F477295

General Info

Members Datasets Scaffolds Average Seq Length
720 388 1440 201

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10219672|Ga0068870_102196722
Length 216
Sequence MKKIVIATNNVGKLNEIGAILAPLDIEIVAQSTLGVTEAAEPHCTFIENALAKARHASAQTGLPALADDSGICVDALNGAPGVHSARFAGESAQAAGGRASQDARNNQKLLDALAHETNRNAHYYCVIVLTRRADDPQPLVCEAEWHGEIVKTPRGSGGFGYDPLFLIPALNKTGAELGPEEKNRISHRGQALAALSAKLAGSRIEDRGSRTPRRR

Samples

Sample ID Description Type Environment
1 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
169 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
170 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
210 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
214 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
221 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
230 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
231 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
232 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
233 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
236 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
321 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
322 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
323 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
324 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
325 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
326 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
327 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
328 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
338 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
339 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
340 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
341 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
344 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
345 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
346 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
347 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
348 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
349 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
350 2643221658 Variovorax sp. Root411 Isolate Unclassified
351 2643221672 Variovorax sp. Root434 Isolate Unclassified
352 2643221683 Variovorax sp. Root473 Isolate Unclassified
353 2738541277 Variovorax sp. GV051 Isolate Unclassified
354 2738541307 Variovorax sp. GV008 Isolate Unclassified
355 2738543013 Variovorax sp. BT01 Isolate Unclassified
356 2738543019 Variovorax sp. GV040 Isolate Unclassified
357 2818991446 Variovorax sp. 1180 Isolate Unclassified
358 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
359 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
360 2842677519 Variovorax sp. R-72495 Isolate Unclassified
361 2842733646 Variovorax sp. R-72446 Isolate Unclassified
362 2842747753 Variovorax sp. R-72060 Isolate Unclassified
363 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
364 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
365 2885198086 Variovorax sp. 679 Isolate Unclassified
366 2885211737 Variovorax sp. 553 Isolate Unclassified
367 2899924645 Variovorax sp. 369 Isolate Unclassified
368 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
369 2904456579 Variovorax sp. 2002 Isolate Unclassified
370 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
371 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
372 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
373 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
374 2928037797 Variovorax sp. 1126 Isolate Unclassified
375 2928044640 Variovorax sp. 1128 Isolate Unclassified
376 2928051484 Variovorax sp. 1133 Isolate Unclassified
377 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
378 2928070936 Variovorax gossypii 1167 Isolate Unclassified
379 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
380 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
381 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
382 2929520902 Variovorax beijingensis 502 Isolate Unclassified
383 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
384 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
385 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
386 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
387 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
388 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0.56
Isolates 6.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.53
Nodule 0.56
Rhizoplane 1.94
Rhizosphere 60.69
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068870_10219672 3300005840 Bacteria 1162
2 JGI24740J21852_10014457 3300001979 Bacteria 2911
3 JGI25152J39213_1001872 3300002773 Bacteria 8458
4 JGI25152J39213_1013199 3300002773 Bacteria 1732
5 JGI25150J39212_1000863 3300002774 Bacteria 10077
6 JGI25150J39212_1005077 3300002774 Bacteria 2845
7 JGI25159J45721_1001848 3300002987 Bacteria 8458
8 JGI25159J45721_1011405 3300002987 Bacteria 2181
9 JGI25151J46595_10000224 3300003187 Bacteria 67033
10 JGI25151J46595_10003612 3300003187 Bacteria 8458
11 JGI25151J46595_10055825 3300003187 Bacteria 1300
12 JGI25153J46596_10000570 3300003215 Bacteria 22743
13 JGI25153J46596_10045861 3300003215 Bacteria 1300
14 JGI25160J50197_1002537 3300003354 Bacteria 8458
15 JGI25160J50197_1010940 3300003354 Bacteria 3252
16 JGI25161J50226_1004265 3300003374 Bacteria 3032
17 JGI25161J50226_1004510 3300003374 Bacteria 2903
18 Ga0006562J51391_1130119 3300003578 Bacteria 1680
19 Ga0006562J51391_1130120 3300003578 Bacteria 800
20 Ga0006562J51391_1140775 3300003578 Bacteria 4680
21 Ga0006562J51391_1140777 3300003578 Bacteria 4120
22 Ga0055532_1009987 3300003758 Bacteria 1143
23 Ga0055535_1000750 3300003761 Bacteria 24203
24 Ga0055542_1000583 3300003762 Bacteria 31637
25 Ga0055529_1001011 3300003763 Bacteria 13521
26 Ga0055526_1003328 3300003771 Bacteria 10278
27 Ga0055526_1006106 3300003771 Bacteria 6650
28 Ga0055537_1000049 3300003773 Bacteria 87244
29 Ga0055537_1002248 3300003773 Bacteria 6650
30 Ga0055537_1014400 3300003773 Bacteria 1438
31 Ga0055524_1002965 3300003775 Bacteria 8458
32 Ga0055524_1003751 3300003775 Bacteria 7250
33 Ga0055536_1002470 3300003781 Bacteria 10381
34 Ga0055536_1008143 3300003781 Bacteria 4563
35 Ga0055536_1008959 3300003781 Bacteria 4217
36 Ga0055536_1057229 3300003781 Bacteria 823
37 Ga0055534_1000049 3300003784 Bacteria 92974
38 Ga0055534_1000343 3300003784 Bacteria 30091
39 Ga0055534_1002329 3300003784 Bacteria 6650
40 Ga0055534_1003905 3300003784 Bacteria 4518
41 Ga0055528_1001187 3300003790 Bacteria 16830
42 Ga0055528_1004551 3300003790 Bacteria 6650
43 Ga0055528_1030326 3300003790 Bacteria 1438
44 Ga0055530_10000318 3300003791 Bacteria 43641
45 Ga0055530_10027635 3300003791 Bacteria 1546
46 Ga0055530_10031974 3300003791 Bacteria 1374
47 Ga0055540_1001928 3300003792 Bacteria 11588
48 Ga0055540_1003384 3300003792 Bacteria 7728
49 Ga0055540_1004195 3300003792 Bacteria 6636
50 Ga0055540_1006573 3300003792 Bacteria 4583
51 Ga0055540_1007675 3300003792 Bacteria 4022
52 Ga0055540_1025065 3300003792 Bacteria 1467
