 223 | Ga0209129_1001166 | 3300025258 | Bacteria | 15152 |
| 224 | Ga0209129_1006462 | 3300025258 | Bacteria | 3778 |
| 225 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 226 | Ga0209565_1000171 | 3300025263 | Bacteria | 84566 |
| 227 | Ga0209565_1007159 | 3300025263 | Bacteria | 3038 |
| 228 | Ga0209565_1047747 | 3300025263 | Bacteria | 778 |
| 229 | Ga0209455_1000819 | 3300025272 | Bacteria | 16921 |
| 230 | Ga0209673_1000295 | 3300025273 | Bacteria | 92499 |
| 231 | Ga0209673_1000301 | 3300025273 | Bacteria | 91435 |
| 232 | Ga0209673_1004394 | 3300025273 | Bacteria | 7572 |
| 233 | Ga0209673_1009432 | 3300025273 | Bacteria | 4226 |
| 234 | Ga0209673_1020108 | 3300025273 | Bacteria | 2373 |
| 235 | Ga0209673_1020941 | 3300025273 | Bacteria | 2300 |
| 236 | Ga0209130_1000193 | 3300025284 | Bacteria | 84550 |
| 237 | Ga0209130_1000366 | 3300025284 | Bacteria | 51201 |
| 238 | Ga0209130_1001843 | 3300025284 | Bacteria | 12207 |
| 239 | Ga0209130_1025709 | 3300025284 | Bacteria | 1272 |
| 240 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 241 | Ga0209675_1000236 | 3300025291 | Bacteria | 55143 |
| 242 | Ga0209675_1000582 | 3300025291 | Bacteria | 26359 |
| 243 | Ga0209675_1006428 | 3300025291 | Bacteria | 4709 |
| 244 | Ga0209675_1008038 | 3300025291 | Bacteria | 3940 |
| 245 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 246 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 247 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 248 | Ga0209676_1013512 | 3300025292 | Bacteria | 3136 |
| 249 | Ga0209676_1018047 | 3300025292 | Bacteria | 2473 |
| 250 | Ga0209676_1023673 | 3300025292 | Bacteria | 2005 |
| 251 | Ga0209676_1043481 | 3300025292 | Bacteria | 1239 |
| 252 | Ga0209676_1050949 | 3300025292 | Bacteria | 1088 |
| 253 | Ga0209025_1000204 | 3300025294 | Bacteria | 142193 |
| 254 | Ga0209025_1000264 | 3300025294 | Bacteria | 123411 |
| 255 | Ga0209025_1000348 | 3300025294 | Bacteria | 100228 |
| 256 | Ga0209025_1005823 | 3300025294 | Bacteria | 9873 |
| 257 | Ga0209025_1019355 | 3300025294 | Bacteria | 3789 |
| 258 | Ga0209025_1019870 | 3300025294 | Bacteria | 3710 |
| 259 | Ga0209564_1000231 | 3300025295 | Bacteria | 123417 |
| 260 | Ga0209564_1002077 | 3300025295 | Bacteria | 17219 |
| 261 | Ga0209758_1000222 | 3300025297 | Bacteria | 123411 |
| 262 | Ga0209758_1051551 | 3300025297 | Bacteria | 1431 |
| 263 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 264 | Ga0209050_1001339 | 3300025298 | Bacteria | 27306 |
| 265 | Ga0209050_1033105 | 3300025298 | Bacteria | 1574 |
| 266 | Ga0209050_1035197 | 3300025298 | Bacteria | 1484 |
| 267 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 268 | Ga0209256_1000284 | 3300025299 | Bacteria | 89178 |
| 269 | Ga0209256_1016014 | 3300025299 | Bacteria | 2583 |
| 270 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 271 | Ga0207426_1000349 | 3300025302 | Bacteria | 84546 |
| 272 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 273 | Ga0209051_1000091 | 3300025303 | Bacteria | 173683 |
| 274 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 275 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 276 | Ga0209051_1000342 | 3300025303 | Bacteria | 70022 |
| 277 | Ga0209051_1001310 | 3300025303 | Bacteria | 21859 |
| 278 | Ga0209051_1025182 | 3300025303 | Bacteria | 2428 |
| 279 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 280 | Ga0209257_1000497 | 3300025304 | Bacteria | 70185 |
| 281 | Ga0209257_1000677 | 3300025304 | Bacteria | 53181 |
| 282 | Ga0209257_1003804 | 3300025304 | Bacteria | 12416 |
| 283 | Ga0209257_1004226 | 3300025304 | Bacteria | 11372 |
| 284 | Ga0209257_1052704 | 3300025304 | Bacteria | 1141 |
| 285 | Ga0207656_10015819 | 3300025321 | Bacteria | 2926 |
| 286 | Ga0207655_1000675 | 3300025728 | Bacteria | 39901 |
| 287 | Ga0207682_10002543 | 3300025893 | Bacteria | 8137 |
| 288 | Ga0207682_10146311 | 3300025893 | Bacteria | 1063 |
| 289 | Ga0207688_10016415 | 3300025901 | Bacteria | 4016 |
| 290 | Ga0207680_10126640 | 3300025903 | Bacteria | 1677 |
| 291 | Ga0207645_10002306 | 3300025907 | Bacteria | 15080 |
| 292 | Ga0207645_10135701 | 3300025907 | Bacteria | 1602 |
| 293 | Ga0207643_10002326 | 3300025908 | Bacteria | 10344 |
| 294 | Ga0207662_10009379 | 3300025918 | Bacteria | 5382 |
| 295 | Ga0207652_10416497 | 3300025921 | Bacteria | 1212 |
| 296 | Ga0207681_10083126 | 3300025923 | Bacteria | 2265 |
| 297 | Ga0207681_10312177 | 3300025923 | Bacteria | 1247 |
| 298 | Ga0207681_10475956 | 3300025923 | Bacteria | 1019 |
| 299 | Ga0207650_10018089 | 3300025925 | Bacteria | 4941 |
| 300 | Ga0207650_10691507 | 3300025925 | Bacteria | 861 |
| 301 | Ga0207644_10127309 | 3300025931 | Bacteria | 1945 |
| 302 | Ga0207706_10015483 | 3300025933 | Bacteria | 6890 |
| 303 | Ga0207706_10035041 | 3300025933 | Bacteria | 4465 |
| 304 | Ga0207686_10335459 | 3300025934 | Bacteria | 1134 |
| 305 | Ga0207709_10000331 | 3300025935 | Bacteria | 50983 |
| 306 | Ga0207709_10000464 | 3300025935 | Bacteria | 37316 |
| 307 | Ga0207709_10008913 | 3300025935 | Bacteria | 5539 |
| 308 | Ga0207709_10100531 | 3300025935 | Bacteria | 1911 |
| 309 | Ga0207669_10102702 | 3300025937 | Bacteria | 1894 |
| 310 | Ga0207704_10797581 | 3300025938 | Bacteria | 788 |
| 311 | Ga0207691_10015351 | 3300025940 | Bacteria | 7286 |
| 312 | Ga0207691_10633910 | 3300025940 | Bacteria | 904 |
| 313 | Ga0207711_10129776 | 3300025941 | Bacteria | 2259 |
| 314 | Ga0207711_10285186 | 3300025941 | Bacteria | 1521 |
| 315 | Ga0207689_10007489 | 3300025942 | Bacteria | 9568 |
| 316 | Ga0207689_10100011 | 3300025942 | Bacteria | 2383 |
| 317 | Ga0207689_10588989 | 3300025942 | Bacteria | 935 |
| 318 | Ga0207679_10074547 | 3300025945 | Bacteria | 2572 |
| 319 | Ga0207667_10099672 | 3300025949 | Bacteria | 2997 |
| 320 | Ga0207667_10109713 | 3300025949 | Bacteria | 2846 |
| 321 | Ga0207651_10019609 | 3300025960 | Bacteria | 4058 |
| 322 | Ga0207651_10072831 | 3300025960 | Bacteria | 2441 |
| 323 | Ga0207651_10206224 | 3300025960 | Bacteria | 1579 |
| 324 | Ga0207640_10482424 | 3300025981 | Bacteria | 1029 |
| 325 | Ga0207658_10116126 | 3300025986 | Bacteria | 2125 |
| 326 | Ga0207658_10255627 | 3300025986 | Bacteria | 1490 |
| 327 | Ga0207658_10865360 | 3300025986 | Bacteria | 822 |
| 328 | Ga0207677_10018143 | 3300026023 | Bacteria | 4217 |
| 329 | Ga0207677_10288768 | 3300026023 | Bacteria | 1350 |
| 330 | Ga0207639_10020870 | 3300026041 | Bacteria | 4697 |
| 331 | Ga0207708_10002353 | 3300026075 | Bacteria | 13889 |
| 332 | Ga0207702_10667621 | 3300026078 | Bacteria | 1023 |
| 333 | Ga0207702_10725298 | 3300026078 | Bacteria | 980 |
| 334 | Ga0207641_10129708 | 3300026088 | Bacteria | 2262 |
| 335 | Ga0207641_10434966 | 3300026088 | Bacteria | 1265 |
| 336 | Ga0207648_10003860 | 3300026089 | Bacteria | 15650 |
| 337 | Ga0207676_10681670 | 3300026095 | Bacteria | 994 |