53 Ga0055540_1037495 3300003792 Bacteria 1068
54 Ga0055531_10000738 3300003794 Bacteria 27594
55 Ga0055531_10002357 3300003794 Bacteria 12698
56 Ga0055531_10007991 3300003794 Bacteria 5658
57 Ga0055531_10021737 3300003794 Bacteria 2475
58 Ga0055543_1001645 3300004625 Bacteria 8512
59 Ga0055543_1002190 3300004625 Bacteria 6700
60 Ga0065165_1003399 3300005262 Bacteria 11243
61 Ga0065714_10003219 3300005288 Bacteria 12731
62 Ga0065704_10275364 3300005289 Bacteria 934
63 Ga0070658_10220642 3300005327 Bacteria 1603
64 Ga0070676_10304541 3300005328 Bacteria 1081
65 Ga0070670_100194010 3300005331 Bacteria 1764
66 Ga0070670_100465219 3300005331 Bacteria 1122
67 Ga0070670_100570772 3300005331 Bacteria 1010
68 Ga0068869_100821021 3300005334 Bacteria 800
69 Ga0068868_100014255 3300005338 Bacteria 5854
70 Ga0068868_100164794 3300005338 Bacteria 1832
71 Ga0070661_100068133 3300005344 Bacteria 2616
72 Ga0070692_10292517 3300005345 Bacteria 991
73 Ga0070668_100111555 3300005347 Bacteria 2177
74 Ga0070668_100130668 3300005347 Bacteria 2015
75 Ga0070669_100043608 3300005353 Bacteria 3268
76 Ga0070669_100131849 3300005353 Bacteria 1918
77 Ga0070669_100262967 3300005353 Bacteria 1377
78 Ga0070669_100361837 3300005353 Bacteria 1180
79 Ga0070675_100041967 3300005354 Bacteria 3737
80 Ga0070671_100129474 3300005355 Bacteria 2125
81 Ga0070674_100318253 3300005356 Bacteria 1246
82 Ga0070674_100612924 3300005356 Bacteria 921
83 Ga0070673_100365501 3300005364 Bacteria 1283
84 Ga0070667_100290148 3300005367 Bacteria 1471
85 Ga0070701_10007392 3300005438 Bacteria 4691
86 Ga0070700_100612691 3300005441 Bacteria 854
87 Ga0070663_100197648 3300005455 Bacteria 1568
88 Ga0070678_100028025 3300005456 Bacteria 3834
89 Ga0070678_100049560 3300005456 Bacteria 3031
90 Ga0070678_100052297 3300005456 Bacteria 2965
91 Ga0070678_100454674 3300005456 Bacteria 1122
92 Ga0070678_100506453 3300005456 Bacteria 1066
93 Ga0070662_100026306 3300005457 Bacteria 4028
94 Ga0068867_100168784 3300005459 Bacteria 1731
95 Ga0068867_100259949 3300005459 Bacteria 1415
96 Ga0068867_100423233 3300005459 Bacteria 1128
97 Ga0068867_100687106 3300005459 Bacteria 902
98 Ga0070685_10113354 3300005466 Bacteria 1674
99 Ga0070706_100059087 3300005467 Bacteria 3539
100 Ga0070698_100552296 3300005471 Bacteria 1091
101 Ga0068853_100823620 3300005539 Bacteria 889
102 Ga0070672_100295833 3300005543 Bacteria 1371
103 Ga0070693_100830647 3300005547 Bacteria 687
104 Ga0070665_100234720 3300005548 Bacteria 1834
105 Ga0070665_100488021 3300005548 Bacteria 1243
106 Ga0070665_100662473 3300005548 Bacteria 1057
107 Ga0070704_100011744 3300005549 Bacteria 5383
108 Ga0070704_100085589 3300005549 Bacteria 2333
109 Ga0068855_100112017 3300005563 Bacteria 3131
110 Ga0068855_100175809 3300005563 Bacteria 2423
111 Ga0070664_100067201 3300005564 Bacteria 3064
112 Ga0068857_100064951 3300005577 Bacteria 3245
113 Ga0068854_100194092 3300005578 Bacteria 1592
114 Ga0068854_100244746 3300005578 Bacteria 1430
115 Ga0068856_100334978 3300005614 Bacteria 1531
116 Ga0068864_100444163 3300005618 Bacteria 1239
117 Ga0068864_100555712 3300005618 Bacteria 1110
118 Ga0068866_10362257 3300005718 Bacteria 924
119 Ga0068861_100026271 3300005719 Bacteria 4232
120 Ga0068851_10011783 3300005834 Bacteria 4107
121 Ga0068863_100047683 3300005841 Bacteria 4063
122 Ga0068863_100132321 3300005841 Bacteria 2381
123 Ga0068863_100155513 3300005841 Bacteria 2189
124 Ga0068860_100114582 3300005843 Bacteria 2577
125 Ga0068862_100109907 3300005844 Bacteria 2419
126 Ga0068862_100427324 3300005844 Bacteria 1244
127 Ga0075363_100017180 3300006048 Bacteria 3584
128 Ga0075363_100065074 3300006048 Bacteria 1970
129 Ga0075363_100171738 3300006048 Bacteria 1231
130 Ga0075363_100264430 3300006048 Bacteria 993
131 Ga0075363_100280042 3300006048 Bacteria 965
132 Ga0075432_10074273 3300006058 Bacteria 1225
133 Ga0075432_10108319 3300006058 Bacteria 1033
134 Ga0075362_10002978 3300006177 Bacteria 5825
135 Ga0075362_10013006 3300006177 Bacteria 3320
136 Ga0075362_10019237 3300006177 Bacteria 2837
137 Ga0075369_10218994 3300006186 Bacteria 881
138 Ga0075366_10072694 3300006195 Bacteria 2049
139 Ga0075366_10080886 3300006195 Bacteria 1940
140 Ga0075366_10100065 3300006195 Bacteria 1739
141 Ga0075366_10105913 3300006195 Bacteria 1690
142 Ga0075366_10124003 3300006195 Bacteria 1558
143 Ga0075366_10190135 3300006195 Bacteria 1248
144 Ga0097621_100030530 3300006237 Bacteria 4267
145 Ga0097621_100246691 3300006237 Bacteria 1563
146 Ga0097621_100797262 3300006237 Bacteria 875
147 Ga0075370_10001034 3300006353 Bacteria 11554
148 Ga0075370_10003779 3300006353 Bacteria 7244
149 Ga0075370_10023982 3300006353 Bacteria 3365
150 Ga0075370_10065741 3300006353 Bacteria 2068
151 Ga0075370_10071851 3300006353 Bacteria 1980
152 Ga0068871_100033921 3300006358 Bacteria 4045
153 Ga0068871_100615614 3300006358 Bacteria 989
154 Ga0075430_100101548 3300006846 Bacteria 2401
155 Ga0075431_100299414 3300006847 Bacteria 1625
156 Ga0075434_100053749 3300006871 Bacteria 4002
157 Ga0075429_100782157 3300006880 Bacteria 836
158 Ga0075436_100622679 3300006914 Bacteria 796
159 Ga0099826_10114653 3300006948 Bacteria 1599
160 Ga0105244_10036366 3300009036 Bacteria 2580
161 Ga0105244_10166189 3300009036 Bacteria 1052
162 Ga0105245_10033012 3300009098 Bacteria 4584
163 Ga0105243_10001140 3300009148 Bacteria 24116
164 Ga0105243_10014072 3300009148 Bacteria 6054
165 Ga0105243_10030230 3300009148 Bacteria 4168
166 Ga0105241_10031745 3300009174 Bacteria 3955
167 Ga0105242_10283450 3300009176 Bacteria 1506
168 Ga0105242_11564768 3300009176 Bacteria 692
169 Ga0105248_10206365 3300009177 Bacteria 2214
170 Ga0105248_10561826 3300009177 Bacteria 1287
171 Ga0105239_10577955 3300010375 Bacteria 1281
172 Ga0105239_11018428 3300010375 Bacteria 952
173 Ga0105246_10069698 3300011119 Bacteria 2471
174 Ga0157347_1009909 3300012502 Bacteria 993
175 Ga0157373_10095661 3300013100 Bacteria 2091
176 Ga0157370_10002450 3300013104 Bacteria 22388
177 Ga0157370_10240479 3300013104 Bacteria 1675
178 Ga0157374_10180187 3300013296 Bacteria 2063
179 Ga0163162_11125515 3300013306 Bacteria 890
180 Ga0157375_10111027 3300013308 Bacteria 2840
181 Ga0157375_10789500 3300013308 Bacteria 1099
182 Ga0157375_10822204 3300013308 Bacteria 1077
183 Ga0163163_10126096 3300014325 Bacteria 2598
184 Ga0163163_10625101 3300014325 Bacteria 1140
185 Ga0163163_10676364 3300014325 Bacteria 1096
186 Ga0157380_10199150 3300014326 Bacteria 1775
187 Ga0182008_10000225 3300014497 Bacteria 44301
188 Ga0182008_10011230 3300014497 Bacteria 4772
189 Ga0182008_10014507 3300014497 Bacteria 4125
190 Ga0182008_10019854 3300014497 Bacteria 3464
191 Ga0182008_10040078 3300014497 Bacteria 2340
192 Ga0182008_10259584 3300014497 Bacteria 898
193 Ga0157379_10014445 3300014968 Bacteria 6930
194 Ga0157379_10512770 3300014968 Bacteria 1112
195 Ga0157376_10038395 3300014969 Bacteria 3896
196 Ga0157376_10082225 3300014969 Bacteria 2767
197 Ga0157376_10354467 3300014969 Bacteria 1405
198 Ga0157376_10405592 3300014969 Bacteria 1319
199 Ga0157376_10940372 3300014969 Bacteria 884