| 338 | Ga0207674_10100238 | 3300026116 | Bacteria | 2878 |
| 339 | Ga0207674_10122845 | 3300026116 | Bacteria | 2562 |
| 340 | Ga0207674_10269315 | 3300026116 | Bacteria | 1651 |
| 341 | Ga0207674_10328358 | 3300026116 | Bacteria | 1479 |
| 342 | Ga0207675_100010756 | 3300026118 | Bacteria | 8574 |
| 343 | Ga0207683_10003766 | 3300026121 | Bacteria | 13151 |
| 344 | Ga0207683_10085145 | 3300026121 | Bacteria | 2810 |
| 345 | Ga0207683_10092950 | 3300026121 | Bacteria | 2688 |
| 346 | Ga0207683_10377433 | 3300026121 | Bacteria | 1303 |
| 347 | Ga0207683_10427315 | 3300026121 | Bacteria | 1220 |
| 348 | Ga0207698_10219338 | 3300026142 | Bacteria | 1717 |
| 349 | Ga0209282_1005738 | 3300027666 | Bacteria | 7658 |
| 350 | Ga0209282_1093813 | 3300027666 | Bacteria | 1565 |
| 351 | Ga0268266_10200059 | 3300028379 | Bacteria | 1828 |
| 352 | Ga0268266_10313833 | 3300028379 | Bacteria | 1465 |
| 353 | Ga0268265_10021322 | 3300028380 | Bacteria | 4537 |
| 354 | Ga0265318_10005954 | 3300028577 | Bacteria | 5667 |
| 355 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 356 | Ga0307515_10099599 | 3300028794 | Bacteria | 3527 |
| 357 | Ga0316177_1099357 | 3300030731 | Bacteria | 1064 |
| 358 | Ga0316176_1067430 | 3300030732 | Bacteria | 2291 |
| 359 | Ga0316183_1086557 | 3300030742 | Bacteria | 14600 |
| 360 | Ga0265330_10019471 | 3300031235 | Bacteria | 3110 |
| 361 | Ga0265330_10025206 | 3300031235 | Bacteria | 2696 |
| 362 | Ga0265332_10000029 | 3300031238 | Bacteria | 180902 |
| 363 | Ga0265332_10000398 | 3300031238 | Bacteria | 31536 |
| 364 | Ga0265328_10000020 | 3300031239 | Bacteria | 125715 |
| 365 | Ga0265328_10011318 | 3300031239 | Bacteria | 3569 |
| 366 | Ga0265328_10040694 | 3300031239 | Bacteria | 1712 |
| 367 | Ga0265320_10033514 | 3300031240 | Bacteria | 2622 |
| 368 | Ga0265320_10141019 | 3300031240 | Bacteria | 1092 |
| 369 | Ga0265329_10004474 | 3300031242 | Bacteria | 5803 |
| 370 | Ga0265329_10034834 | 3300031242 | Unclassified | 1626 |
| 371 | Ga0265340_10217061 | 3300031247 | Bacteria | 857 |
| 372 | Ga0265339_10060614 | 3300031249 | Bacteria | 2039 |
| 373 | Ga0265331_10021074 | 3300031250 | Bacteria | 3338 |
| 374 | Ga0265331_10053388 | 3300031250 | Bacteria | 1928 |
| 375 | Ga0265327_10000746 | 3300031251 | Bacteria | 50605 |
| 376 | Ga0265327_10001767 | 3300031251 | Bacteria | 25537 |
| 377 | Ga0265327_10021084 | 3300031251 | Bacteria | 3944 |
| 378 | Ga0265327_10044923 | 3300031251 | Bacteria | 2351 |
| 379 | Ga0265327_10052990 | 3300031251 | Bacteria | 2108 |
| 380 | Ga0265316_10030433 | 3300031344 | Bacteria | 4425 |
| 381 | Ga0265316_10048756 | 3300031344 | Bacteria | 3341 |
| 382 | Ga0265316_10139021 | 3300031344 | Bacteria | 1826 |
| 383 | Ga0265316_10141935 | 3300031344 | Bacteria | 1803 |
| 384 | Ga0307513_10113647 | 3300031456 | Bacteria | 2695 |
| 385 | Ga0307513_10175863 | 3300031456 | Bacteria | 2011 |
| 386 | Ga0307513_10313467 | 3300031456 | Bacteria | 1330 |
| 387 | Ga0307408_100003650 | 3300031548 | Bacteria | 10489 |
| 388 | Ga0307408_100051116 | 3300031548 | Bacteria | 2975 |
| 389 | Ga0307408_100053852 | 3300031548 | Bacteria | 2907 |
| 390 | Ga0307408_100076112 | 3300031548 | Bacteria | 2495 |
| 391 | Ga0307408_101162263 | 3300031548 | Bacteria | 718 |
| 392 | Ga0265313_10075381 | 3300031595 | Bacteria | 1544 |
| 393 | Ga0307514_10008104 | 3300031649 | Bacteria | 8984 |
| 394 | Ga0265314_10005578 | 3300031711 | Bacteria | 11314 |
| 395 | Ga0265342_10008414 | 3300031712 | Bacteria | 7396 |
| 396 | Ga0307516_10077116 | 3300031730 | Bacteria | 3182 |
| 397 | Ga0307516_10126631 | 3300031730 | Bacteria | 2338 |
| 398 | Ga0307405_10012930 | 3300031731 | Bacteria | 4438 |
| 399 | Ga0307405_10027530 | 3300031731 | Bacteria | 3297 |
| 400 | Ga0307405_10280752 | 3300031731 | Bacteria | 1253 |
| 401 | Ga0307405_10546594 | 3300031731 | Bacteria | 936 |
| 402 | Ga0307405_10641943 | 3300031731 | Bacteria | 872 |
| 403 | Ga0307405_10695234 | 3300031731 | Bacteria | 841 |
| 404 | Ga0307405_11133808 | 3300031731 | Bacteria | 673 |
| 405 | Ga0307413_10055028 | 3300031824 | Bacteria | 2418 |
| 406 | Ga0307413_10434456 | 3300031824 | Bacteria | 1038 |
| 407 | Ga0307406_10000324 | 3300031901 | Bacteria | 27796 |
| 408 | Ga0307406_10059024 | 3300031901 | Bacteria | 2468 |
| 409 | Ga0307406_10235516 | 3300031901 | Bacteria | 1370 |
| 410 | Ga0307406_10260938 | 3300031901 | Bacteria | 1311 |
| 411 | Ga0307406_10316864 | 3300031901 | Bacteria | 1205 |
| 412 | Ga0307406_10750741 | 3300031901 | Bacteria | 819 |
| 413 | Ga0307407_10445024 | 3300031903 | Bacteria | 939 |
| 414 | Ga0307412_10030197 | 3300031911 | Bacteria | 3409 |
| 415 | Ga0307412_10043892 | 3300031911 | Bacteria | 2914 |
| 416 | Ga0307412_10077823 | 3300031911 | Bacteria | 2282 |
| 417 | Ga0307412_10102742 | 3300031911 | Bacteria | 2024 |
| 418 | Ga0307412_10247791 | 3300031911 | Bacteria | 1382 |
| 419 | Ga0307409_101043332 | 3300031995 | Bacteria | 837 |
| 420 | Ga0307416_100010896 | 3300032002 | Bacteria | 6030 |
| 421 | Ga0307414_10078062 | 3300032004 | Bacteria | 2412 |
| 422 | Ga0307414_10610220 | 3300032004 | Bacteria | 979 |
| 423 | Ga0307414_10710933 | 3300032004 | Bacteria | 910 |
| 424 | Ga0307411_10001615 | 3300032005 | Bacteria | 9387 |
| 425 | Ga0307411_10027661 | 3300032005 | Bacteria | 3435 |
| 426 | Ga0307411_10578154 | 3300032005 | Bacteria | 963 |
| 427 | Ga0307415_100393587 | 3300032126 | Bacteria | 1181 |
| 428 | Ga0316583_10017757 | 3300032133 | Bacteria | 2556 |
| 429 | Ga0373932_0127620 | 3300035112 | Bacteria | 854 |
| 430 | Ga0373931_0032340 | 3300035691 | Bacteria | 2707 |
| 431 | Ga0373931_0059932 | 3300035691 | Bacteria | 2048 |
| 432 | Ga0373933_0563865 | 3300035724 | Bacteria | 747 |
| 433 | Ga0373937_0627494 | 3300036401 | Bacteria | 1020 |
| 434 | Ga0373925_0280497 | 3300037068 | Bacteria | 1342 |
| 435 | Ga0395899_0001018 | 3300037312 | Bacteria | 25619 |
| 436 | Ga0395899_0322141 | 3300037312 | Bacteria | 1041 |
| 437 | Ga0395899_0455726 | 3300037312 | Bacteria | 837 |
| 438 | Ga0395900_0040394 | 3300037418 | Bacteria | 4808 |
| 439 | Ga0395900_0216421 | 3300037418 | Bacteria | 1933 |
| 440 | Ga0395898_0008698 | 3300037466 | Bacteria | 10712 |
| 441 | Ga0395898_0107645 | 3300037466 | Bacteria | 2673 |
| 442 | Ga0395898_0199014 | 3300037466 | Bacteria | 1913 |
| 443 | Ga0395905_0002817 | 3300037471 | Bacteria | 19057 |
| 444 | Ga0395905_0004508 | 3300037471 | Bacteria | 14433 |
| 445 | Ga0395905_0008661 | 3300037471 | Bacteria | 10021 |
| 446 | Ga0395905_0052347 | 3300037471 | Bacteria | 3822 |
| 447 | Ga0395905_0065940 | 3300037471 | Bacteria | 3390 |
| 448 | Ga0395905_0089643 | 3300037471 | Bacteria | 2882 |
| 449 | Ga0395905_0206749 | 3300037471 | Bacteria | 1840 |
| 450 | Ga0395905_0228685 | 3300037471 | Bacteria | 1739 |
| 451 | Ga0395905_0795698 | 3300037471 | Bacteria | 848 |
| 452 | Ga0395905_0834446 | 3300037471 | Bacteria | 824 |
| 453 | Ga0395901_0022637 | 3300038443 | Bacteria | 6441 |
| 454 | Ga0395901_0097141 | 3300038443 | Bacteria | 3087 |
| 455 | Ga0395901_0366817 | 3300038443 | Bacteria | 1484 |
| 456 | Ga0400490_08919 | 3300038726 | Bacteria | 7346 |
| 457 | Ga0400483_079146 | 3300039062 | Bacteria | 1018 |
| 458 | Ga0436361_0837231 | 3300039447 | Bacteria | 44100 |
| 459 | Ga0439436_0000586 | 3300041404 | Bacteria | 9641 |
| 460 | Ga0439436_0003260 | 3300041404 | Bacteria | 4920 |
| 461 | Ga0439436_0053662 | 3300041404 | Bacteria | 1135 |
| 462 | Ga0439439_0007617 | 3300041406 | Bacteria | 2537 |
| 463 | Ga0439439_0012633 | 3300041406 | Bacteria | 2044 |
| 464 | Ga0439447_031943 | 3300041407 | Bacteria | 1319 |
| 465 | Ga0439447_074976 | 3300041407 | Bacteria | 784 |
| 466 | Ga0439447_080230 | 3300041407 | Bacteria | 754 |
| 467 | Ga0439461_0001667 | 3300041410 | Bacteria | 3459 |
| 468 | Ga0439466_0016222 | 3300041411 | Bacteria | 2696 |
| 469 | Ga0439466_0093318 | 3300041411 | Bacteria | 942 |
| 470 | Ga0439465_0000571 | 3300041413 | Bacteria | 11082 |
| 471 | Ga0451841_1087416 | 3300041498 | Bacteria | 708 |
| 472 | Ga0439431_0000218 | 3300041997 | Bacteria | 11553 |
| 473 | Ga0439431_0023674 | 3300041997 | Bacteria | 1489 |
| 474 | Ga0439431_0045506 | 3300041997 | Bacteria | 1127 |
| 475 | Ga0439437_023326 | 3300042000 | Bacteria | 756 |
| 476 | Ga0439442_014583 | 3300042002 | Bacteria | 1618 |
| 477 | Ga0439445_0005073 | 3300042004 | Bacteria | 2991 |
| 478 | Ga0439445_0060743 | 3300042004 | Bacteria | 1033 |
| 479 | Ga0439445_0100640 | 3300042004 | Bacteria | 819 |
| 480 | Ga0439432_000464 | 3300042006 | Bacteria | 15181 |
| 481 | Ga0439432_013370 | 3300042006 | Bacteria | 2793 |
| 482 | Ga0439449_0001782 | 3300042007 | Bacteria | 8471 |
| 483 | Ga0439449_0002685 | 3300042007 | Bacteria | 6926 |
| 484 | Ga0439449_0232706 | 3300042007 | Bacteria | 692 |
| 485 | Ga0439452_009991 | 3300042010 | Bacteria | 2776 |
| 486 | Ga0439455_0031067 | 3300042012 | Bacteria | 1328 |
| 487 | Ga0439457_021851 | 3300042014 | Bacteria | 1417 |
| 488 | Ga0439457_039645 | 3300042014 | Bacteria | 1049 |
| 489 | Ga0439457_045282 | 3300042014 | Bacteria | 983 |
| 490 | Ga0439457_067131 | 3300042014 | Bacteria | 815 |
| 491 | Ga0439462_0001912 | 3300042015 | Bacteria | 4743 |
| 492 | Ga0439462_0006154 | 3300042015 | Bacteria | 2976 |
| 493 | Ga0439462_0007329 | 3300042015 | Bacteria | 2759 |
| 494 | Ga0439462_0029151 | 3300042015 | Bacteria | 1460 |
| 495 | Ga0439462_0033550 | 3300042015 | Bacteria | 1361 |
| 496 | Ga0450911_000496 | 3300042115 | Bacteria | 12520 |
| 497 | Ga0450919_008525 | 3300042121 | Bacteria | 1184 |
| 498 | Ga0450894_011246 | 3300042131 | Bacteria | 1165 |
| 499 | Ga0450906_014085 | 3300042145 | Bacteria | 1467 |
| 500 | Ga0450910_001247 | 3300042147 | Bacteria | 3169 |
| 501 | Ga0439446_0088038 | 3300042156 | Bacteria | 969 |
| 502 | Ga0439446_0219893 | 3300042156 | Bacteria | 647 |
| 503 | Ga0450908_004376 | 3300042184 | Bacteria | 2724 |
| 504 | Ga0450909_014761 | 3300042185 | Bacteria | 1150 |
| 505 | Ga0450909_026382 | 3300042185 | Bacteria | 876 |
| 506 | Ga0439434_0000517 | 3300042435 | Bacteria | 10981 |
| 507 | Ga0439434_0009050 | 3300042435 | Bacteria | 2927 |
| 508 | Ga0439460_0030740 | 3300042461 | Bacteria | 1529 |
| 509 | Ga0450918_006667 | 3300042531 | Bacteria | 2054 |
| 510 | Ga0450918_024708 | 3300042531 | Bacteria | 1051 |
| 511 | Ga0451577_0035717 | 3300042876 | Bacteria | 4477 |
| 512 | Ga0451577_0073800 | 3300042876 | Bacteria | 3044 |
| 513 | Ga0451577_0101455 | 3300042876 | Bacteria | 2571 |
| 514 | Ga0466969_0021587 | 3300044656 | Bacteria | 3328 |
| 515 | Ga0466969_0038894 | 3300044656 | Bacteria | 2391 |
| 516 | Ga0453683_0006241 | 3300044673 | Bacteria | 8196 |
| 517 | Ga0466965_0370169 | 3300044683 | Bacteria | 787 |
| 518 | Ga0466966_0138717 | 3300044684 | Bacteria | 1487 |
| 519 | Ga0466961_0099502 | 3300044693 | Bacteria | 1832 |
| 520 | Ga0453684_0449119 | 3300044712 | Bacteria | 1435 |
| 521 | Ga0453684_1575430 | 3300044712 | Bacteria | 675 |
| 522 | Ga0466970_0037823 | 3300044765 | Bacteria | 2559 |
| 523 | Ga0466957_0396785 | 3300044842 | Bacteria | 943 |
| 524 | Ga0466960_0265159 | 3300044901 | Bacteria | 958 |
| 525 | Ga0466960_0539891 | 3300044901 | Bacteria | 687 |
| 526 | Ga0466959_0036604 | 3300045049 | Bacteria | 3626 |
| 527 | Ga0466959_0454665 | 3300045049 | Bacteria | 868 |
| 528 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 529 | Ga0451576_0017383 | 3300045051 | Bacteria | 7907 |
| 530 | Ga0451576_0609279 | 3300045051 | Bacteria | 1148 |
| 531 | Ga0495627_057008 | 3300046453 | Bacteria | 1163 |
| 532 | Ga0495590_0080524 | 3300046457 | Bacteria | 1147 |
| 533 | Ga0495629_0211632 | 3300046459 | Bacteria | 1339 |
| 534 | Ga0495638_0019572 | 3300046460 | Bacteria | 4478 |
| 535 | Ga0495610_0021660 | 3300046512 | Bacteria | 3528 |
| 536 | Ga0495616_0003870 | 3300046513 | Bacteria | 9542 |
| 537 | Ga0495631_0000163 | 3300046518 | Bacteria | 45348 |
| 538 | Ga0495637_0006475 | 3300046520 | Bacteria | 5874 |
| 539 | Ga0495663_0037328 | 3300046525 | Bacteria | 1465 |
| 540 | Ga0495642_0081622 | 3300046528 | Bacteria | 1362 |
| 541 | Ga0495654_0022427 | 3300046530 | Bacteria | 3279 |
| 542 | Ga0495654_0201393 | 3300046530 | Bacteria | 852 |
| 543 | Ga0495622_0262361 | 3300046557 | Bacteria | 758 |
| 544 | Ga0495633_0148210 | 3300046558 | Bacteria | 1084 |
| 545 | Ga0495656_0000163 | 3300046615 | Bacteria | 24459 |
| 546 | Ga0495656_0111103 | 3300046615 | Bacteria | 1282 |
| 547 | Ga0495656_0124913 | 3300046615 | Bacteria | 1219 |
| 548 | Ga0495625_0000045 | 3300046660 | Bacteria | 202475 |
| 549 | Ga0495625_0060501 | 3300046660 | Bacteria | 2683 |
| 550 | Ga0495588_0255079 | 3300046674 | Bacteria | 924 |
| 551 | Ga0495658_0115048 | 3300046683 | Bacteria | 1621 |
| 552 | Ga0495670_0100652 | 3300046691 | Bacteria | 1488 |
| 553 | Ga0495671_0015415 | 3300046692 | Bacteria | 4093 |
| 554 | Ga0495660_0045443 | 3300046810 | Bacteria | 2411 |
| 555 | Ga0495676_0058877 | 3300047321 | Bacteria | 3020 |
| 556 | Ga0495681_0253262 | 3300047470 | Bacteria | 694 |
| 557 | Ga0495593_0002104 | 3300047673 | Bacteria | 11902 |
| 558 | Ga0495614_0088545 | 3300048089 | Bacteria | 1345 |
| 559 | Ga0496100_0099001 | 3300048903 | Bacteria | 2005 |
| 560 | Ga0496101_0003542 | 3300048904 | Bacteria | 9742 |
| 561 | Ga0496101_0059835 | 3300048904 | Bacteria | 2762 |
| 562 | Ga0496102_0008409 | 3300048905 | Bacteria | 8842 |
| 563 | Ga0496102_0266002 | 3300048905 | Bacteria | 1617 |
| 564 | Ga0496104_0116799 | 3300048907 | Bacteria | 2560 |
| 565 | Ga0496105_0050318 | 3300048908 | Bacteria | 3441 |
| 566 | Ga0496108_0221492 | 3300048911 | Bacteria | 1644 |
| 567 | Ga0496110_0013319 | 3300048913 | Bacteria | 6795 |