200 Ga0182006_1010162 3300015261 Bacteria 4195
201 Ga0182006_1041803 3300015261 Bacteria 1798
202 Ga0182007_10003534 3300015262 Bacteria 7361
203 Ga0182007_10020624 3300015262 Bacteria 2353
204 Ga0182005_1016595 3300015265 Bacteria 2046
205 Ga0182005_1039584 3300015265 Bacteria 1282
206 Ga0183362_10005 3300015683 Bacteria 437616
207 Ga0163161_10000114 3300017792 Bacteria 76397
208 Ga0163161_10051863 3300017792 Bacteria 2973
209 Ga0163161_10101427 3300017792 Bacteria 2143
210 Ga0163161_10232667 3300017792 Bacteria 1430
211 Ga0163161_10241309 3300017792 Bacteria 1405
212 Ga0163161_10288442 3300017792 Bacteria 1289
213 Ga0163161_10679700 3300017792 Bacteria 855
214 Ga0163161_11266573 3300017792 Bacteria 640
215 Ga0213872_10005990 3300021361 Bacteria 6162
216 Ga0209672_100477 3300025228 Bacteria 22499
217 Ga0209147_101499 3300025229 Bacteria 8245
218 Ga0209258_100568 3300025242 Bacteria 31666
219 Ga0207425_1000069 3300025245 Bacteria 120895
220 Ga0207425_1007005 3300025245 Bacteria 3028
221 Ga0209148_1000033 3300025254 Bacteria 555508
222 Ga0209129_1000233 3300025258 Bacteria 61174
223 Ga0209129_1001166 3300025258 Bacteria 15152
224 Ga0209129_1006462 3300025258 Bacteria 3778
225 Ga0209565_1000020 3300025263 Bacteria 432627
226 Ga0209565_1000171 3300025263 Bacteria 84566
227 Ga0209565_1007159 3300025263 Bacteria 3038
228 Ga0209565_1047747 3300025263 Bacteria 778
229 Ga0209455_1000819 3300025272 Bacteria 16921
230 Ga0209673_1000295 3300025273 Bacteria 92499
231 Ga0209673_1000301 3300025273 Bacteria 91435
232 Ga0209673_1004394 3300025273 Bacteria 7572
233 Ga0209673_1009432 3300025273 Bacteria 4226
234 Ga0209673_1020108 3300025273 Bacteria 2373
235 Ga0209673_1020941 3300025273 Bacteria 2300
236 Ga0209130_1000193 3300025284 Bacteria 84550
237 Ga0209130_1000366 3300025284 Bacteria 51201
238 Ga0209130_1001843 3300025284 Bacteria 12207
239 Ga0209130_1025709 3300025284 Bacteria 1272
240 Ga0209675_1000014 3300025291 Bacteria 421902
241 Ga0209675_1000236 3300025291 Bacteria 55143
242 Ga0209675_1000582 3300025291 Bacteria 26359
243 Ga0209675_1006428 3300025291 Bacteria 4709
244 Ga0209675_1008038 3300025291 Bacteria 3940
245 Ga0209676_1000048 3300025292 Bacteria 403716
246 Ga0209676_1000098 3300025292 Bacteria 234305
247 Ga0209676_1000123 3300025292 Bacteria 195351
248 Ga0209676_1013512 3300025292 Bacteria 3136
249 Ga0209676_1018047 3300025292 Bacteria 2473
250 Ga0209676_1023673 3300025292 Bacteria 2005
251 Ga0209676_1043481 3300025292 Bacteria 1239
252 Ga0209676_1050949 3300025292 Bacteria 1088
253 Ga0209025_1000204 3300025294 Bacteria 142193
254 Ga0209025_1000264 3300025294 Bacteria 123411
255 Ga0209025_1000348 3300025294 Bacteria 100228
256 Ga0209025_1005823 3300025294 Bacteria 9873
257 Ga0209025_1019355 3300025294 Bacteria 3789
258 Ga0209025_1019870 3300025294 Bacteria 3710
259 Ga0209564_1000231 3300025295 Bacteria 123417
260 Ga0209564_1002077 3300025295 Bacteria 17219
261 Ga0209758_1000222 3300025297 Bacteria 123411
262 Ga0209758_1051551 3300025297 Bacteria 1431
263 Ga0209050_1000012 3300025298 Bacteria 813717
264 Ga0209050_1001339 3300025298 Bacteria 27306
265 Ga0209050_1033105 3300025298 Bacteria 1574
266 Ga0209050_1035197 3300025298 Bacteria 1484
267 Ga0209256_1000095 3300025299 Bacteria 206120
268 Ga0209256_1000284 3300025299 Bacteria 89178
269 Ga0209256_1016014 3300025299 Bacteria 2583
270 Ga0207426_1000058 3300025302 Bacteria 363857
271 Ga0207426_1000349 3300025302 Bacteria 84546
272 Ga0209051_1000019 3300025303 Bacteria 511268
273 Ga0209051_1000091 3300025303 Bacteria 173683
274 Ga0209051_1000098 3300025303 Bacteria 165284
275 Ga0209051_1000099 3300025303 Bacteria 165161
276 Ga0209051_1000342 3300025303 Bacteria 70022
277 Ga0209051_1001310 3300025303 Bacteria 21859
278 Ga0209051_1025182 3300025303 Bacteria 2428
279 Ga0209257_1000024 3300025304 Bacteria 726068
280 Ga0209257_1000497 3300025304 Bacteria 70185
281 Ga0209257_1000677 3300025304 Bacteria 53181
282 Ga0209257_1003804 3300025304 Bacteria 12416
283 Ga0209257_1004226 3300025304 Bacteria 11372
284 Ga0209257_1052704 3300025304 Bacteria 1141
285 Ga0207656_10015819 3300025321 Bacteria 2926
286 Ga0207655_1000675 3300025728 Bacteria 39901
287 Ga0207682_10002543 3300025893 Bacteria 8137
288 Ga0207682_10146311 3300025893 Bacteria 1063
289 Ga0207688_10016415 3300025901 Bacteria 4016
290 Ga0207680_10126640 3300025903 Bacteria 1677
291 Ga0207645_10002306 3300025907 Bacteria 15080
292 Ga0207645_10135701 3300025907 Bacteria 1602
293 Ga0207643_10002326 3300025908 Bacteria 10344
294 Ga0207662_10009379 3300025918 Bacteria 5382
295 Ga0207652_10416497 3300025921 Bacteria 1212
296 Ga0207681_10083126 3300025923 Bacteria 2265
297 Ga0207681_10312177 3300025923 Bacteria 1247
298 Ga0207681_10475956 3300025923 Bacteria 1019
299 Ga0207650_10018089 3300025925 Bacteria 4941
300 Ga0207650_10691507 3300025925 Bacteria 861
301 Ga0207644_10127309 3300025931 Bacteria 1945
302 Ga0207706_10015483 3300025933 Bacteria 6890
303 Ga0207706_10035041 3300025933 Bacteria 4465
304 Ga0207686_10335459 3300025934 Bacteria 1134
305 Ga0207709_10000331 3300025935 Bacteria 50983
306 Ga0207709_10000464 3300025935 Bacteria 37316
307 Ga0207709_10008913 3300025935 Bacteria 5539
308 Ga0207709_10100531 3300025935 Bacteria 1911
309 Ga0207669_10102702 3300025937 Bacteria 1894
310 Ga0207704_10797581 3300025938 Bacteria 788
311 Ga0207691_10015351 3300025940 Bacteria 7286
312 Ga0207691_10633910 3300025940 Bacteria 904
313 Ga0207711_10129776 3300025941 Bacteria 2259
314 Ga0207711_10285186 3300025941 Bacteria 1521
315 Ga0207689_10007489 3300025942 Bacteria 9568
316 Ga0207689_10100011 3300025942 Bacteria 2383
317 Ga0207689_10588989 3300025942 Bacteria 935
318 Ga0207679_10074547 3300025945 Bacteria 2572
319 Ga0207667_10099672 3300025949 Bacteria 2997
320 Ga0207667_10109713 3300025949 Bacteria 2846
321 Ga0207651_10019609 3300025960 Bacteria 4058
322 Ga0207651_10072831 3300025960 Bacteria 2441
323 Ga0207651_10206224 3300025960 Bacteria 1579
324 Ga0207640_10482424 3300025981 Bacteria 1029
325 Ga0207658_10116126 3300025986 Bacteria 2125
326 Ga0207658_10255627 3300025986 Bacteria 1490
327 Ga0207658_10865360 3300025986 Bacteria 822
328 Ga0207677_10018143 3300026023 Bacteria 4217
329 Ga0207677_10288768 3300026023 Bacteria 1350
330 Ga0207639_10020870 3300026041 Bacteria 4697
331 Ga0207708_10002353 3300026075 Bacteria 13889
332 Ga0207702_10667621 3300026078 Bacteria 1023
333 Ga0207702_10725298 3300026078 Bacteria 980
334 Ga0207641_10129708 3300026088 Bacteria 2262
335 Ga0207641_10434966 3300026088 Bacteria 1265
336 Ga0207648_10003860 3300026089 Bacteria 15650
337 Ga0207676_10681670 3300026095 Bacteria 994
338 Ga0207674_10100238 3300026116 Bacteria 2878
339 Ga0207674_10122845 3300026116 Bacteria 2562
340 Ga0207674_10269315 3300026116 Bacteria 1651
341 Ga0207674_10328358 3300026116 Bacteria 1479
342 Ga0207675_100010756 3300026118 Bacteria 8574
343 Ga0207683_10003766 3300026121 Bacteria 13151
344 Ga0207683_10085145 3300026121 Bacteria 2810
345 Ga0207683_10092950 3300026121 Bacteria 2688
346 Ga0207683_10377433 3300026121 Bacteria 1303
347 Ga0207683_10427315 3300026121 Bacteria 1220
348 Ga0207698_10219338 3300026142 Bacteria 1717
349 Ga0209282_1005738 3300027666 Bacteria 7658
350 Ga0209282_1093813 3300027666 Bacteria 1565
351 Ga0268266_10200059 3300028379 Bacteria 1828
352 Ga0268266_10313833 3300028379 Bacteria 1465
353 Ga0268265_10021322 3300028380 Bacteria 4537
354 Ga0265318_10005954 3300028577 Bacteria 5667
355 Ga0307515_10000040 3300028794 Bacteria 322704
356 Ga0307515_10099599 3300028794 Bacteria 3527
357 Ga0316177_1099357 3300030731 Bacteria 1064
358 Ga0316176_1067430 3300030732 Bacteria 2291
359 Ga0316183_1086557 3300030742 Bacteria 14600
360 Ga0265330_10019471 3300031235 Bacteria 3110
361 Ga0265330_10025206 3300031235 Bacteria 2696
362 Ga0265332_10000029 3300031238 Bacteria 180902
363 Ga0265332_10000398 3300031238 Bacteria 31536
364 Ga0265328_10000020 3300031239 Bacteria 125715
365 Ga0265328_10011318 3300031239 Bacteria 3569
366 Ga0265328_10040694 3300031239 Bacteria 1712
367 Ga0265320_10033514 3300031240 Bacteria 2622
368 Ga0265320_10141019 3300031240 Bacteria 1092
369 Ga0265329_10004474 3300031242 Bacteria 5803
370 Ga0265329_10034834 3300031242 Unclassified 1626
371 Ga0265340_10217061 3300031247 Bacteria 857
372 Ga0265339_10060614 3300031249 Bacteria 2039
373 Ga0265331_10021074 3300031250 Bacteria 3338
374 Ga0265331_10053388 3300031250 Bacteria 1928
375 Ga0265327_10000746 3300031251 Bacteria 50605
376 Ga0265327_10001767 3300031251 Bacteria 25537
377 Ga0265327_10021084 3300031251 Bacteria 3944
378 Ga0265327_10044923 3300031251 Bacteria 2351
379 Ga0265327_10052990 3300031251 Bacteria 2108
380 Ga0265316_10030433 3300031344 Bacteria 4425
381 Ga0265316_10048756 3300031344 Bacteria 3341
382 Ga0265316_10139021 3300031344 Bacteria 1826
383 Ga0265316_10141935 3300031344 Bacteria 1803
384 Ga0307513_10113647 3300031456 Bacteria 2695
385 Ga0307513_10175863 3300031456 Bacteria 2011
386 Ga0307513_10313467 3300031456 Bacteria 1330
387 Ga0307408_100003650 3300031548 Bacteria 10489
388 Ga0307408_100051116 3300031548 Bacteria 2975
389 Ga0307408_100053852 3300031548 Bacteria 2907
390 Ga0307408_100076112 3300031548 Bacteria 2495
391 Ga0307408_101162263 3300031548 Bacteria 718
392 Ga0265313_10075381 3300031595 Bacteria 1544
393 Ga0307514_10008104 3300031649 Bacteria 8984
394 Ga0265314_10005578 3300031711 Bacteria 11314
395 Ga0265342_10008414 3300031712 Bacteria 7396
396 Ga0307516_10077116 3300031730 Bacteria 3182
397 Ga0307516_10126631 3300031730 Bacteria 2338
398 Ga0307405_10012930 3300031731 Bacteria 4438
399 Ga0307405_10027530 3300031731 Bacteria 3297
400 Ga0307405_10280752 3300031731 Bacteria 1253
401 Ga0307405_10546594 3300031731 Bacteria 936
402 Ga0307405_10641943 3300031731 Bacteria 872
403 Ga0307405_10695234 3300031731 Bacteria 841
404 Ga0307405_11133808 3300031731 Bacteria 673
405 Ga0307413_10055028 3300031824 Bacteria 2418
406 Ga0307413_10434456 3300031824 Bacteria 1038
407 Ga0307406_10000324 3300031901 Bacteria 27796
408 Ga0307406_10059024 3300031901 Bacteria 2468
409 Ga0307406_10235516 3300031901 Bacteria 1370
410 Ga0307406_10260938 3300031901 Bacteria 1311
411 Ga0307406_10316864 3300031901 Bacteria 1205
412 Ga0307406_10750741 3300031901 Bacteria 819
413 Ga0307407_10445024 3300031903 Bacteria 939
414 Ga0307412_10030197 3300031911 Bacteria 3409
415 Ga0307412_10043892 3300031911 Bacteria 2914
416 Ga0307412_10077823 3300031911 Bacteria 2282
417 Ga0307412_10102742 3300031911 Bacteria 2024
418 Ga0307412_10247791 3300031911 Bacteria 1382
419 Ga0307409_101043332 3300031995 Bacteria 837
420 Ga0307416_100010896 3300032002 Bacteria 6030
421 Ga0307414_10078062 3300032004 Bacteria 2412
422 Ga0307414_10610220 3300032004 Bacteria 979
423 Ga0307414_10710933 3300032004 Bacteria 910
424 Ga0307411_10001615 3300032005 Bacteria 9387
425 Ga0307411_10027661 3300032005 Bacteria 3435
426 Ga0307411_10578154 3300032005 Bacteria 963
427 Ga0307415_100393587 3300032126 Bacteria 1181
428 Ga0316583_10017757 3300032133 Bacteria 2556
429 Ga0373932_0127620 3300035112 Bacteria 854
430 Ga0373931_0032340 3300035691 Bacteria 2707
431 Ga0373931_0059932 3300035691 Bacteria 2048
432 Ga0373933_0563865 3300035724 Bacteria 747
433 Ga0373937_0627494 3300036401 Bacteria 1020
434 Ga0373925_0280497 3300037068 Bacteria 1342
435 Ga0395899_0001018 3300037312 Bacteria 25619
436 Ga0395899_0322141 3300037312 Bacteria 1041
437 Ga0395899_0455726 3300037312 Bacteria 837
438 Ga0395900_0040394 3300037418 Bacteria 4808
439 Ga0395900_0216421 3300037418 Bacteria 1933
440 Ga0395898_0008698 3300037466 Bacteria 10712
441 Ga0395898_0107645 3300037466 Bacteria 2673
442 Ga0395898_0199014 3300037466 Bacteria 1913
443 Ga0395905_0002817 3300037471 Bacteria 19057
444 Ga0395905_0004508 3300037471 Bacteria 14433
445 Ga0395905_0008661 3300037471 Bacteria 10021
446 Ga0395905_0052347 3300037471 Bacteria 3822
447 Ga0395905_0065940 3300037471 Bacteria 3390
448 Ga0395905_0089643 3300037471 Bacteria 2882
449 Ga0395905_0206749 3300037471 Bacteria 1840
450 Ga0395905_0228685 3300037471 Bacteria 1739
451 Ga0395905_0795698 3300037471 Bacteria 848
452 Ga0395905_0834446 3300037471 Bacteria 824
453 Ga0395901_0022637 3300038443 Bacteria 6441
454 Ga0395901_0097141 3300038443 Bacteria 3087
455 Ga0395901_0366817 3300038443 Bacteria 1484
456 Ga0400490_08919 3300038726 Bacteria 7346
457 Ga0400483_079146 3300039062 Bacteria 1018
458 Ga0436361_0837231 3300039447 Bacteria 44100
459 Ga0439436_0000586 3300041404 Bacteria 9641
460 Ga0439436_0003260 3300041404 Bacteria 4920
461 Ga0439436_0053662 3300041404 Bacteria 1135
462 Ga0439439_0007617 3300041406 Bacteria 2537
463 Ga0439439_0012633 3300041406 Bacteria 2044
464 Ga0439447_031943 3300041407 Bacteria 1319
465 Ga0439447_074976 3300041407 Bacteria 784
466 Ga0439447_080230 3300041407 Bacteria 754
467 Ga0439461_0001667 3300041410 Bacteria 3459
468 Ga0439466_0016222 3300041411 Bacteria 2696
469 Ga0439466_0093318 3300041411 Bacteria 942
470 Ga0439465_0000571 3300041413 Bacteria 11082
471 Ga0451841_1087416 3300041498 Bacteria 708
472 Ga0439431_0000218 3300041997 Bacteria 11553
473 Ga0439431_0023674 3300041997 Bacteria 1489
474 Ga0439431_0045506 3300041997 Bacteria 1127
475 Ga0439437_023326 3300042000 Bacteria 756
476 Ga0439442_014583 3300042002 Bacteria 1618
477 Ga0439445_0005073 3300042004 Bacteria 2991
478 Ga0439445_0060743 3300042004 Bacteria 1033
479 Ga0439445_0100640 3300042004 Bacteria 819
480 Ga0439432_000464 3300042006 Bacteria 15181
481 Ga0439432_013370 3300042006 Bacteria 2793
482 Ga0439449_0001782 3300042007 Bacteria 8471
483 Ga0439449_0002685 3300042007 Bacteria 6926
484 Ga0439449_0232706 3300042007 Bacteria 692
485 Ga0439452_009991 3300042010 Bacteria 2776
486 Ga0439455_0031067 3300042012 Bacteria 1328
487 Ga0439457_021851 3300042014 Bacteria 1417
488 Ga0439457_039645 3300042014 Bacteria 1049
489 Ga0439457_045282 3300042014 Bacteria 983
490 Ga0439457_067131 3300042014 Bacteria 815
491 Ga0439462_0001912 3300042015 Bacteria 4743
492 Ga0439462_0006154 3300042015 Bacteria 2976
493 Ga0439462_0007329 3300042015 Bacteria 2759
494 Ga0439462_0029151 3300042015 Bacteria 1460
495 Ga0439462_0033550 3300042015 Bacteria 1361
496 Ga0450911_000496 3300042115 Bacteria 12520