| 568 | Ga0496111_0400359 | 3300048914 | Bacteria | 1014 |
| 569 | Ga0496114_0371118 | 3300048917 | Bacteria | 1266 |
| 570 | Ga0496116_0064554 | 3300048919 | Bacteria | 2353 |
| 571 | Ga0496116_0158318 | 3300048919 | Bacteria | 1246 |
| 572 | Ga0496117_0028929 | 3300048920 | Bacteria | 4281 |
| 573 | Ga0496117_0059066 | 3300048920 | Bacteria | 2652 |
| 574 | Ga0496117_0112317 | 3300048920 | Bacteria | 1694 |
| 575 | Ga0496118_0032009 | 3300048921 | Bacteria | 4344 |
| 576 | Ga0496118_0282758 | 3300048921 | Bacteria | 922 |
| 577 | Ga0496118_0297641 | 3300048921 | Bacteria | 888 |
| 578 | Ga0496119_0162441 | 3300048922 | Bacteria | 1186 |
| 579 | Ga0496121_0006773 | 3300048924 | Bacteria | 14053 |
| 580 | Ga0496121_0094623 | 3300048924 | Bacteria | 2323 |
| 581 | Ga0496121_0146946 | 3300048924 | Bacteria | 1740 |
| 582 | Ga0496121_0269007 | 3300048924 | Bacteria | 1172 |
| 583 | Ga0496121_0316496 | 3300048924 | Bacteria | 1052 |
| 584 | Ga0496122_0000331 | 3300048925 | Bacteria | 102617 |
| 585 | Ga0496122_0133772 | 3300048925 | Bacteria | 1568 |
| 586 | Ga0496122_0162021 | 3300048925 | Bacteria | 1362 |
| 587 | Ga0496122_0367184 | 3300048925 | Bacteria | 744 |
| 588 | Ga0496122_0367425 | 3300048925 | Bacteria | 744 |
| 589 | Ga0496123_0000124 | 3300048926 | Bacteria | 158327 |
| 590 | Ga0496123_0040092 | 3300048926 | Bacteria | 3268 |
| 591 | Ga0496123_0042013 | 3300048926 | Bacteria | 3162 |
| 592 | Ga0496123_0161843 | 3300048926 | Bacteria | 1192 |
| 593 | Ga0496124_0052777 | 3300048927 | Bacteria | 3452 |
| 594 | Ga0496124_0141472 | 3300048927 | Bacteria | 1898 |
| 595 | Ga0496124_0183400 | 3300048927 | Bacteria | 1608 |
| 596 | Ga0496125_0014888 | 3300048928 | Bacteria | 7553 |
| 597 | Ga0496125_0032434 | 3300048928 | Bacteria | 4640 |
| 598 | Ga0496125_0032803 | 3300048928 | Bacteria | 4607 |
| 599 | Ga0496125_0056027 | 3300048928 | Bacteria | 3205 |
| 600 | Ga0496125_0128324 | 3300048928 | Bacteria | 1791 |
| 601 | Ga0496125_0202642 | 3300048928 | Bacteria | 1297 |
| 602 | Ga0496126_0385908 | 3300048929 | Bacteria | 1139 |
| 603 | Ga0496126_0427765 | 3300048929 | Bacteria | 1069 |
| 604 | Ga0495678_120977 | 3300049459 | Bacteria | 879 |
| 605 | Ga0501032_0279026 | 3300049569 | Bacteria | 1082 |
| 606 | Ga0501033_0179328 | 3300049570 | Bacteria | 1519 |
| 607 | Ga0501033_0222049 | 3300049570 | Bacteria | 1345 |
| 608 | Ga0501034_0028787 | 3300049571 | Bacteria | 5652 |
| 609 | Ga0501034_0957112 | 3300049571 | Bacteria | 742 |
| 610 | Ga0501036_0544306 | 3300049572 | Bacteria | 965 |
| 611 | Ga0501043_0493917 | 3300049579 | Bacteria | 915 |
| 612 | Ga0501047_0050858 | 3300049581 | Bacteria | 4002 |
| 613 | Ga0501047_0072718 | 3300049581 | Bacteria | 3309 |
| 614 | Ga0501047_0360049 | 3300049581 | Bacteria | 1291 |
| 615 | Ga0501072_0702415 | 3300049588 | Bacteria | 795 |
| 616 | Ga0501080_0122319 | 3300049742 | Bacteria | 2411 |
| 617 | Ga0501262_000120 | 3300049759 | Bacteria | 9771 |
| 618 | Ga0501035_0009745 | 3300049822 | Bacteria | 8934 |
| 619 | Ga0501035_0166450 | 3300049822 | Bacteria | 1906 |
| 620 | Ga0501044_0005907 | 3300049823 | Bacteria | 13556 |
| 621 | Ga0501044_0504748 | 3300049823 | Bacteria | 1110 |
| 622 | nmdc:mga03683_3109_c1 | 3300050489 | Bacteria | 5281 |
| 623 | nmdc:mga03n38_221925_c1 | 3300050490 | Bacteria | 987 |
| 624 | nmdc:mga03n38_97708_c1 | 3300050490 | Bacteria | 1411 |
| 625 | nmdc:mga00v17_193484_c1 | 3300050491 | Bacteria | 1314 |
| 626 | nmdc:mga0yw44_22552_c1 | 3300050492 | Bacteria | 3532 |
| 627 | nmdc:mga0yw44_284841_c1 | 3300050492 | Bacteria | 1105 |
| 628 | nmdc:mga0k408_290334_c1 | 3300050493 | Bacteria | 976 |
| 629 | nmdc:mga0k408_78444_c1 | 3300050493 | Bacteria | 1932 |
| 630 | nmdc:mga0k408_79978_c1 | 3300050493 | Bacteria | 1913 |
| 631 | nmdc:mga06z11_193123_c1 | 3300050494 | Bacteria | 1179 |
| 632 | nmdc:mga06z11_301054_c1 | 3300050494 | Bacteria | 953 |
| 633 | nmdc:mga06z11_459275_c1 | 3300050494 | Bacteria | 770 |
| 634 | nmdc:mga07m45_17711_c1 | 3300050496 | Bacteria | 3832 |
| 635 | nmdc:mga07m45_29343_c2 | 3300050496 | Bacteria | 2027 |
| 636 | nmdc:mga07m45_297175_c1 | 3300050496 | Bacteria | 939 |
| 637 | nmdc:mga07m45_5781_c1 | 3300050496 | Bacteria | 6196 |
| 638 | nmdc:mga07m45_605_c1 | 3300050496 | Bacteria | 15256 |
| 639 | nmdc:mga07m45_62136_c1 | 3300050496 | Bacteria | 2116 |
| 640 | nmdc:mga07m45_8102_c1 | 3300050496 | Bacteria | 5387 |
| 641 | nmdc:mga09592_673856_c1 | 3300050508 | Bacteria | 882 |
| 642 | nmdc:mga0qj67_671149_c1 | 3300050509 | Bacteria | 826 |
| 643 | nmdc:mga0n895_950962_c1 | 3300050512 | Bacteria | 842 |
| 644 | nmdc:mga08x19_556076_c1 | 3300050514 | Bacteria | 812 |
| 645 | Ga0500610_0000014 | 3300053079 | Bacteria | 84868 |
| 646 | Ga0500610_0000021 | 3300053079 | Bacteria | 66361 |
| 647 | Ga0500643_025509 | 3300053087 | Bacteria | 1862 |
| 648 | Ga0500651_0000560 | 3300053093 | Bacteria | 18911 |
| 649 | Ga0500566_0176662 | 3300053094 | Bacteria | 1099 |
| 650 | Ga0500571_026455 | 3300053110 | Bacteria | 3212 |
| 651 | Ga0500572_061989 | 3300053111 | Bacteria | 1139 |
| 652 | Ga0500593_000644 | 3300053117 | Bacteria | 13420 |
| 653 | Ga0500594_0000473 | 3300053118 | Bacteria | 8831 |
| 654 | Ga0500607_000674 | 3300053121 | Bacteria | 32958 |
| 655 | Ga0500607_125994 | 3300053121 | Bacteria | 1230 |
| 656 | Ga0500608_116280 | 3300053122 | Bacteria | 1219 |
| 657 | Ga0500626_036089 | 3300053128 | Bacteria | 2235 |
| 658 | Ga0500658_0000034 | 3300053134 | Bacteria | 87668 |
| 659 | Ga0500658_0001015 | 3300053134 | Bacteria | 11448 |
| 660 | Ga0500559_0000367 | 3300053136 | Bacteria | 33241 |
| 661 | Ga0500564_151480 | 3300053138 | Bacteria | 988 |
| 662 | Ga0500568_0000490 | 3300053139 | Bacteria | 29149 |
| 663 | Ga0500604_0148557 | 3300053151 | Bacteria | 795 |
| 664 | Ga0500616_0119166 | 3300053153 | Bacteria | 1263 |
| 665 | Ga0500627_0001528 | 3300053158 | Bacteria | 6510 |
| 666 | Ga0500627_0175674 | 3300053158 | Bacteria | 964 |
| 667 | Ga0500634_0006252 | 3300053161 | Bacteria | 5745 |
| 668 | Ga0500634_0122059 | 3300053161 | Bacteria | 1266 |
| 669 | Ga0500638_132157 | 3300053162 | Bacteria | 1130 |
| 670 | Ga0500636_0046985 | 3300053177 | Bacteria | 2544 |
| 671 | Ga0500567_099967 | 3300053723 | Bacteria | 1207 |
| 672 | Ga0500565_002430 | 3300053734 | Bacteria | 1391 |
| 673 | Ga0590075_007587 | 3300059424 | Bacteria | 2582 |
| 674 | Ga0466962_0250788 | 3300061719 | Bacteria | 870 |
| 675 | 2513230376 | 2513020051 | Bacteria | 6053213 |
| 676 | 2526211396 | 2526164512 | Bacteria | 4025691 |
| 677 | 2599627959 | 2599185214 | Bacteria | 8209958 |
| 678 | 2599677770 | 2599185226 | Bacteria | 8233575 |
| 679 | 2599685589 | 2599185227 | Bacteria | 8246414 |
| 680 | 2599697491 | 2599185229 | Bacteria | 8216126 |
| 681 | 2644161788 | 2643221628 | Bacteria | 5745828 |
| 682 | 2644325808 | 2643221658 | Bacteria | 6064537 |