497 Ga0450919_008525 3300042121 Bacteria 1184
498 Ga0450894_011246 3300042131 Bacteria 1165
499 Ga0450906_014085 3300042145 Bacteria 1467
500 Ga0450910_001247 3300042147 Bacteria 3169
501 Ga0439446_0088038 3300042156 Bacteria 969
502 Ga0439446_0219893 3300042156 Bacteria 647
503 Ga0450908_004376 3300042184 Bacteria 2724
504 Ga0450909_014761 3300042185 Bacteria 1150
505 Ga0450909_026382 3300042185 Bacteria 876
506 Ga0439434_0000517 3300042435 Bacteria 10981
507 Ga0439434_0009050 3300042435 Bacteria 2927
508 Ga0439460_0030740 3300042461 Bacteria 1529
509 Ga0450918_006667 3300042531 Bacteria 2054
510 Ga0450918_024708 3300042531 Bacteria 1051
511 Ga0451577_0035717 3300042876 Bacteria 4477
512 Ga0451577_0073800 3300042876 Bacteria 3044
513 Ga0451577_0101455 3300042876 Bacteria 2571
514 Ga0466969_0021587 3300044656 Bacteria 3328
515 Ga0466969_0038894 3300044656 Bacteria 2391
516 Ga0453683_0006241 3300044673 Bacteria 8196
517 Ga0466965_0370169 3300044683 Bacteria 787
518 Ga0466966_0138717 3300044684 Bacteria 1487
519 Ga0466961_0099502 3300044693 Bacteria 1832
520 Ga0453684_0449119 3300044712 Bacteria 1435
521 Ga0453684_1575430 3300044712 Bacteria 675
522 Ga0466970_0037823 3300044765 Bacteria 2559
523 Ga0466957_0396785 3300044842 Bacteria 943
524 Ga0466960_0265159 3300044901 Bacteria 958
525 Ga0466960_0539891 3300044901 Bacteria 687
526 Ga0466959_0036604 3300045049 Bacteria 3626
527 Ga0466959_0454665 3300045049 Bacteria 868
528 Ga0451576_0000006 3300045051 Bacteria 949698
529 Ga0451576_0017383 3300045051 Bacteria 7907
530 Ga0451576_0609279 3300045051 Bacteria 1148
531 Ga0495627_057008 3300046453 Bacteria 1163
532 Ga0495590_0080524 3300046457 Bacteria 1147
533 Ga0495629_0211632 3300046459 Bacteria 1339
534 Ga0495638_0019572 3300046460 Bacteria 4478
535 Ga0495610_0021660 3300046512 Bacteria 3528
536 Ga0495616_0003870 3300046513 Bacteria 9542
537 Ga0495631_0000163 3300046518 Bacteria 45348
538 Ga0495637_0006475 3300046520 Bacteria 5874
539 Ga0495663_0037328 3300046525 Bacteria 1465
540 Ga0495642_0081622 3300046528 Bacteria 1362
541 Ga0495654_0022427 3300046530 Bacteria 3279
542 Ga0495654_0201393 3300046530 Bacteria 852
543 Ga0495622_0262361 3300046557 Bacteria 758
544 Ga0495633_0148210 3300046558 Bacteria 1084
545 Ga0495656_0000163 3300046615 Bacteria 24459
546 Ga0495656_0111103 3300046615 Bacteria 1282
547 Ga0495656_0124913 3300046615 Bacteria 1219
548 Ga0495625_0000045 3300046660 Bacteria 202475
549 Ga0495625_0060501 3300046660 Bacteria 2683
550 Ga0495588_0255079 3300046674 Bacteria 924
551 Ga0495658_0115048 3300046683 Bacteria 1621
552 Ga0495670_0100652 3300046691 Bacteria 1488
553 Ga0495671_0015415 3300046692 Bacteria 4093
554 Ga0495660_0045443 3300046810 Bacteria 2411
555 Ga0495676_0058877 3300047321 Bacteria 3020
556 Ga0495681_0253262 3300047470 Bacteria 694
557 Ga0495593_0002104 3300047673 Bacteria 11902
558 Ga0495614_0088545 3300048089 Bacteria 1345
559 Ga0496100_0099001 3300048903 Bacteria 2005
560 Ga0496101_0003542 3300048904 Bacteria 9742
561 Ga0496101_0059835 3300048904 Bacteria 2762
562 Ga0496102_0008409 3300048905 Bacteria 8842
563 Ga0496102_0266002 3300048905 Bacteria 1617
564 Ga0496104_0116799 3300048907 Bacteria 2560
565 Ga0496105_0050318 3300048908 Bacteria 3441
566 Ga0496108_0221492 3300048911 Bacteria 1644
567 Ga0496110_0013319 3300048913 Bacteria 6795
568 Ga0496111_0400359 3300048914 Bacteria 1014
569 Ga0496114_0371118 3300048917 Bacteria 1266
570 Ga0496116_0064554 3300048919 Bacteria 2353
571 Ga0496116_0158318 3300048919 Bacteria 1246
572 Ga0496117_0028929 3300048920 Bacteria 4281
573 Ga0496117_0059066 3300048920 Bacteria 2652
574 Ga0496117_0112317 3300048920 Bacteria 1694
575 Ga0496118_0032009 3300048921 Bacteria 4344
576 Ga0496118_0282758 3300048921 Bacteria 922
577 Ga0496118_0297641 3300048921 Bacteria 888
578 Ga0496119_0162441 3300048922 Bacteria 1186
579 Ga0496121_0006773 3300048924 Bacteria 14053
580 Ga0496121_0094623 3300048924 Bacteria 2323
581 Ga0496121_0146946 3300048924 Bacteria 1740
582 Ga0496121_0269007 3300048924 Bacteria 1172
583 Ga0496121_0316496 3300048924 Bacteria 1052
584 Ga0496122_0000331 3300048925 Bacteria 102617
585 Ga0496122_0133772 3300048925 Bacteria 1568
586 Ga0496122_0162021 3300048925 Bacteria 1362
587 Ga0496122_0367184 3300048925 Bacteria 744
588 Ga0496122_0367425 3300048925 Bacteria 744
589 Ga0496123_0000124 3300048926 Bacteria 158327
590 Ga0496123_0040092 3300048926 Bacteria 3268
591 Ga0496123_0042013 3300048926 Bacteria 3162
592 Ga0496123_0161843 3300048926 Bacteria 1192
593 Ga0496124_0052777 3300048927 Bacteria 3452
594 Ga0496124_0141472 3300048927 Bacteria 1898
595 Ga0496124_0183400 3300048927 Bacteria 1608
596 Ga0496125_0014888 3300048928 Bacteria 7553
597 Ga0496125_0032434 3300048928 Bacteria 4640
598 Ga0496125_0032803 3300048928 Bacteria 4607
599 Ga0496125_0056027 3300048928 Bacteria 3205
600 Ga0496125_0128324 3300048928 Bacteria 1791
601 Ga0496125_0202642 3300048928 Bacteria 1297
602 Ga0496126_0385908 3300048929 Bacteria 1139
603 Ga0496126_0427765 3300048929 Bacteria 1069
604 Ga0495678_120977 3300049459 Bacteria 879
605 Ga0501032_0279026 3300049569 Bacteria 1082
606 Ga0501033_0179328 3300049570 Bacteria 1519
607 Ga0501033_0222049 3300049570 Bacteria 1345
608 Ga0501034_0028787 3300049571 Bacteria 5652
609 Ga0501034_0957112 3300049571 Bacteria 742
610 Ga0501036_0544306 3300049572 Bacteria 965
611 Ga0501043_0493917 3300049579 Bacteria 915
612 Ga0501047_0050858 3300049581 Bacteria 4002
613 Ga0501047_0072718 3300049581 Bacteria 3309
614 Ga0501047_0360049 3300049581 Bacteria 1291
615 Ga0501072_0702415 3300049588 Bacteria 795
616 Ga0501080_0122319 3300049742 Bacteria 2411
617 Ga0501262_000120 3300049759 Bacteria 9771
618 Ga0501035_0009745 3300049822 Bacteria 8934
619 Ga0501035_0166450 3300049822 Bacteria 1906
620 Ga0501044_0005907 3300049823 Bacteria 13556
621 Ga0501044_0504748 3300049823 Bacteria 1110
622 nmdc:mga03683_3109_c1 3300050489 Bacteria 5281
623 nmdc:mga03n38_221925_c1 3300050490 Bacteria 987
624 nmdc:mga03n38_97708_c1 3300050490 Bacteria 1411
625 nmdc:mga00v17_193484_c1 3300050491 Bacteria 1314
626 nmdc:mga0yw44_22552_c1 3300050492 Bacteria 3532
627 nmdc:mga0yw44_284841_c1 3300050492 Bacteria 1105
628 nmdc:mga0k408_290334_c1 3300050493 Bacteria 976
629 nmdc:mga0k408_78444_c1 3300050493 Bacteria 1932
630 nmdc:mga0k408_79978_c1 3300050493 Bacteria 1913
631 nmdc:mga06z11_193123_c1 3300050494 Bacteria 1179
632 nmdc:mga06z11_301054_c1 3300050494 Bacteria 953
633 nmdc:mga06z11_459275_c1 3300050494 Bacteria 770
634 nmdc:mga07m45_17711_c1 3300050496 Bacteria 3832
635 nmdc:mga07m45_29343_c2 3300050496 Bacteria 2027
636 nmdc:mga07m45_297175_c1 3300050496 Bacteria 939
637 nmdc:mga07m45_5781_c1 3300050496 Bacteria 6196
638 nmdc:mga07m45_605_c1 3300050496 Bacteria 15256
639 nmdc:mga07m45_62136_c1 3300050496 Bacteria 2116
640 nmdc:mga07m45_8102_c1 3300050496 Bacteria 5387
641 nmdc:mga09592_673856_c1 3300050508 Bacteria 882
642 nmdc:mga0qj67_671149_c1 3300050509 Bacteria 826
643 nmdc:mga0n895_950962_c1 3300050512 Bacteria 842
644 nmdc:mga08x19_556076_c1 3300050514 Bacteria 812
645 Ga0500610_0000014 3300053079 Bacteria 84868
646 Ga0500610_0000021 3300053079 Bacteria 66361
647 Ga0500643_025509 3300053087 Bacteria 1862
648 Ga0500651_0000560 3300053093 Bacteria 18911
649 Ga0500566_0176662 3300053094 Bacteria 1099
650 Ga0500571_026455 3300053110 Bacteria 3212
651 Ga0500572_061989 3300053111 Bacteria 1139
652 Ga0500593_000644 3300053117 Bacteria 13420
653 Ga0500594_0000473 3300053118 Bacteria 8831
654 Ga0500607_000674 3300053121 Bacteria 32958
655 Ga0500607_125994 3300053121 Bacteria 1230
656 Ga0500608_116280 3300053122 Bacteria 1219
657 Ga0500626_036089 3300053128 Bacteria 2235
658 Ga0500658_0000034 3300053134 Bacteria 87668
659 Ga0500658_0001015 3300053134 Bacteria 11448
660 Ga0500559_0000367 3300053136 Bacteria 33241
661 Ga0500564_151480 3300053138 Bacteria 988
662 Ga0500568_0000490 3300053139 Bacteria 29149
663 Ga0500604_0148557 3300053151 Bacteria 795
664 Ga0500616_0119166 3300053153 Bacteria 1263
665 Ga0500627_0001528 3300053158 Bacteria 6510
666 Ga0500627_0175674 3300053158 Bacteria 964
667 Ga0500634_0006252 3300053161 Bacteria 5745
668 Ga0500634_0122059 3300053161 Bacteria 1266
669 Ga0500638_132157 3300053162 Bacteria 1130
670 Ga0500636_0046985 3300053177 Bacteria 2544
671 Ga0500567_099967 3300053723 Bacteria 1207
672 Ga0500565_002430 3300053734 Bacteria 1391
673 Ga0590075_007587 3300059424 Bacteria 2582
674 Ga0466962_0250788 3300061719 Bacteria 870
675 2513230376 2513020051 Bacteria 6053213
676 2526211396 2526164512 Bacteria 4025691
677 2599627959 2599185214 Bacteria 8209958
678 2599677770 2599185226 Bacteria 8233575
679 2599685589 2599185227 Bacteria 8246414
680 2599697491 2599185229 Bacteria 8216126
681 2644161788 2643221628 Bacteria 5745828
682 2644325808 2643221658 Bacteria 6064537
683 2644399649 2643221672 Bacteria 6322190
684 2644465161 2643221683 Bacteria 5749203
685 2738724022 2738541277 Bacteria 7458140
686 2738880576 2738541307 Bacteria 8606193
687 2739247912 2738543013 Bacteria 5618633
688 2739284707 2738543019 Bacteria 7459457
689 2819600673 2818991446 Bacteria 7757362
690 2831268084 2831265667 Bacteria 7184833
691 2838061719 2838054893 Bacteria 7451788
692 2842679760 2842677519 Bacteria 5615038
693 2842734097 2842733646 Bacteria 5716726
694 2842752527 2842747753 Bacteria 5578255
695 2881102712 2881101125 Bacteria 4590519
696 2885193061 2885192300 Bacteria 5882526
697 2885203153 2885198086 Bacteria 7212419
698 2885216450 2885211737 Bacteria 7212420
699 2899928073 2899924645 Bacteria 7487985
700 2904452511 2904449895 Bacteria 6927402
701 2904460890 2904456579 Bacteria 6819253
702 2904480013 2904479285 Bacteria 5073931
703 2904545224 2904541872 Bacteria 8915136
704 2919463860 2919462493 Bacteria 5817112
705 2919704165 2919704043 Bacteria 5560311
706 2928041077 2928037797 Bacteria 7273642
707 2928047919 2928044640 Bacteria 7271509
708 2928055814 2928051484 Bacteria 7773759
709 2928066712 2928064002 Bacteria 7419480
710 2928075218 2928070936 Bacteria 8062541
711 2928088611 2928084124 Bacteria 7159212
712 2928115563 2928115317 Bacteria 6477646
713 2929165416 2929160207 Bacteria 9075316
714 2929522856 2929520902 Bacteria 6765052
715 2939636115 2939631187 Bacteria 6118131
716 2945909940 2945909444 Bacteria 7065066
717 2945945983 2945945610 Bacteria 5951079
718 2945975601 2945972063 Bacteria 6086495
719 2945988099 2945984333 Bacteria 7358892
720 2954768954 2954767861 Bacteria 5535784
721 Ga0068870_10219672
722 JGI24740J21852_10014457
723 JGI25152J39213_1001872
724 JGI25152J39213_1013199
725 JGI25150J39212_1000863
726 JGI25150J39212_1005077
727 JGI25159J45721_1001848
728 JGI25159J45721_1011405
729 JGI25151J46595_10000224
730 JGI25151J46595_10003612
731 JGI25151J46595_10055825
732 JGI25153J46596_10000570
733 JGI25153J46596_10045861
734 JGI25160J50197_1002537
735 JGI25160J50197_1010940
736 JGI25161J50226_1004265
737 JGI25161J50226_1004510
738 Ga0006562J51391_1130119
739 Ga0006562J51391_1130120
740 Ga0006562J51391_1140775
741 Ga0006562J51391_1140777
742 Ga0055532_1009987
743 Ga0055535_1000750
744 Ga0055542_1000583
745 Ga0055529_1001011
746 Ga0055526_1003328
747 Ga0055526_1006106
748 Ga0055537_1000049
749 Ga0055537_1002248
750 Ga0055537_1014400
751 Ga0055524_1002965
752 Ga0055524_1003751
753 Ga0055536_1002470
754 Ga0055536_1008143
755 Ga0055536_1008959
756 Ga0055536_1057229
757 Ga0055534_1000049
758 Ga0055534_1000343
759 Ga0055534_1002329
760 Ga0055534_1003905
761 Ga0055528_1001187
762 Ga0055528_1004551
763 Ga0055528_1030326
764 Ga0055530_10000318
765 Ga0055530_10027635
766 Ga0055530_10031974
767 Ga0055540_1001928
768 Ga0055540_1003384
769 Ga0055540_1004195
770 Ga0055540_1006573
771 Ga0055540_1007675
772 Ga0055540_1025065
773 Ga0055540_1037495
774 Ga0055531_10000738
775 Ga0055531_10002357
776 Ga0055531_10007991
777 Ga0055531_10021737
778 Ga0055543_1001645
779 Ga0055543_1002190
780 Ga0065165_1003399
781 Ga0065714_10003219
782 Ga0065704_10275364
783 Ga0070658_10220642
784 Ga0070676_10304541
785 Ga0070670_100194010
786 Ga0070670_100465219
787 Ga0070670_100570772
788 Ga0068869_100821021
789 Ga0068868_100014255
790 Ga0068868_100164794
791 Ga0070661_100068133
792 Ga0070692_10292517
793 Ga0070668_100111555
794 Ga0070668_100130668
795 Ga0070669_100043608
796 Ga0070669_100131849
797 Ga0070669_100262967
798 Ga0070669_100361837
799 Ga0070675_100041967
800 Ga0070671_100129474
801 Ga0070674_100318253
802 Ga0070674_100612924
803 Ga0070673_100365501
804 Ga0070667_100290148
805 Ga0070701_10007392
806 Ga0070700_100612691
807 Ga0070663_100197648
808 Ga0070678_100028025
809 Ga0070678_100049560
810 Ga0070678_100052297
811 Ga0070678_100454674
812 Ga0070678_100506453
813 Ga0070662_100026306
814 Ga0068867_100168784
815 Ga0068867_100259949
816 Ga0068867_100423233
817 Ga0068867_100687106
818 Ga0070685_10113354
819 Ga0070706_100059087
820 Ga0070698_100552296
821 Ga0068853_100823620
822 Ga0070672_100295833
823 Ga0070693_100830647
824 Ga0070665_100234720
825 Ga0070665_100488021
826 Ga0070665_100662473
827 Ga0070704_100011744
828 Ga0070704_100085589
829 Ga0068855_100112017
830 Ga0068855_100175809
831 Ga0070664_100067201
832 Ga0068857_100064951
833 Ga0068854_100194092
834 Ga0068854_100244746
835 Ga0068856_100334978
836 Ga0068864_100444163
837 Ga0068864_100555712
838 Ga0068866_10362257
839 Ga0068861_100026271
840 Ga0068851_10011783
841 Ga0068863_100047683
842 Ga0068863_100132321
843 Ga0068863_100155513
844 Ga0068860_100114582
845 Ga0068862_100109907
846 Ga0068862_100427324
847 Ga0075363_100017180
848 Ga0075363_100065074
849 Ga0075363_100171738
850 Ga0075363_100264430
851 Ga0075363_100280042
852 Ga0075432_10074273
853 Ga0075432_10108319
854 Ga0075362_10002978
855 Ga0075362_10013006
856 Ga0075362_10019237
857 Ga0075369_10218994
858 Ga0075366_10072694
859 Ga0075366_10080886
860 Ga0075366_10100065
861 Ga0075366_10105913
862 Ga0075366_10124003
863 Ga0075366_10190135
864 Ga0097621_100030530
865 Ga0097621_100246691
866 Ga0097621_100797262
867 Ga0075370_10001034
868 Ga0075370_10003779
869 Ga0075370_10023982
870 Ga0075370_10065741
871 Ga0075370_10071851
872 Ga0068871_100033921
873 Ga0068871_100615614
874 Ga0075430_100101548
875 Ga0075431_100299414
876 Ga0075434_100053749