| 683 | 2644399649 | 2643221672 | Bacteria | 6322190 |
| 684 | 2644465161 | 2643221683 | Bacteria | 5749203 |
| 685 | 2738724022 | 2738541277 | Bacteria | 7458140 |
| 686 | 2738880576 | 2738541307 | Bacteria | 8606193 |
| 687 | 2739247912 | 2738543013 | Bacteria | 5618633 |
| 688 | 2739284707 | 2738543019 | Bacteria | 7459457 |
| 689 | 2819600673 | 2818991446 | Bacteria | 7757362 |
| 690 | 2831268084 | 2831265667 | Bacteria | 7184833 |
| 691 | 2838061719 | 2838054893 | Bacteria | 7451788 |
| 692 | 2842679760 | 2842677519 | Bacteria | 5615038 |
| 693 | 2842734097 | 2842733646 | Bacteria | 5716726 |
| 694 | 2842752527 | 2842747753 | Bacteria | 5578255 |
| 695 | 2881102712 | 2881101125 | Bacteria | 4590519 |
| 696 | 2885193061 | 2885192300 | Bacteria | 5882526 |
| 697 | 2885203153 | 2885198086 | Bacteria | 7212419 |
| 698 | 2885216450 | 2885211737 | Bacteria | 7212420 |
| 699 | 2899928073 | 2899924645 | Bacteria | 7487985 |
| 700 | 2904452511 | 2904449895 | Bacteria | 6927402 |
| 701 | 2904460890 | 2904456579 | Bacteria | 6819253 |
| 702 | 2904480013 | 2904479285 | Bacteria | 5073931 |
| 703 | 2904545224 | 2904541872 | Bacteria | 8915136 |
| 704 | 2919463860 | 2919462493 | Bacteria | 5817112 |
| 705 | 2919704165 | 2919704043 | Bacteria | 5560311 |
| 706 | 2928041077 | 2928037797 | Bacteria | 7273642 |
| 707 | 2928047919 | 2928044640 | Bacteria | 7271509 |
| 708 | 2928055814 | 2928051484 | Bacteria | 7773759 |
| 709 | 2928066712 | 2928064002 | Bacteria | 7419480 |
| 710 | 2928075218 | 2928070936 | Bacteria | 8062541 |
| 711 | 2928088611 | 2928084124 | Bacteria | 7159212 |
| 712 | 2928115563 | 2928115317 | Bacteria | 6477646 |
| 713 | 2929165416 | 2929160207 | Bacteria | 9075316 |
| 714 | 2929522856 | 2929520902 | Bacteria | 6765052 |
| 715 | 2939636115 | 2939631187 | Bacteria | 6118131 |
| 716 | 2945909940 | 2945909444 | Bacteria | 7065066 |
| 717 | 2945945983 | 2945945610 | Bacteria | 5951079 |
| 718 | 2945975601 | 2945972063 | Bacteria | 6086495 |
| 719 | 2945988099 | 2945984333 | Bacteria | 7358892 |
| 720 | 2954768954 | 2954767861 | Bacteria | 5535784 |
| 721 | Ga0068870_10219672 | |||
| 722 | JGI24740J21852_10014457 | |||
| 723 | JGI25152J39213_1001872 | |||
| 724 | JGI25152J39213_1013199 | |||
| 725 | JGI25150J39212_1000863 | |||
| 726 | JGI25150J39212_1005077 | |||
| 727 | JGI25159J45721_1001848 | |||
| 728 | JGI25159J45721_1011405 | |||
| 729 | JGI25151J46595_10000224 | |||
| 730 | JGI25151J46595_10003612 | |||
| 731 | JGI25151J46595_10055825 | |||
| 732 | JGI25153J46596_10000570 | |||
| 733 | JGI25153J46596_10045861 | |||
| 734 | JGI25160J50197_1002537 | |||
| 735 | JGI25160J50197_1010940 | |||
| 736 | JGI25161J50226_1004265 | |||
| 737 | JGI25161J50226_1004510 | |||
| 738 | Ga0006562J51391_1130119 | |||
| 739 | Ga0006562J51391_1130120 | |||
| 740 | Ga0006562J51391_1140775 | |||
| 741 | Ga0006562J51391_1140777 | |||
| 742 | Ga0055532_1009987 | |||
| 743 | Ga0055535_1000750 | |||
| 744 | Ga0055542_1000583 | |||
| 745 | Ga0055529_1001011 | |||
| 746 | Ga0055526_1003328 | |||
| 747 | Ga0055526_1006106 | |||
| 748 | Ga0055537_1000049 | |||
| 749 | Ga0055537_1002248 | |||
| 750 | Ga0055537_1014400 | |||
| 751 | Ga0055524_1002965 | |||
| 752 | Ga0055524_1003751 | |||
| 753 | Ga0055536_1002470 | |||
| 754 | Ga0055536_1008143 | |||
| 755 | Ga0055536_1008959 | |||
| 756 | Ga0055536_1057229 | |||
| 757 | Ga0055534_1000049 | |||
| 758 | Ga0055534_1000343 | |||
| 759 | Ga0055534_1002329 | |||
| 760 | Ga0055534_1003905 | |||
| 761 | Ga0055528_1001187 | |||
| 762 | Ga0055528_1004551 | |||
| 763 | Ga0055528_1030326 | |||
| 764 | Ga0055530_10000318 | |||
| 765 | Ga0055530_10027635 | |||
| 766 | Ga0055530_10031974 | |||
| 767 | Ga0055540_1001928 | |||
| 768 | Ga0055540_1003384 | |||
| 769 | Ga0055540_1004195 | |||
| 770 | Ga0055540_1006573 | |||
| 771 | Ga0055540_1007675 | |||
| 772 | Ga0055540_1025065 | |||
| 773 | Ga0055540_1037495 | |||
| 774 | Ga0055531_10000738 | |||
| 775 | Ga0055531_10002357 | |||
| 776 | Ga0055531_10007991 | |||
| 777 | Ga0055531_10021737 | |||
| 778 | Ga0055543_1001645 | |||
| 779 | Ga0055543_1002190 | |||
| 780 | Ga0065165_1003399 | |||
| 781 | Ga0065714_10003219 | |||
| 782 | Ga0065704_10275364 | |||
| 783 | Ga0070658_10220642 | |||
| 784 | Ga0070676_10304541 | |||
| 785 | Ga0070670_100194010 | |||
| 786 | Ga0070670_100465219 | |||
| 787 | Ga0070670_100570772 | |||
| 788 | Ga0068869_100821021 | |||
| 789 | Ga0068868_100014255 | |||
| 790 | Ga0068868_100164794 | |||
| 791 | Ga0070661_100068133 | |||
| 792 | Ga0070692_10292517 | |||
| 793 | Ga0070668_100111555 | |||
| 794 | Ga0070668_100130668 | |||
| 795 | Ga0070669_100043608 | |||
| 796 | Ga0070669_100131849 | |||
| 797 | Ga0070669_100262967 | |||
| 798 | Ga0070669_100361837 | |||
| 799 | Ga0070675_100041967 | |||
| 800 | Ga0070671_100129474 | |||
| 801 | Ga0070674_100318253 | |||
| 802 | Ga0070674_100612924 | |||
| 803 | Ga0070673_100365501 | |||
| 804 | Ga0070667_100290148 | |||
| 805 | Ga0070701_10007392 | |||
| 806 | Ga0070700_100612691 | |||
| 807 | Ga0070663_100197648 | |||
| 808 | Ga0070678_100028025 | |||
| 809 | Ga0070678_100049560 | |||
| 810 | Ga0070678_100052297 | |||
| 811 | Ga0070678_100454674 | |||
| 812 | Ga0070678_100506453 | |||
| 813 | Ga0070662_100026306 | |||
| 814 | Ga0068867_100168784 | |||
| 815 | Ga0068867_100259949 | |||
| 816 | Ga0068867_100423233 | |||
| 817 | Ga0068867_100687106 | |||
| 818 | Ga0070685_10113354 | |||
| 819 | Ga0070706_100059087 | |||
| 820 | Ga0070698_100552296 | |||
| 821 | Ga0068853_100823620 | |||
| 822 | Ga0070672_100295833 | |||
| 823 | Ga0070693_100830647 | |||
| 824 | Ga0070665_100234720 | |||
| 825 | Ga0070665_100488021 | |||
| 826 | Ga0070665_100662473 | |||
| 827 | Ga0070704_100011744 | |||
| 828 | Ga0070704_100085589 | |||
| 829 | Ga0068855_100112017 | |||
| 830 | Ga0068855_100175809 | |||
| 831 | Ga0070664_100067201 | |||
| 832 | Ga0068857_100064951 | |||
| 833 | Ga0068854_100194092 | |||
| 834 | Ga0068854_100244746 | |||
| 835 | Ga0068856_100334978 | |||
| 836 | Ga0068864_100444163 | |||
| 837 | Ga0068864_100555712 | |||
| 838 | Ga0068866_10362257 | |||
| 839 | Ga0068861_100026271 | |||
| 840 | Ga0068851_10011783 | |||
| 841 | Ga0068863_100047683 | |||
| 842 | Ga0068863_100132321 | |||
| 843 | Ga0068863_100155513 | |||
| 844 | Ga0068860_100114582 | |||
| 845 | Ga0068862_100109907 | |||
| 846 | Ga0068862_100427324 | |||
| 847 | Ga0075363_100017180 | |||
| 848 | Ga0075363_100065074 | |||
| 849 | Ga0075363_100171738 | |||
| 850 | Ga0075363_100264430 | |||
| 851 | Ga0075363_100280042 | |||
| 852 | Ga0075432_10074273 | |||
| 853 | Ga0075432_10108319 | |||
| 854 | Ga0075362_10002978 | |||
| 855 | Ga0075362_10013006 | |||
| 856 | Ga0075362_10019237 | |||
| 857 | Ga0075369_10218994 | |||
| 858 | Ga0075366_10072694 | |||
| 859 | Ga0075366_10080886 | |||
| 860 | Ga0075366_10100065 | |||