877 Ga0075429_100782157
878 Ga0075436_100622679
879 Ga0099826_10114653
880 Ga0105244_10036366
881 Ga0105244_10166189
882 Ga0105245_10033012
883 Ga0105243_10001140
884 Ga0105243_10014072
885 Ga0105243_10030230
886 Ga0105241_10031745
887 Ga0105242_10283450
888 Ga0105242_11564768
889 Ga0105248_10206365
890 Ga0105248_10561826
891 Ga0105239_10577955
892 Ga0105239_11018428
893 Ga0105246_10069698
894 Ga0157347_1009909
895 Ga0157373_10095661
896 Ga0157370_10002450
897 Ga0157370_10240479
898 Ga0157374_10180187
899 Ga0163162_11125515
900 Ga0157375_10111027
901 Ga0157375_10789500
902 Ga0157375_10822204
903 Ga0163163_10126096
904 Ga0163163_10625101
905 Ga0163163_10676364
906 Ga0157380_10199150
907 Ga0182008_10000225
908 Ga0182008_10011230
909 Ga0182008_10014507
910 Ga0182008_10019854
911 Ga0182008_10040078
912 Ga0182008_10259584
913 Ga0157379_10014445
914 Ga0157379_10512770
915 Ga0157376_10038395
916 Ga0157376_10082225
917 Ga0157376_10354467
918 Ga0157376_10405592
919 Ga0157376_10940372
920 Ga0182006_1010162
921 Ga0182006_1041803
922 Ga0182007_10003534
923 Ga0182007_10020624
924 Ga0182005_1016595
925 Ga0182005_1039584
926 Ga0183362_10005
927 Ga0163161_10000114
928 Ga0163161_10051863
929 Ga0163161_10101427
930 Ga0163161_10232667
931 Ga0163161_10241309
932 Ga0163161_10288442
933 Ga0163161_10679700
934 Ga0163161_11266573
935 Ga0213872_10005990
936 Ga0209672_100477
937 Ga0209147_101499
938 Ga0209258_100568
939 Ga0207425_1000069
940 Ga0207425_1007005
941 Ga0209148_1000033
942 Ga0209129_1000233
943 Ga0209129_1001166
944 Ga0209129_1006462
945 Ga0209565_1000020
946 Ga0209565_1000171
947 Ga0209565_1007159
948 Ga0209565_1047747
949 Ga0209455_1000819
950 Ga0209673_1000295
951 Ga0209673_1000301
952 Ga0209673_1004394
953 Ga0209673_1009432
954 Ga0209673_1020108
955 Ga0209673_1020941
956 Ga0209130_1000193
957 Ga0209130_1000366
958 Ga0209130_1001843
959 Ga0209130_1025709
960 Ga0209675_1000014
961 Ga0209675_1000236
962 Ga0209675_1000582
963 Ga0209675_1006428
964 Ga0209675_1008038
965 Ga0209676_1000048
966 Ga0209676_1000098
967 Ga0209676_1000123
968 Ga0209676_1013512
969 Ga0209676_1018047
970 Ga0209676_1023673
971 Ga0209676_1043481
972 Ga0209676_1050949
973 Ga0209025_1000204
974 Ga0209025_1000264
975 Ga0209025_1000348
976 Ga0209025_1005823
977 Ga0209025_1019355
978 Ga0209025_1019870
979 Ga0209564_1000231
980 Ga0209564_1002077
981 Ga0209758_1000222
982 Ga0209758_1051551
983 Ga0209050_1000012
984 Ga0209050_1001339
985 Ga0209050_1033105
986 Ga0209050_1035197
987 Ga0209256_1000095
988 Ga0209256_1000284
989 Ga0209256_1016014
990 Ga0207426_1000058
991 Ga0207426_1000349
992 Ga0209051_1000019
993 Ga0209051_1000091
994 Ga0209051_1000098
995 Ga0209051_1000099
996 Ga0209051_1000342
997 Ga0209051_1001310
998 Ga0209051_1025182
999 Ga0209257_1000024
1000 Ga0209257_1000497
1001 Ga0209257_1000677
1002 Ga0209257_1003804
1003 Ga0209257_1004226
1004 Ga0209257_1052704
1005 Ga0207656_10015819
1006 Ga0207655_1000675
1007 Ga0207682_10002543
1008 Ga0207682_10146311
1009 Ga0207688_10016415
1010 Ga0207680_10126640
1011 Ga0207645_10002306
1012 Ga0207645_10135701
1013 Ga0207643_10002326
1014 Ga0207662_10009379
1015 Ga0207652_10416497
1016 Ga0207681_10083126
1017 Ga0207681_10312177
1018 Ga0207681_10475956
1019 Ga0207650_10018089
1020 Ga0207650_10691507
1021 Ga0207644_10127309
1022 Ga0207706_10015483
1023 Ga0207706_10035041
1024 Ga0207686_10335459
1025 Ga0207709_10000331
1026 Ga0207709_10000464
1027 Ga0207709_10008913
1028 Ga0207709_10100531
1029 Ga0207669_10102702
1030 Ga0207704_10797581
1031 Ga0207691_10015351
1032 Ga0207691_10633910
1033 Ga0207711_10129776
1034 Ga0207711_10285186
1035 Ga0207689_10007489
1036 Ga0207689_10100011
1037 Ga0207689_10588989
1038 Ga0207679_10074547
1039 Ga0207667_10099672
1040 Ga0207667_10109713
1041 Ga0207651_10019609
1042 Ga0207651_10072831
1043 Ga0207651_10206224
1044 Ga0207640_10482424
1045 Ga0207658_10116126
1046 Ga0207658_10255627
1047 Ga0207658_10865360
1048 Ga0207677_10018143
1049 Ga0207677_10288768
1050 Ga0207639_10020870
1051 Ga0207708_10002353
1052 Ga0207702_10667621
1053 Ga0207702_10725298
1054 Ga0207641_10129708
1055 Ga0207641_10434966
1056 Ga0207648_10003860
1057 Ga0207676_10681670
1058 Ga0207674_10100238
1059 Ga0207674_10122845
1060 Ga0207674_10269315
1061 Ga0207674_10328358
1062 Ga0207675_100010756
1063 Ga0207683_10003766
1064 Ga0207683_10085145
1065 Ga0207683_10092950
1066 Ga0207683_10377433
1067 Ga0207683_10427315
1068 Ga0207698_10219338
1069 Ga0209282_1005738
1070 Ga0209282_1093813
1071 Ga0268266_10200059
1072 Ga0268266_10313833
1073 Ga0268265_10021322
1074 Ga0265318_10005954
1075 Ga0307515_10000040
1076 Ga0307515_10099599
1077 Ga0316177_1099357
1078 Ga0316176_1067430
1079 Ga0316183_1086557
1080 Ga0265330_10019471
1081 Ga0265330_10025206
1082 Ga0265332_10000029
1083 Ga0265332_10000398
1084 Ga0265328_10000020
1085 Ga0265328_10011318
1086 Ga0265328_10040694
1087 Ga0265320_10033514
1088 Ga0265320_10141019
1089 Ga0265329_10004474
1090 Ga0265329_10034834
1091 Ga0265340_10217061
1092 Ga0265339_10060614
1093 Ga0265331_10021074
1094 Ga0265331_10053388
1095 Ga0265327_10000746
1096 Ga0265327_10001767
1097 Ga0265327_10021084
1098 Ga0265327_10044923
1099 Ga0265327_10052990
1100 Ga0265316_10030433
1101 Ga0265316_10048756
1102 Ga0265316_10139021
1103 Ga0265316_10141935
1104 Ga0307513_10113647
1105 Ga0307513_10175863
1106 Ga0307513_10313467
1107 Ga0307408_100003650
1108 Ga0307408_100051116
1109 Ga0307408_100053852
1110 Ga0307408_100076112
1111 Ga0307408_101162263
1112 Ga0265313_10075381
1113 Ga0307514_10008104
1114 Ga0265314_10005578
1115 Ga0265342_10008414
1116 Ga0307516_10077116
1117 Ga0307516_10126631
1118 Ga0307405_10012930
1119 Ga0307405_10027530
1120 Ga0307405_10280752
1121 Ga0307405_10546594
1122 Ga0307405_10641943
1123 Ga0307405_10695234
1124 Ga0307405_11133808
1125 Ga0307413_10055028
1126 Ga0307413_10434456
1127 Ga0307406_10000324
1128 Ga0307406_10059024
1129 Ga0307406_10235516
1130 Ga0307406_10260938
1131 Ga0307406_10316864
1132 Ga0307406_10750741
1133 Ga0307407_10445024
1134 Ga0307412_10030197
1135 Ga0307412_10043892
1136 Ga0307412_10077823
1137 Ga0307412_10102742
1138 Ga0307412_10247791
1139 Ga0307409_101043332
1140 Ga0307416_100010896
1141 Ga0307414_10078062
1142 Ga0307414_10610220
1143 Ga0307414_10710933
1144 Ga0307411_10001615
1145 Ga0307411_10027661
1146 Ga0307411_10578154
1147 Ga0307415_100393587
1148 Ga0316583_10017757
1149 Ga0373932_0127620
1150 Ga0373931_0032340
1151 Ga0373931_0059932
1152 Ga0373933_0563865
1153 Ga0373937_0627494
1154 Ga0373925_0280497
1155 Ga0395899_0001018
1156 Ga0395899_0322141
1157 Ga0395899_0455726
1158 Ga0395900_0040394
1159 Ga0395900_0216421
1160 Ga0395898_0008698
1161 Ga0395898_0107645
1162 Ga0395898_0199014
1163 Ga0395905_0002817
1164 Ga0395905_0004508
1165 Ga0395905_0008661
1166 Ga0395905_0052347
1167 Ga0395905_0065940
1168 Ga0395905_0089643
1169 Ga0395905_0206749
1170 Ga0395905_0228685
1171 Ga0395905_0795698
1172 Ga0395905_0834446
1173 Ga0395901_0022637
1174 Ga0395901_0097141
1175 Ga0395901_0366817
1176 Ga0400490_08919
1177 Ga0400483_079146
1178 Ga0436361_0837231
1179 Ga0439436_0000586
1180 Ga0439436_0003260
1181 Ga0439436_0053662
1182 Ga0439439_0007617
1183 Ga0439439_0012633
1184 Ga0439447_031943
1185 Ga0439447_074976
1186 Ga0439447_080230
1187 Ga0439461_0001667
1188 Ga0439466_0016222
1189 Ga0439466_0093318
1190 Ga0439465_0000571
1191 Ga0451841_1087416
1192 Ga0439431_0000218
1193 Ga0439431_0023674
1194 Ga0439431_0045506
1195 Ga0439437_023326
1196 Ga0439442_014583
1197 Ga0439445_0005073
1198 Ga0439445_0060743
1199 Ga0439445_0100640
1200 Ga0439432_000464
1201 Ga0439432_013370
1202 Ga0439449_0001782
1203 Ga0439449_0002685
1204 Ga0439449_0232706
1205 Ga0439452_009991
1206 Ga0439455_0031067
1207 Ga0439457_021851
1208 Ga0439457_039645
1209 Ga0439457_045282
1210 Ga0439457_067131
1211 Ga0439462_0001912
1212 Ga0439462_0006154
1213 Ga0439462_0007329
1214 Ga0439462_0029151
1215 Ga0439462_0033550
1216 Ga0450911_000496
1217 Ga0450919_008525
1218 Ga0450894_011246
1219 Ga0450906_014085
1220 Ga0450910_001247
1221 Ga0439446_0088038
1222 Ga0439446_0219893
1223 Ga0450908_004376
1224 Ga0450909_014761
1225 Ga0450909_026382
1226 Ga0439434_0000517
1227 Ga0439434_0009050
1228 Ga0439460_0030740
1229 Ga0450918_006667
1230 Ga0450918_024708
1231 Ga0451577_0035717
1232 Ga0451577_0073800
1233 Ga0451577_0101455
1234 Ga0466969_0021587
1235 Ga0466969_0038894
1236 Ga0453683_0006241
1237 Ga0466965_0370169
1238 Ga0466966_0138717
1239 Ga0466961_0099502
1240 Ga0453684_0449119
1241 Ga0453684_1575430
1242 Ga0466970_0037823
1243 Ga0466957_0396785
1244 Ga0466960_0265159
1245 Ga0466960_0539891
1246 Ga0466959_0036604
1247 Ga0466959_0454665
1248 Ga0451576_0000006
1249 Ga0451576_0017383
1250 Ga0451576_0609279
1251 Ga0495627_057008
1252 Ga0495590_0080524
1253 Ga0495629_0211632
1254 Ga0495638_0019572
1255 Ga0495610_0021660
1256 Ga0495616_0003870
1257 Ga0495631_0000163
1258 Ga0495637_0006475
1259 Ga0495663_0037328
1260 Ga0495642_0081622
1261 Ga0495654_0022427
1262 Ga0495654_0201393
1263 Ga0495622_0262361
1264 Ga0495633_0148210
1265 Ga0495656_0000163
1266 Ga0495656_0111103
1267 Ga0495656_0124913
1268 Ga0495625_0000045
1269 Ga0495625_0060501
1270 Ga0495588_0255079
1271 Ga0495658_0115048
1272 Ga0495670_0100652
1273 Ga0495671_0015415
1274 Ga0495660_0045443
1275 Ga0495676_0058877
1276 Ga0495681_0253262
1277 Ga0495593_0002104
1278 Ga0495614_0088545
1279 Ga0496100_0099001
1280 Ga0496101_0003542
1281 Ga0496101_0059835
1282 Ga0496102_0008409
1283 Ga0496102_0266002
1284 Ga0496104_0116799
1285 Ga0496105_0050318
1286 Ga0496108_0221492
1287 Ga0496110_0013319
1288 Ga0496111_0400359
1289 Ga0496114_0371118
1290 Ga0496116_0064554
1291 Ga0496116_0158318
1292 Ga0496117_0028929
1293 Ga0496117_0059066
1294 Ga0496117_0112317
1295 Ga0496118_0032009
1296 Ga0496118_0282758
1297 Ga0496118_0297641
1298 Ga0496119_0162441
1299 Ga0496121_0006773
1300 Ga0496121_0094623
1301 Ga0496121_0146946
1302 Ga0496121_0269007
1303 Ga0496121_0316496
1304 Ga0496122_0000331
1305 Ga0496122_0133772
1306 Ga0496122_0162021
1307 Ga0496122_0367184
1308 Ga0496122_0367425
1309 Ga0496123_0000124
1310 Ga0496123_0040092
1311 Ga0496123_0042013
1312 Ga0496123_0161843
1313 Ga0496124_0052777
1314 Ga0496124_0141472
1315 Ga0496124_0183400
1316 Ga0496125_0014888
1317 Ga0496125_0032434
1318 Ga0496125_0032803
1319 Ga0496125_0056027
1320 Ga0496125_0128324
1321 Ga0496125_0202642
1322 Ga0496126_0385908
1323 Ga0496126_0427765
1324 Ga0495678_120977
1325 Ga0501032_0279026
1326 Ga0501033_0179328
1327 Ga0501033_0222049
1328 Ga0501034_0028787
1329 Ga0501034_0957112
1330 Ga0501036_0544306
1331 Ga0501043_0493917
1332 Ga0501047_0050858
1333 Ga0501047_0072718
1334 Ga0501047_0360049
1335 Ga0501072_0702415
1336 Ga0501080_0122319
1337 Ga0501262_000120
1338 Ga0501035_0009745
1339 Ga0501035_0166450
1340 Ga0501044_0005907
1341 Ga0501044_0504748
1342 nmdc:mga03683_3109_c1
1343 nmdc:mga03n38_221925_c1
1344 nmdc:mga03n38_97708_c1
1345 nmdc:mga00v17_193484_c1
1346 nmdc:mga0yw44_22552_c1
1347 nmdc:mga0yw44_284841_c1
1348 nmdc:mga0k408_290334_c1
1349 nmdc:mga0k408_78444_c1
1350 nmdc:mga0k408_79978_c1
1351 nmdc:mga06z11_193123_c1
1352 nmdc:mga06z11_301054_c1
1353 nmdc:mga06z11_459275_c1
1354 nmdc:mga07m45_17711_c1
1355 nmdc:mga07m45_29343_c2
1356 nmdc:mga07m45_297175_c1
1357 nmdc:mga07m45_5781_c1
1358 nmdc:mga07m45_605_c1
1359 nmdc:mga07m45_62136_c1
1360 nmdc:mga07m45_8102_c1
1361 nmdc:mga09592_673856_c1
1362 nmdc:mga0qj67_671149_c1
1363 nmdc:mga0n895_950962_c1
1364 nmdc:mga08x19_556076_c1
1365 Ga0500610_0000014
1366 Ga0500610_0000021
1367 Ga0500643_025509
1368 Ga0500651_0000560
1369 Ga0500566_0176662
1370 Ga0500571_026455
1371 Ga0500572_061989
1372 Ga0500593_000644
1373 Ga0500594_0000473
1374 Ga0500607_000674
1375 Ga0500607_125994
1376 Ga0500608_116280
1377 Ga0500626_036089
1378 Ga0500658_0000034
1379 Ga0500658_0001015
1380 Ga0500559_0000367
1381 Ga0500564_151480
1382 Ga0500568_0000490
1383 Ga0500604_0148557
1384 Ga0500616_0119166
1385 Ga0500627_0001528
1386 Ga0500627_0175674
1387 Ga0500634_0006252
1388 Ga0500634_0122059
1389 Ga0500638_132157
1390 Ga0500636_0046985
1391 Ga0500567_099967
1392 Ga0500565_002430
1393 Ga0590075_007587
1394 Ga0466962_0250788
1395 2513230376
1396 2526211396
1397 2599627959
1398 2599677770
1399 2599685589
1400 2599697491
1401 2644161788
1402 2644325808
1403 2644399649
1404 2644465161
1405 2738724022
1406 2738880576
1407 2739247912
1408 2739284707
1409 2819600673
1410 2831268084
1411 2838061719
1412 2842679760
1413 2842734097
1414 2842752527
1415 2881102712
1416 2885193061
1417 2885203153
1418 2885216450
1419 2899928073
1420 2904452511
1421 2904460890
1422 2904480013
1423 2904545224
1424 2919463860
1425 2919704165
1426 2928041077
1427 2928047919
1428 2928055814
1429 2928066712
1430 2928075218
1431 2928088611
1432 2928115563
1433 2929165416
1434 2929522856
1435 2939636115
1436 2945909940
1437 2945945983
1438 2945975601
1439 2945988099
1440 2954768954

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

4

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.968 3 194
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9532 3 194
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9186 1 197
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9178 1 196
2dvn-assembly1.cif.gz_A structure of ph1917 protein with the complex of imp from pyrococcus horikoshii 0.9102 1 197
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9738 1 196 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9592 1 196 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9305 2 198 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9186 1 197 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9156 2 196 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A522SJC3-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9974 1 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A1V6ET71-F1-model_v4 DITP/XTP pyrophosphatase (EC 3.6.1.19) 0.9955 74 199 GO:0005829
GO:0009117
GO:0009143
GO:0047429
AF-A0A6G8CR52-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9946 1 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7X9U394-F1-model_v4 deleted 0.9927 1 199
AF-A0A1M5EUG2-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9923 1 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872

Map