| 861 | Ga0075366_10105913 | |||
| 862 | Ga0075366_10124003 | |||
| 863 | Ga0075366_10190135 | |||
| 864 | Ga0097621_100030530 | |||
| 865 | Ga0097621_100246691 | |||
| 866 | Ga0097621_100797262 | |||
| 867 | Ga0075370_10001034 | |||
| 868 | Ga0075370_10003779 | |||
| 869 | Ga0075370_10023982 | |||
| 870 | Ga0075370_10065741 | |||
| 871 | Ga0075370_10071851 | |||
| 872 | Ga0068871_100033921 | |||
| 873 | Ga0068871_100615614 | |||
| 874 | Ga0075430_100101548 | |||
| 875 | Ga0075431_100299414 | |||
| 876 | Ga0075434_100053749 | |||
| 877 | Ga0075429_100782157 | |||
| 878 | Ga0075436_100622679 | |||
| 879 | Ga0099826_10114653 | |||
| 880 | Ga0105244_10036366 | |||
| 881 | Ga0105244_10166189 | |||
| 882 | Ga0105245_10033012 | |||
| 883 | Ga0105243_10001140 | |||
| 884 | Ga0105243_10014072 | |||
| 885 | Ga0105243_10030230 | |||
| 886 | Ga0105241_10031745 | |||
| 887 | Ga0105242_10283450 | |||
| 888 | Ga0105242_11564768 | |||
| 889 | Ga0105248_10206365 | |||
| 890 | Ga0105248_10561826 | |||
| 891 | Ga0105239_10577955 | |||
| 892 | Ga0105239_11018428 | |||
| 893 | Ga0105246_10069698 | |||
| 894 | Ga0157347_1009909 | |||
| 895 | Ga0157373_10095661 | |||
| 896 | Ga0157370_10002450 | |||
| 897 | Ga0157370_10240479 | |||
| 898 | Ga0157374_10180187 | |||
| 899 | Ga0163162_11125515 | |||
| 900 | Ga0157375_10111027 | |||
| 901 | Ga0157375_10789500 | |||
| 902 | Ga0157375_10822204 | |||
| 903 | Ga0163163_10126096 | |||
| 904 | Ga0163163_10625101 | |||
| 905 | Ga0163163_10676364 | |||
| 906 | Ga0157380_10199150 | |||
| 907 | Ga0182008_10000225 | |||
| 908 | Ga0182008_10011230 | |||
| 909 | Ga0182008_10014507 | |||
| 910 | Ga0182008_10019854 | |||
| 911 | Ga0182008_10040078 | |||
| 912 | Ga0182008_10259584 | |||
| 913 | Ga0157379_10014445 | |||
| 914 | Ga0157379_10512770 | |||
| 915 | Ga0157376_10038395 | |||
| 916 | Ga0157376_10082225 | |||
| 917 | Ga0157376_10354467 | |||
| 918 | Ga0157376_10405592 | |||
| 919 | Ga0157376_10940372 | |||
| 920 | Ga0182006_1010162 | |||
| 921 | Ga0182006_1041803 | |||
| 922 | Ga0182007_10003534 | |||
| 923 | Ga0182007_10020624 | |||
| 924 | Ga0182005_1016595 | |||
| 925 | Ga0182005_1039584 | |||
| 926 | Ga0183362_10005 | |||
| 927 | Ga0163161_10000114 | |||
| 928 | Ga0163161_10051863 | |||
| 929 | Ga0163161_10101427 | |||
| 930 | Ga0163161_10232667 | |||
| 931 | Ga0163161_10241309 | |||
| 932 | Ga0163161_10288442 | |||
| 933 | Ga0163161_10679700 | |||
| 934 | Ga0163161_11266573 | |||
| 935 | Ga0213872_10005990 | |||
| 936 | Ga0209672_100477 | |||
| 937 | Ga0209147_101499 | |||
| 938 | Ga0209258_100568 | |||
| 939 | Ga0207425_1000069 | |||
| 940 | Ga0207425_1007005 | |||
| 941 | Ga0209148_1000033 | |||
| 942 | Ga0209129_1000233 | |||
| 943 | Ga0209129_1001166 | |||
| 944 | Ga0209129_1006462 | |||
| 945 | Ga0209565_1000020 | |||
| 946 | Ga0209565_1000171 | |||
| 947 | Ga0209565_1007159 | |||
| 948 | Ga0209565_1047747 | |||
| 949 | Ga0209455_1000819 | |||
| 950 | Ga0209673_1000295 | |||
| 951 | Ga0209673_1000301 | |||
| 952 | Ga0209673_1004394 | |||
| 953 | Ga0209673_1009432 | |||
| 954 | Ga0209673_1020108 | |||
| 955 | Ga0209673_1020941 | |||
| 956 | Ga0209130_1000193 | |||
| 957 | Ga0209130_1000366 | |||
| 958 | Ga0209130_1001843 | |||
| 959 | Ga0209130_1025709 | |||
| 960 | Ga0209675_1000014 | |||
| 961 | Ga0209675_1000236 | |||
| 962 | Ga0209675_1000582 | |||
| 963 | Ga0209675_1006428 | |||
| 964 | Ga0209675_1008038 | |||
| 965 | Ga0209676_1000048 | |||
| 966 | Ga0209676_1000098 | |||
| 967 | Ga0209676_1000123 | |||
| 968 | Ga0209676_1013512 | |||
| 969 | Ga0209676_1018047 | |||
| 970 | Ga0209676_1023673 | |||
| 971 | Ga0209676_1043481 | |||
| 972 | Ga0209676_1050949 | |||
| 973 | Ga0209025_1000204 | |||
| 974 | Ga0209025_1000264 | |||
| 975 | Ga0209025_1000348 | |||
| 976 | Ga0209025_1005823 | |||
| 977 | Ga0209025_1019355 | |||
| 978 | Ga0209025_1019870 | |||
| 979 | Ga0209564_1000231 | |||
| 980 | Ga0209564_1002077 | |||
| 981 | Ga0209758_1000222 | |||
| 982 | Ga0209758_1051551 | |||
| 983 | Ga0209050_1000012 | |||
| 984 | Ga0209050_1001339 | |||
| 985 | Ga0209050_1033105 | |||
| 986 | Ga0209050_1035197 | |||
| 987 | Ga0209256_1000095 | |||
| 988 | Ga0209256_1000284 | |||
| 989 | Ga0209256_1016014 | |||
| 990 | Ga0207426_1000058 | |||
| 991 | Ga0207426_1000349 | |||
| 992 | Ga0209051_1000019 | |||
| 993 | Ga0209051_1000091 | |||
| 994 | Ga0209051_1000098 | |||
| 995 | Ga0209051_1000099 | |||
| 996 | Ga0209051_1000342 | |||
| 997 | Ga0209051_1001310 | |||
| 998 | Ga0209051_1025182 | |||
| 999 | Ga0209257_1000024 | |||
| 1000 | Ga0209257_1000497 | |||
| 1001 | Ga0209257_1000677 | |||
| 1002 | Ga0209257_1003804 | |||
| 1003 | Ga0209257_1004226 | |||
| 1004 | Ga0209257_1052704 | |||
| 1005 | Ga0207656_10015819 | |||
| 1006 | Ga0207655_1000675 | |||
| 1007 | Ga0207682_10002543 | |||
| 1008 | Ga0207682_10146311 | |||
| 1009 | Ga0207688_10016415 | |||
| 1010 | Ga0207680_10126640 | |||
| 1011 | Ga0207645_10002306 | |||
| 1012 | Ga0207645_10135701 | |||
| 1013 | Ga0207643_10002326 | |||
| 1014 | Ga0207662_10009379 | |||
| 1015 | Ga0207652_10416497 | |||
| 1016 | Ga0207681_10083126 | |||
| 1017 | Ga0207681_10312177 | |||
| 1018 | Ga0207681_10475956 | |||
| 1019 | Ga0207650_10018089 | |||
| 1020 | Ga0207650_10691507 | |||
| 1021 | Ga0207644_10127309 | |||
| 1022 | Ga0207706_10015483 | |||
| 1023 | Ga0207706_10035041 | |||
| 1024 | Ga0207686_10335459 | |||
| 1025 | Ga0207709_10000331 | |||
| 1026 | Ga0207709_10000464 | |||
| 1027 | Ga0207709_10008913 | |||
| 1028 | Ga0207709_10100531 | |||
| 1029 | Ga0207669_10102702 | |||
| 1030 | Ga0207704_10797581 | |||
| 1031 | Ga0207691_10015351 | |||
| 1032 | Ga0207691_10633910 | |||
| 1033 | Ga0207711_10129776 | |||
| 1034 | Ga0207711_10285186 | |||
| 1035 | Ga0207689_10007489 | |||
| 1036 | Ga0207689_10100011 | |||
| 1037 | Ga0207689_10588989 | |||
| 1038 | Ga0207679_10074547 | |||
| 1039 | Ga0207667_10099672 | |||
| 1040 | Ga0207667_10109713 | |||
| 1041 | Ga0207651_10019609 | |||
| 1042 | Ga0207651_10072831 | |||
| 1043 | Ga0207651_10206224 | |||
| 1044 | Ga0207640_10482424 | |||
| 1045 | Ga0207658_10116126 | |||
| 1046 | Ga0207658_10255627 | |||
| 1047 | Ga0207658_10865360 | |||
| 1048 | Ga0207677_10018143 | |||
| 1049 | Ga0207677_10288768 | |||
| 1050 | Ga0207639_10020870 | |||
| 1051 | Ga0207708_10002353 | |||
| 1052 | Ga0207702_10667621 | |||
| 1053 | Ga0207702_10725298 | |||
| 1054 | Ga0207641_10129708 | |||
| 1055 | Ga0207641_10434966 | |||
| 1056 | Ga0207648_10003860 | |||
| 1057 | Ga0207676_10681670 | |||
| 1058 | Ga0207674_10100238 | |||
| 1059 | Ga0207674_10122845 | |||
| 1060 | Ga0207674_10269315 | |||
| 1061 | Ga0207674_10328358 | |||
| 1062 | Ga0207675_100010756 | |||
| 1063 | Ga0207683_10003766 | |||
| 1064 | Ga0207683_10085145 | |||
| 1065 | Ga0207683_10092950 | |||
| 1066 | Ga0207683_10377433 | |||
| 1067 | Ga0207683_10427315 | |||
| 1068 | Ga0207698_10219338 | |||
| 1069 | Ga0209282_1005738 | |||
| 1070 | Ga0209282_1093813 | |||
| 1071 | Ga0268266_10200059 | |||
| 1072 | Ga0268266_10313833 | |||
| 1073 | Ga0268265_10021322 | |||
| 1074 | Ga0265318_10005954 | |||
| 1075 | Ga0307515_10000040 | |||
| 1076 | Ga0307515_10099599 | |||
| 1077 | Ga0316177_1099357 | |||
| 1078 | Ga0316176_1067430 | |||
| 1079 | Ga0316183_1086557 | |||
| 1080 | Ga0265330_10019471 | |||
| 1081 | Ga0265330_10025206 | |||
| 1082 | Ga0265332_10000029 | |||
| 1083 | Ga0265332_10000398 | |||
| 1084 | Ga0265328_10000020 | |||
| 1085 | Ga0265328_10011318 | |||
| 1086 | Ga0265328_10040694 | |||
| 1087 | Ga0265320_10033514 | |||
| 1088 | Ga0265320_10141019 | |||
| 1089 | Ga0265329_10004474 | |||
| 1090 | Ga0265329_10034834 | |||
| 1091 | Ga0265340_10217061 | |||
| 1092 | Ga0265339_10060614 | |||
| 1093 | Ga0265331_10021074 | |||
| 1094 | Ga0265331_10053388 | |||
| 1095 | Ga0265327_10000746 | |||
| 1096 | Ga0265327_10001767 | |||
| 1097 | Ga0265327_10021084 | |||
| 1098 | Ga0265327_10044923 | |||
| 1099 | Ga0265327_10052990 | |||
| 1100 | Ga0265316_10030433 | |||
| 1101 | Ga0265316_10048756 | |||
| 1102 | Ga0265316_10139021 | |||
| 1103 | Ga0265316_10141935 | |||
| 1104 | Ga0307513_10113647 | |||
| 1105 | Ga0307513_10175863 | |||
| 1106 | Ga0307513_10313467 | |||
| 1107 | Ga0307408_100003650 | |||
| 1108 | Ga0307408_100051116 | |||
| 1109 | Ga0307408_100053852 | |||
| 1110 | Ga0307408_100076112 | |||
| 1111 | Ga0307408_101162263 | |||
| 1112 | Ga0265313_10075381 | |||
| 1113 | Ga0307514_10008104 | |||
| 1114 | Ga0265314_10005578 | |||
| 1115 | Ga0265342_10008414 | |||
| 1116 | Ga0307516_10077116 | |||
| 1117 | Ga0307516_10126631 | |||
| 1118 | Ga0307405_10012930 | |||
| 1119 | Ga0307405_10027530 | |||
| 1120 | Ga0307405_10280752 | |||
| 1121 | Ga0307405_10546594 | |||
| 1122 | Ga0307405_10641943 | |||
| 1123 | Ga0307405_10695234 | |||
| 1124 | Ga0307405_11133808 | |||
| 1125 | Ga0307413_10055028 | |||
| 1126 | Ga0307413_10434456 | |||
| 1127 | Ga0307406_10000324 | |||
| 1128 | Ga0307406_10059024 | |||
| 1129 | Ga0307406_10235516 | |||
| 1130 | Ga0307406_10260938 | |||
| 1131 | Ga0307406_10316864 | |||
| 1132 | Ga0307406_10750741 | |||
| 1133 | Ga0307407_10445024 | |||
| 1134 | Ga0307412_10030197 | |||
| 1135 | Ga0307412_10043892 | |||
| 1136 | Ga0307412_10077823 | |||
| 1137 | Ga0307412_10102742 | |||
| 1138 | Ga0307412_10247791 | |||
| 1139 | Ga0307409_101043332 | |||
| 1140 | Ga0307416_100010896 | |||
| 1141 | Ga0307414_10078062 | |||
| 1142 | Ga0307414_10610220 | |||
| 1143 | Ga0307414_10710933 | |||
| 1144 | Ga0307411_10001615 | |||
| 1145 | Ga0307411_10027661 | |||
| 1146 | Ga0307411_10578154 | |||
| 1147 | Ga0307415_100393587 | |||
| 1148 | Ga0316583_10017757 | |||
| 1149 | Ga0373932_0127620 | |||
| 1150 | Ga0373931_0032340 | |||
| 1151 | Ga0373931_0059932 | |||
| 1152 | Ga0373933_0563865 | |||
| 1153 | Ga0373937_0627494 | |||
| 1154 | Ga0373925_0280497 | |||
| 1155 | Ga0395899_0001018 | |||
| 1156 | Ga0395899_0322141 | |||
| 1157 | Ga0395899_0455726 | |||
| 1158 | Ga0395900_0040394 | |||
| 1159 | Ga0395900_0216421 | |||
| 1160 | Ga0395898_0008698 | |||
| 1161 | Ga0395898_0107645 | |||
| 1162 | Ga0395898_0199014 | |||
| 1163 | Ga0395905_0002817 | |||
| 1164 | Ga0395905_0004508 | |||
| 1165 | Ga0395905_0008661 | |||
| 1166 | Ga0395905_0052347 | |||
| 1167 | Ga0395905_0065940 | |||
| 1168 | Ga0395905_0089643 | |||
| 1169 | Ga0395905_0206749 | |||
| 1170 | Ga0395905_0228685 | |||
| 1171 | Ga0395905_0795698 | |||
| 1172 | Ga0395905_0834446 | |||
| 1173 | Ga0395901_0022637 | |||
| 1174 | Ga0395901_0097141 | |||
| 1175 | Ga0395901_0366817 | |||
| 1176 | Ga0400490_08919 | |||
| 1177 | Ga0400483_079146 | |||
| 1178 | Ga0436361_0837231 | |||
| 1179 | Ga0439436_0000586 | |||
| 1180 | Ga0439436_0003260 | |||
| 1181 | Ga0439436_0053662 | |||
| 1182 | Ga0439439_0007617 | |||
| 1183 | Ga0439439_0012633 | |||
| 1184 | Ga0439447_031943 | |||
| 1185 | Ga0439447_074976 | |||
| 1186 | Ga0439447_080230 | |||
| 1187 | Ga0439461_0001667 | |||
| 1188 | Ga0439466_0016222 | |||
| 1189 | Ga0439466_0093318 | |||
| 1190 | Ga0439465_0000571 | |||
| 1191 | Ga0451841_1087416 | |||
| 1192 | Ga0439431_0000218 | |||
| 1193 | Ga0439431_0023674 | |||
| 1194 | Ga0439431_0045506 | |||
| 1195 | Ga0439437_023326 | |||
| 1196 | Ga0439442_014583 | |||
| 1197 | Ga0439445_0005073 | |||
| 1198 | Ga0439445_0060743 | |||
| 1199 | Ga0439445_0100640 | |||
| 1200 | Ga0439432_000464 | |||
| 1201 | Ga0439432_013370 | |||
| 1202 | Ga0439449_0001782 | |||
| 1203 | Ga0439449_0002685 | |||
| 1204 | Ga0439449_0232706 | |||
| 1205 | Ga0439452_009991 | |||
| 1206 | Ga0439455_0031067 | |||
| 1207 | Ga0439457_021851 | |||
| 1208 | Ga0439457_039645 | |||
| 1209 | Ga0439457_045282 | |||
| 1210 | Ga0439457_067131 | |||
| 1211 | Ga0439462_0001912 | |||
| 1212 | Ga0439462_0006154 | |||
| 1213 | Ga0439462_0007329 | |||
| 1214 | Ga0439462_0029151 | |||
| 1215 | Ga0439462_0033550 | |||
| 1216 | Ga0450911_000496 | |||
| 1217 | Ga0450919_008525 | |||
| 1218 | Ga0450894_011246 | |||
| 1219 | Ga0450906_014085 | |||
| 1220 | Ga0450910_001247 | |||
| 1221 | Ga0439446_0088038 | |||
| 1222 | Ga0439446_0219893 | |||
| 1223 | Ga0450908_004376 | |||
| 1224 | Ga0450909_014761 | |||
| 1225 | Ga0450909_026382 | |||
| 1226 | Ga0439434_0000517 | |||
| 1227 | Ga0439434_0009050 | |||
| 1228 | Ga0439460_0030740 | |||
| 1229 | Ga0450918_006667 | |||
| 1230 | Ga0450918_024708 | |||
| 1231 | Ga0451577_0035717 | |||
| 1232 | Ga0451577_0073800 | |||
| 1233 | Ga0451577_0101455 | |||
| 1234 | Ga0466969_0021587 | |||
| 1235 | Ga0466969_0038894 | |||
| 1236 | Ga0453683_0006241 | |||
| 1237 | Ga0466965_0370169 | |||
| 1238 | Ga0466966_0138717 | |||
| 1239 | Ga0466961_0099502 | |||
| 1240 | Ga0453684_0449119 | |||
| 1241 | Ga0453684_1575430 | |||
| 1242 | Ga0466970_0037823 | |||
| 1243 | Ga0466957_0396785 | |||
| 1244 | Ga0466960_0265159 | |||
| 1245 | Ga0466960_0539891 | |||
| 1246 | Ga0466959_0036604 | |||
| 1247 | Ga0466959_0454665 | |||
| 1248 | Ga0451576_0000006 | |||
| 1249 | Ga0451576_0017383 | |||
| 1250 | Ga0451576_0609279 | |||
| 1251 | Ga0495627_057008 | |||
| 1252 | Ga0495590_0080524 | |||
| 1253 | Ga0495629_0211632 | |||
| 1254 | Ga0495638_0019572 | |||
| 1255 | Ga0495610_0021660 | |||
| 1256 | Ga0495616_0003870 | |||
| 1257 | Ga0495631_0000163 | |||
| 1258 | Ga0495637_0006475 | |||
| 1259 | Ga0495663_0037328 | |||
| 1260 | Ga0495642_0081622 | |||
| 1261 | Ga0495654_0022427 | |||
| 1262 | Ga0495654_0201393 | |||
| 1263 | Ga0495622_0262361 | |||
| 1264 | Ga0495633_0148210 | |||
| 1265 | Ga0495656_0000163 | |||
| 1266 | Ga0495656_0111103 | |||
| 1267 | Ga0495656_0124913 | |||
| 1268 | Ga0495625_0000045 | |||
| 1269 | Ga0495625_0060501 | |||
| 1270 | Ga0495588_0255079 | |||
| 1271 | Ga0495658_0115048 | |||
| 1272 | Ga0495670_0100652 | |||
| 1273 | Ga0495671_0015415 | |||
| 1274 | Ga0495660_0045443 | |||
| 1275 | Ga0495676_0058877 | |||
| 1276 | Ga0495681_0253262 | |||
| 1277 | Ga0495593_0002104 | |||
| 1278 | Ga0495614_0088545 | |||
| 1279 | Ga0496100_0099001 | |||
| 1280 | Ga0496101_0003542 | |||
| 1281 | Ga0496101_0059835 | |||
| 1282 | Ga0496102_0008409 | |||
| 1283 | Ga0496102_0266002 | |||
| 1284 | Ga0496104_0116799 | |||
| 1285 | Ga0496105_0050318 | |||
| 1286 | Ga0496108_0221492 | |||
| 1287 | Ga0496110_0013319 | |||
| 1288 | Ga0496111_0400359 | |||
| 1289 | Ga0496114_0371118 | |||
| 1290 | Ga0496116_0064554 | |||
| 1291 | Ga0496116_0158318 | |||
| 1292 | Ga0496117_0028929 | |||
| 1293 | Ga0496117_0059066 | |||
| 1294 | Ga0496117_0112317 | |||
| 1295 | Ga0496118_0032009 | |||
| 1296 | Ga0496118_0282758 | |||
| 1297 | Ga0496118_0297641 | |||
| 1298 | Ga0496119_0162441 | |||
| 1299 | Ga0496121_0006773 | |||
| 1300 | Ga0496121_0094623 | |||
| 1301 | Ga0496121_0146946 | |||
| 1302 | Ga0496121_0269007 | |||
| 1303 | Ga0496121_0316496 | |||
| 1304 | Ga0496122_0000331 | |||
| 1305 | Ga0496122_0133772 | |||
| 1306 | Ga0496122_0162021 | |||
| 1307 | Ga0496122_0367184 | |||
| 1308 | Ga0496122_0367425 | |||
| 1309 | Ga0496123_0000124 | |||
| 1310 | Ga0496123_0040092 | |||
| 1311 | Ga0496123_0042013 | |||
| 1312 | Ga0496123_0161843 | |||
| 1313 | Ga0496124_0052777 | |||
| 1314 | Ga0496124_0141472 | |||
| 1315 | Ga0496124_0183400 | |||
| 1316 | Ga0496125_0014888 | |||
| 1317 | Ga0496125_0032434 | |||
| 1318 | Ga0496125_0032803 | |||
| 1319 | Ga0496125_0056027 | |||
| 1320 | Ga0496125_0128324 | |||
| 1321 | Ga0496125_0202642 | |||
| 1322 | Ga0496126_0385908 | |||
| 1323 | Ga0496126_0427765 | |||
| 1324 | Ga0495678_120977 | |||
| 1325 | Ga0501032_0279026 | |||
| 1326 | Ga0501033_0179328 | |||
| 1327 | Ga0501033_0222049 | |||
| 1328 | Ga0501034_0028787 | |||
| 1329 | Ga0501034_0957112 | |||
| 1330 | Ga0501036_0544306 | |||
| 1331 | Ga0501043_0493917 | |||
| 1332 | Ga0501047_0050858 | |||
| 1333 | Ga0501047_0072718 | |||
| 1334 | Ga0501047_0360049 | |||
| 1335 | Ga0501072_0702415 | |||
| 1336 | Ga0501080_0122319 | |||
| 1337 | Ga0501262_000120 | |||
| 1338 | Ga0501035_0009745 | |||
| 1339 | Ga0501035_0166450 | |||
| 1340 | Ga0501044_0005907 | |||
| 1341 | Ga0501044_0504748 | |||
| 1342 | nmdc:mga03683_3109_c1 | |||
| 1343 | nmdc:mga03n38_221925_c1 | |||
| 1344 | nmdc:mga03n38_97708_c1 | |||
| 1345 | nmdc:mga00v17_193484_c1 | |||
| 1346 | nmdc:mga0yw44_22552_c1 | |||
| 1347 | nmdc:mga0yw44_284841_c1 | |||
| 1348 | nmdc:mga0k408_290334_c1 | |||
| 1349 | nmdc:mga0k408_78444_c1 | |||
| 1350 | nmdc:mga0k408_79978_c1 | |||
| 1351 | nmdc:mga06z11_193123_c1 | |||
| 1352 | nmdc:mga06z11_301054_c1 | |||
| 1353 | nmdc:mga06z11_459275_c1 | |||
| 1354 | nmdc:mga07m45_17711_c1 | |||
| 1355 | nmdc:mga07m45_29343_c2 | |||
| 1356 | nmdc:mga07m45_297175_c1 | |||
| 1357 | nmdc:mga07m45_5781_c1 | |||
| 1358 | nmdc:mga07m45_605_c1 | |||
| 1359 | nmdc:mga07m45_62136_c1 | |||
| 1360 | nmdc:mga07m45_8102_c1 | |||
| 1361 | nmdc:mga09592_673856_c1 | |||
| 1362 | nmdc:mga0qj67_671149_c1 | |||
| 1363 | nmdc:mga0n895_950962_c1 | |||
| 1364 | nmdc:mga08x19_556076_c1 | |||
| 1365 | Ga0500610_0000014 | |||
| 1366 | Ga0500610_0000021 | |||
| 1367 | Ga0500643_025509 | |||
| 1368 | Ga0500651_0000560 | |||
| 1369 | Ga0500566_0176662 | |||
| 1370 | Ga0500571_026455 | |||
| 1371 | Ga0500572_061989 | |||
| 1372 | Ga0500593_000644 | |||
| 1373 | Ga0500594_0000473 | |||
| 1374 | Ga0500607_000674 | |||
| 1375 | Ga0500607_125994 | |||
| 1376 | Ga0500608_116280 | |||
| 1377 | Ga0500626_036089 | |||
| 1378 | Ga0500658_0000034 | |||
| 1379 | Ga0500658_0001015 | |||
| 1380 | Ga0500559_0000367 | |||
| 1381 | Ga0500564_151480 | |||
| 1382 | Ga0500568_0000490 | |||
| 1383 | Ga0500604_0148557 | |||
| 1384 | Ga0500616_0119166 | |||
| 1385 | Ga0500627_0001528 | |||
| 1386 | Ga0500627_0175674 | |||
| 1387 | Ga0500634_0006252 | |||
| 1388 | Ga0500634_0122059 | |||
| 1389 | Ga0500638_132157 | |||
| 1390 | Ga0500636_0046985 | |||
| 1391 | Ga0500567_099967 | |||
| 1392 | Ga0500565_002430 | |||
| 1393 | Ga0590075_007587 | |||
| 1394 | Ga0466962_0250788 | |||
| 1395 | 2513230376 | |||
| 1396 | 2526211396 | |||
| 1397 | 2599627959 | |||
| 1398 | 2599677770 | |||
| 1399 | 2599685589 | |||
| 1400 | 2599697491 | |||
| 1401 | 2644161788 | |||
| 1402 | 2644325808 | |||
| 1403 | 2644399649 | |||
| 1404 | 2644465161 | |||
| 1405 | 2738724022 | |||
| 1406 | 2738880576 | |||
| 1407 | 2739247912 | |||
| 1408 | 2739284707 | |||
| 1409 | 2819600673 | |||
| 1410 | 2831268084 | |||
| 1411 | 2838061719 | |||
| 1412 | 2842679760 | |||
| 1413 | 2842734097 | |||
| 1414 | 2842752527 | |||
| 1415 | 2881102712 | |||
| 1416 | 2885193061 | |||
| 1417 | 2885203153 | |||
| 1418 | 2885216450 | |||
| 1419 | 2899928073 | |||
| 1420 | 2904452511 | |||
| 1421 | 2904460890 | |||
| 1422 | 2904480013 | |||
| 1423 | 2904545224 | |||
| 1424 | 2919463860 | |||
| 1425 | 2919704165 | |||
| 1426 | 2928041077 | |||
| 1427 | 2928047919 | |||
| 1428 | 2928055814 | |||
| 1429 | 2928066712 | |||
| 1430 | 2928075218 | |||
| 1431 | 2928088611 | |||
| 1432 | 2928115563 | |||
| 1433 | 2929165416 | |||
| 1434 | 2929522856 | |||
| 1435 | 2939636115 | |||
| 1436 | 2945909940 | |||
| 1437 | 2945945983 | |||
| 1438 | 2945975601 | |||
| 1439 | 2945988099 | |||
| 1440 | 2954768954 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.968 | 3 | 194 |
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.9532 | 3 | 194 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9186 | 1 | 197 |
| 3tqu-assembly2.cif.gz_D | structure of a ham1 protein from coxiella burnetii | 0.9178 | 1 | 196 |
| 2dvn-assembly1.cif.gz_A | structure of ph1917 protein with the complex of imp from pyrococcus horikoshii | 0.9102 | 1 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9738 | 1 | 196 | 3.90.950.10 |
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9592 | 1 | 196 | 3.90.950.10 |
| af_Q2FZC5_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9305 | 2 | 198 | 3.90.950.10 |
| 3s86D00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9186 | 1 | 197 | 3.90.950.10 |
| af_Q9UU89_2_186_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9156 | 2 | 196 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522SJC3-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9974 | 1 | 199 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A1V6ET71-F1-model_v4 | DITP/XTP pyrophosphatase (EC 3.6.1.19) | 0.9955 | 74 | 199 |
GO:0005829
GO:0009117 GO:0009143 GO:0047429 |
| AF-A0A6G8CR52-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9946 | 1 | 199 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A7X9U394-F1-model_v4 | deleted | 0.9927 | 1 | 199 |
|
| AF-A0A1M5EUG2-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9923 | 1 | 199 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |