F477304

General Info

Members Datasets Scaffolds Average Seq Length
720 325 1440 298

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10071368|Ga0213876_100713683
Length 336
Sequence MWTPSDIAAFGRPAEKIVPLCYPHSYMSGTVLDGKKVSREIRDELRPRIDALRSNKRAPALAVVLVGDNPASQIYVRNKIKACQELGIRSIELRPAQDITTEQLLEQISPLNRDSDVDGILIQMPLPKQIDVNTLNLHLDPMRDVDGFSAYSLGRLVRNEPAPRACTPAGIMELLKRYQISIAGRRAVVVGRSDIVGKPIALMLLHENATVTICHSKTRDLAGECRRADILIAAMGRPAAITADYIKPGAVVVDVGVNRLTNEAEVVRLFPHDTGRLAGYAKNGSTLVGDVEPMAMQEISSAYTPVPGGVGPLTIAMLMANTVKLAEMRLLGKSAG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
196 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 2506783011 Frankia datiscae Dg1 Isolate Nodule
284 2508501039 Frankia saprophytica CN3 Isolate Nodule
285 2517572101 Frankia sp. DC12 Isolate Nodule
286 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
287 2527291627 Frankia casuarinae Thr Isolate Nodule
288 2527291629 Frankia sp. BMG5.23 Isolate Nodule
289 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
290 2576861822 Frankia sp. CeD Isolate Nodule
291 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
292 2619618881 Frankia sp. ACN1ag Isolate Unclassified
293 2619619003 Frankia sp. CpI1-P Isolate Nodule
294 2626541554 Frankia sp. AvcI.1 Isolate Nodule
295 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
296 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
297 2684623036 Frankia sp. CgIM4 Isolate Nodule
298 2687453737 Frankia sp. BMG5.36 Isolate Nodule
299 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
300 2710264753 Frankia sp. KB5 Isolate Nodule
301 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
302 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
303 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
304 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
305 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
306 2773857924 Frankia sp. CgIS1 Isolate Nodule
307 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
308 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
309 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
310 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
311 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
312 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
313 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
314 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
315 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
316 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
317 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
318 637000116 Frankia casuarinae CcI3 Isolate Nodule
319 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
320 8002775197 Frankia nepalensis CN7 Isolate Nodule
321 8002784119 Frankia sp. AgB1.9 Isolate Nodule
322 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
323 8054920844 Frankia tisae Agncl-8 Isolate Nodule
324 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
325 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.03
Metatranscriptomes 0
Isolates 5.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 2.78
Rhizoplane 3.47
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10071368 3300021384 Bacteria 1834
2 MBSR1b_contig_2607737 2162886012 Bacteria 1941
3 LJQas_1000007 3300000549 Bacteria 31319
4 JGI25406J46586_10031864 3300003203 Bacteria 1966
5 Ga0055541_1006232 3300003841 Bacteria 2034
6 Ga0065704_10093027 3300005289 Bacteria 2621
7 Ga0065715_10124535 3300005293 Bacteria 2152
8 Ga0070658_10017385 3300005327 Bacteria 5754
9 Ga0070658_10169684 3300005327 Bacteria 1833
10 Ga0070683_100013341 3300005329 Bacteria 7164
11 Ga0070683_100018105 3300005329 Bacteria 6234
12 Ga0070683_100046079 3300005329 Bacteria 4026
13 Ga0070683_100263147 3300005329 Bacteria 1641
14 Ga0070690_100053341 3300005330 Unclassified 2587
15 Ga0070690_100386479 3300005330 Bacteria 1024
16 Ga0068869_100023139 3300005334 Bacteria 4287
17 Ga0070680_100009354 3300005336 Bacteria 7528
18 Ga0070680_100010904 3300005336 Bacteria 7022
19 Ga0070680_100038161 3300005336 Unclassified 3884
20 Ga0070680_100307333 3300005336 Bacteria 1345
21 Ga0068868_100002275 3300005338 Bacteria 13264
22 Ga0070660_100034314 3300005339 Bacteria 3832
23 Ga0070660_100167511 3300005339 Bacteria 1773
24 Ga0070689_100034718 3300005340 Bacteria 3848
25 Ga0070691_10017606 3300005341 Bacteria 3288
26 Ga0070661_100013004 3300005344 Bacteria 5834
27 Ga0070661_100026126 3300005344 Bacteria 4197
28 Ga0070661_100115847 3300005344 Bacteria 2004
29 Ga0070661_100286029 3300005344 Unclassified 1280
30 Ga0070668_100049194 3300005347 Bacteria 3244
31 Ga0070675_100155155 3300005354 Bacteria 1965
32 Ga0070671_100312434 3300005355 Bacteria 1339
33 Ga0070674_100020577 3300005356 Bacteria 4219
34 Ga0070659_100083707 3300005366 Bacteria 2550
35 Ga0070709_10106829 3300005434 Bacteria 1875
36 Ga0070709_10127394 3300005434 Bacteria 1734
37 Ga0070709_10301612 3300005434 Bacteria 1170
38 Ga0070713_100093866 3300005436 Bacteria 2586
39 Ga0070713_100147555 3300005436 Bacteria 2089
40 Ga0070713_100211971 3300005436 Bacteria 1754
41 Ga0070711_100030940 3300005439 Bacteria 3549
42 Ga0070711_100242037 3300005439 Unclassified 1411
43 Ga0070711_100277359 3300005439 Bacteria 1325
44 Ga0070700_100403488 3300005441 Bacteria 1028
45 Ga0070694_100037348 3300005444 Bacteria 3222
46 Ga0070708_100015506 3300005445 Bacteria 6298
47 Ga0070708_100081034 3300005445 Bacteria 2938
48 Ga0070678_100179288 3300005456 Bacteria 1733
49 Ga0070678_100219297 3300005456 Bacteria 1580
50 Ga0070681_10000605 3300005458 Bacteria 29575
51 Ga0070681_10005377 3300005458 Bacteria 12369
52 Ga0070681_10034973 3300005458 Bacteria 5046
53 Ga0070681_10043027 3300005458 Bacteria 4525
54 Ga0070681_10150205 3300005458 Bacteria 2256
55 Ga0070681_10213804 3300005458 Bacteria 1844
56 Ga0070706_100027585 3300005467 Bacteria 5226
57 Ga0070707_100089736 3300005468 Bacteria 2975
58 Ga0070707_100156247 3300005468 Bacteria 2222
59 Ga0070707_100294931 3300005468 Bacteria 1576
60 Ga0070699_100024627 3300005518 Bacteria 5188
61 Ga0070699_100208234 3300005518 Bacteria 1740
62 Ga0070679_100005804 3300005530 Bacteria 11455
63 Ga0070679_100009024 3300005530 Bacteria 9406
64 Ga0070679_100140602 3300005530 Bacteria 2394
65 Ga0070679_100170443 3300005530 Unclassified 2150
66 Ga0070684_100002114 3300005535 Bacteria 14642
67 Ga0070684_100022521 3300005535 Bacteria 5257
68 Ga0070684_100249089 3300005535 Unclassified 1624
69 Ga0070697_100036073 3300005536 Bacteria 3993
70 Ga0070697_100037641 3300005536 Bacteria 3908
71 Ga0070697_100046586 3300005536 Bacteria 3514
72 Ga0068853_100038145 3300005539 Bacteria 4091
73 Ga0068853_100081151 3300005539 Bacteria 2839
74 Ga0068853_100314152 3300005539 Bacteria 1451
75 Ga0070672_100246532 3300005543 Bacteria 1504
76 Ga0070686_100071878 3300005544 Bacteria 2267
77 Ga0070695_100016987 3300005545 Bacteria 4412
78 Ga0070695_100026911 3300005545 Bacteria 3560
79 Ga0070695_100060897 3300005545 Bacteria 2447
80 Ga0070696_100040063 3300005546 Bacteria 3235
81 Ga0070693_100006824 3300005547 Bacteria 5548
82 Ga0070665_100048003 3300005548 Bacteria 4286
83 Ga0070665_100175928 3300005548 Bacteria 2141
84 Ga0070665_100238239 3300005548 Bacteria 1820
85 Ga0070704_100248779 3300005549 Bacteria 1459
86 Ga0068855_100004587 3300005563 Bacteria 16867
87 Ga0068855_100007492 3300005563 Bacteria 13215
88 Ga0068855_100049900 3300005563 Bacteria 4934
89 Ga0068855_100058864 3300005563 Bacteria 4497
90 Ga0068855_100085120 3300005563 Bacteria 3659
91 Ga0068855_100093880 3300005563 Unclassified 3460
92 Ga0068855_100095978 3300005563 Bacteria 3417
93 Ga0068855_100189752 3300005563 Bacteria 2319
94 Ga0070664_100176442 3300005564 Bacteria 1897
95 Ga0070664_100309057 3300005564 Bacteria 1430
96 Ga0070664_100336510 3300005564 Bacteria 1370
97 Ga0068857_100003819 3300005577 Bacteria 12677
98 Ga0068857_100007396 3300005577 Bacteria 9457
99 Ga0068854_100142677 3300005578 Bacteria 1839
100 Ga0068856_100010972 3300005614 Bacteria 8796
101 Ga0068856_100022526 3300005614 Bacteria 6125
102 Ga0068856_100027489 3300005614 Bacteria 5550
103 Ga0068856_100036394 3300005614 Bacteria 4826
104 Ga0068856_100040539 3300005614 Bacteria 4575
105 Ga0068856_100086445 3300005614 Bacteria 3116
106 Ga0068856_100118059 3300005614 Bacteria 2654
107 Ga0068856_100125226 3300005614 Unclassified 2573
108 Ga0068856_100218103 3300005614 Bacteria 1923
109 Ga0068852_100210130 3300005616 Bacteria 1846
110 Ga0068852_100264604 3300005616 Bacteria 1652
111 Ga0068852_100284848 3300005616 Bacteria 1594
112 Ga0068859_100000054 3300005617 Bacteria 123173
113 Ga0068859_100001223 3300005617 Bacteria 26205
114 Ga0068859_100024538 3300005617 Bacteria 6049
115 Ga0068859_100043795 3300005617 Bacteria 4498
116 Ga0068859_100058013 3300005617 Bacteria 3899
117 Ga0068859_100281892 3300005617 Bacteria 1755
118 Ga0068864_100020562 3300005618 Bacteria 5522
119 Ga0068864_100129878 3300005618 Bacteria 2262
120 Ga0068864_100225252 3300005618 Unclassified 1732
121 Ga0068861_100301950 3300005719 Bacteria 1387
122 Ga0068863_100419081 3300005841 Bacteria 1311
123 Ga0068863_100474461 3300005841 Bacteria 1229
124 Ga0068858_100005980 3300005842 Bacteria 11883
125 Ga0068858_100068750 3300005842 Unclassified 3282
126 Ga0068858_100072117 3300005842 Bacteria 3204
127 Ga0068858_100073980 3300005842 Bacteria 3163
128 Ga0068858_100129946 3300005842 Bacteria 2361
129 Ga0068858_100147216 3300005842 Bacteria 2212
130 Ga0068858_100272745 3300005842 Bacteria 1610
131 Ga0068860_100030585 3300005843 Bacteria 5178
132 Ga0068862_100000037 3300005844 Bacteria 172796
133 Ga0068862_100265430 3300005844 Unclassified 1568
134 Ga0081455_10007431 3300005937 Bacteria 11544
135 Ga0081455_10027970 3300005937 Bacteria 5157
136 Ga0081455_10133534 3300005937 Bacteria 1937
137 Ga0081539_10001047 3300005985 Bacteria 50655
138 Ga0081539_10008121 3300005985 Bacteria 9270
139 Ga0070717_10023812 3300006028 Bacteria 4857
140 Ga0070717_10451066 3300006028 Bacteria 1159
141 Ga0070712_100162944 3300006175 Bacteria 1723
142 Ga0070712_100310671 3300006175 Archaea 1279
143 Ga0097621_100012173 3300006237 Bacteria 6367
144 Ga0097621_100059860 3300006237 Bacteria 3120
145 Ga0097621_100454928 3300006237 Bacteria 1154
146 Ga0097621_100456789 3300006237 Bacteria 1151
147 Ga0097621_100629932 3300006237 Bacteria 982
148 Ga0068871_100005987 3300006358 Bacteria 8558
149 Ga0068871_100043122 3300006358 Unclassified 3624
150 Ga0068871_100262525 3300006358 Bacteria 1507
151 Ga0068871_100275505 3300006358 Bacteria 1470
152 Ga0068871_100503766 3300006358 Bacteria 1092
153 Ga0075428_100005577 3300006844 Bacteria 13988
154 Ga0075430_100013130 3300006846 Bacteria 7057
155 Ga0075431_100045761 3300006847 Bacteria 4511
156 Ga0075433_10003719 3300006852 Bacteria 11807
157 Ga0075434_100000069 3300006871 Bacteria 53659
158 Ga0075434_100319193 3300006871 Bacteria 1574
159 Ga0068865_100030146 3300006881 Bacteria 3605
160 Ga0075436_100007970 3300006914 Bacteria 7254
161 Ga0075436_100016687 3300006914 Bacteria 5026
162 Ga0097620_100000054 3300006931 Bacteria 123173
163 Ga0097620_100001223 3300006931 Bacteria 26205
164 Ga0097620_100024538 3300006931 Bacteria 6049
165 Ga0097620_100043791 3300006931 Bacteria 4498
166 Ga0097620_100058013 3300006931 Bacteria 3899
167 Ga0097620_100281880 3300006931 Bacteria 1755
168 Ga0075435_100106627 3300007076 Bacteria 2327
169 Ga0075435_100116985 3300007076 Archaea 2221
170 Ga0099794_10069567 3300007265 Bacteria 1722
171 Ga0105240_10003303 3300009093 Bacteria 25212
172 Ga0105240_10003832 3300009093 Bacteria 23257
173 Ga0105240_10013706 3300009093 Bacteria 11109
174 Ga0105240_10037802 3300009093 Bacteria 6199
175 Ga0105240_10063307 3300009093 Bacteria 4602
176 Ga0105240_10084091 3300009093 Bacteria 3902
177 Ga0105240_10156934 3300009093 Bacteria 2705
178 Ga0105240_10664710 3300009093 Bacteria 1140
179 Ga0105240_10716684 3300009093 Bacteria 1091
180 Ga0111539_10077847 3300009094 Bacteria 3902
181 Ga0111539_10263308 3300009094 Bacteria 2007
182 Ga0111539_10340307 3300009094 Bacteria 1746
183 Ga0105245_10002254 3300009098 Bacteria 17460
184 Ga0105245_10061145 3300009098 Bacteria 3394
185 Ga0105245_10107928 3300009098 Bacteria 2585
186 Ga0105245_10157114 3300009098 Bacteria 2155
187 Ga0105245_10262345 3300009098 Bacteria 1682
188 Ga0105247_10000125 3300009101 Bacteria 74220
189 Ga0105247_10005102 3300009101 Bacteria 8317
190 Ga0105247_10071278 3300009101 Bacteria 2173
191 Ga0114129_10299524 3300009147 Bacteria 2144
192 Ga0114129_10333590 3300009147 Bacteria 2013
193 Ga0105243_10090788 3300009148 Bacteria 2514
194 Ga0105241_10008535 3300009174 Bacteria 7534
195 Ga0105241_10045243 3300009174 Unclassified 3339
196 Ga0105241_10138018 3300009174 Bacteria 1982
197 Ga0105242_10013866 3300009176 Bacteria 6235
198 Ga0105248_10000018 3300009177 Bacteria 294894
199 Ga0105248_10003078 3300009177 Bacteria 18491
200 Ga0105248_10045759 3300009177 Bacteria 4906
201 Ga0105248_10054531 3300009177 Bacteria 4483
202 Ga0105248_10085631 3300009177 Bacteria 3546
203 Ga0105248_10107131 3300009177 Bacteria 3151
204 Ga0105248_10232588 3300009177 Bacteria 2075
205 Ga0105248_10239066 3300009177 Bacteria 2044
206 Ga0105248_10332995 3300009177 Unclassified 1710
207 Ga0105237_10000223 3300009545 Bacteria 79892
208 Ga0105237_10021372 3300009545 Bacteria 6653
209 Ga0105237_10046509 3300009545 Bacteria 4365
210 Ga0105237_10077423 3300009545 Bacteria 3315
211 Ga0105237_10110999 3300009545 Bacteria 2734
212 Ga0105237_10173473 3300009545 Bacteria 2156
213 Ga0105237_10457109 3300009545 Bacteria 1283
214 Ga0105238_10008033 3300009551 Bacteria 10557
215 Ga0105238_10008204 3300009551 Bacteria 10447
216 Ga0105238_10011819 3300009551 Bacteria 8795
217 Ga0105238_10018386 3300009551 Bacteria 7114
218 Ga0105238_10062169 3300009551 Bacteria 3735
219 Ga0105238_10063942 3300009551 Bacteria 3680
220 Ga0105238_10118213 3300009551 Bacteria 2631
221 Ga0105249_10089219 3300009553 Bacteria 2881
222 Ga0105249_10134884 3300009553 Bacteria 2361
223 Ga0105249_10150578 3300009553 Bacteria 2240
224 Ga0105249_10237101 3300009553 Bacteria 1802
225 Ga0105239_10006113 3300010375 Bacteria 14019
226 Ga0105239_10018215 3300010375 Bacteria 7763
227 Ga0105239_10019814 3300010375 Bacteria 7424
228 Ga0105239_10020900 3300010375 Bacteria 7222
229 Ga0105239_10226136 3300010375 Unclassified 2099
230 Ga0105239_10242934 3300010375 Bacteria 2021
231 Ga0105246_10190773 3300011119 Bacteria 1586
232 Ga0157370_10005991 3300013104 Bacteria 13531
233 Ga0157370_10006307 3300013104 Bacteria 13104
234 Ga0157370_10016399 3300013104 Bacteria 7499
235 Ga0157370_10040560 3300013104 Bacteria 4495
236 Ga0157370_10057435 3300013104 Bacteria 3700
237 Ga0157370_10065457 3300013104 Bacteria 3439
238 Ga0157369_10008782 3300013105 Bacteria 11578
239 Ga0157369_10012845 3300013105 Bacteria 9495
240 Ga0157369_10013263 3300013105 Bacteria 9324
241 Ga0157369_10016965 3300013105 Bacteria 8182
242 Ga0157369_10063670 3300013105 Bacteria 3973
243 Ga0157369_10112426 3300013105 Bacteria 2893
244 Ga0157369_10152686 3300013105 Bacteria 2441
245 Ga0157369_10204804 3300013105 Unclassified 2070
246 Ga0157374_10012136 3300013296 Bacteria 7484
247 Ga0157374_10067061 3300013296 Bacteria 3373
248 Ga0157374_10258466 3300013296 Bacteria 1715
249 Ga0157374_10303284 3300013296 Bacteria 1580
250 Ga0157378_10054675 3300013297 Bacteria 3554
251 Ga0157378_10166445 3300013297 Bacteria 2065
252 Ga0157378_10184073 3300013297 Bacteria 1966
253 Ga0157378_10365856 3300013297 Bacteria 1412
254 Ga0163162_10013500 3300013306 Bacteria 7974
255 Ga0163162_10086353 3300013306 Bacteria 3215
256 Ga0163162_10124049 3300013306 Unclassified 2688
257 Ga0163162_10209761 3300013306 Bacteria 2077
258 Ga0163162_10258956 3300013306 Unclassified 1871
259 Ga0163162_10512574 3300013306 Bacteria 1329
260 Ga0163162_10799954 3300013306 Bacteria 1060
261 Ga0157372_10007318 3300013307 Bacteria 11750
262 Ga0157372_10020322 3300013307 Bacteria 7162
263 Ga0157372_10057171 3300013307 Bacteria 4360
264 Ga0157372_10118462 3300013307 Bacteria 3038
265 Ga0157372_10374825 3300013307 Bacteria 1658
266 Ga0157372_10665210 3300013307 Bacteria 1213
267 Ga0157375_10005690 3300013308 Bacteria 10846
268 Ga0157375_10159781 3300013308 Bacteria 2395
269 Ga0157375_10249317 3300013308 Bacteria 1936
270 Ga0157375_10327530 3300013308 Bacteria 1697
271 Ga0157375_10700022 3300013308 Bacteria 1167
272 Ga0163163_10002598 3300014325 Bacteria 15306
273 Ga0163163_10018126 3300014325 Bacteria 6581
274 Ga0163163_10040514 3300014325 Bacteria 4549
275 Ga0163163_10043155 3300014325 Bacteria 4420
276 Ga0163163_10152034 3300014325 Bacteria 2358
277 Ga0163163_10266364 3300014325 Bacteria 1765
278 Ga0163163_10451920 3300014325 Bacteria 1345
279 Ga0163163_10511951 3300014325 Bacteria 1262
280 Ga0163163_10875955 3300014325 Bacteria 961
281 Ga0182008_10078939 3300014497 Bacteria 1619
282 Ga0182008_10080883 3300014497 Bacteria 1599
283 Ga0157379_10050360 3300014968 Bacteria 3718
284 Ga0157379_10065070 3300014968 Bacteria 3259
285 Ga0157379_10269986 3300014968 Bacteria 1547
286 Ga0157379_10469430 3300014968 Bacteria 1164
287 Ga0157376_10096022 3300014969 Bacteria 2579
288 Ga0157376_10182786 3300014969 Unclassified 1918
289 Ga0157376_10354898 3300014969 Bacteria 1404
290 Ga0157376_10525925 3300014969 Bacteria 1166
291 Ga0182006_1057686 3300015261 Bacteria 1475
292 Ga0213872_10000182 3300021361 Bacteria 56427
293 Ga0213874_10011049 3300021377 Unclassified 2277
294 Ga0213874_10061087 3300021377 Bacteria 1180
295 Ga0213876_10003589 3300021384 Bacteria 8828
296 Ga0213876_10014097 3300021384 Bacteria 4238
297 Ga0213876_10025225 3300021384 Bacteria 3137
298 Ga0213875_10000019 3300021388 Bacteria 231333
299 Ga0213875_10000109 3300021388 Bacteria 94035
300 Ga0213875_10000137 3300021388 Bacteria 80801
301 Ga0213875_10001103 3300021388 Bacteria 18734
302 Ga0213875_10003448 3300021388 Bacteria 9003
303 Ga0213875_10059306 3300021388 Bacteria 1791
304 Ga0213875_10091566 3300021388 Bacteria 1418
305 Ga0213875_10092868 3300021388 Bacteria 1407
306 Ga0209566_100108 3300025225 Bacteria 119382
307 Ga0209675_1030371 3300025291 Bacteria 1290
308 Ga0209025_1004716 3300025294 Bacteria 11631
309 Ga0207656_10029760 3300025321 Bacteria 2252
310 Ga0207710_10000149 3300025900 Bacteria 79810
311 Ga0207710_10002412 3300025900 Bacteria 8707
312 Ga0207680_10044635 3300025903 Bacteria 2608
313 Ga0207647_10206988 3300025904 Bacteria 1134
314 Ga0207705_10047594 3300025909 Bacteria 3084
315 Ga0207705_10067567 3300025909 Bacteria 2587
316 Ga0207684_10071762 3300025910 Bacteria 2942
317 Ga0207684_10127316 3300025910 Bacteria 2186
318 Ga0207684_10220381 3300025910 Bacteria 1637
319 Ga0207654_10078752 3300025911 Bacteria 1978
320 Ga0207707_10000372 3300025912 Bacteria 47046
321 Ga0207707_10007147 3300025912 Bacteria 9721
322 Ga0207707_10007166 3300025912 Bacteria 9705
323 Ga0207707_10057693 3300025912 Bacteria 3379
324 Ga0207707_10060292 3300025912 Bacteria 3301
325 Ga0207707_10248489 3300025912 Bacteria 1545
326 Ga0207707_10292634 3300025912 Unclassified 1409
327 Ga0207695_10000563 3300025913 Bacteria 76084
328 Ga0207695_10001447 3300025913 Bacteria 39719
329 Ga0207695_10008730 3300025913 Bacteria 12638
330 Ga0207695_10016938 3300025913 Bacteria 8503
331 Ga0207695_10035763 3300025913 Bacteria 5380
332 Ga0207695_10220905 3300025913 Bacteria 1802
333 Ga0207695_10305061 3300025913 Bacteria 1483
334 Ga0207671_10000256 3300025914 Bacteria 79879
335 Ga0207660_10023863 3300025917 Unclassified 4135
336 Ga0207660_10052210 3300025917 Bacteria 2910
337 Ga0207660_10087896 3300025917 Bacteria 2297
338 Ga0207660_10390683 3300025917 Bacteria 1119
339 Ga0207657_10008514 3300025919 Bacteria 10401
340 Ga0207657_10022801 3300025919 Bacteria 5846
341 Ga0207657_10141762 3300025919 Bacteria 1963
342 Ga0207652_10008525 3300025921 Bacteria 8251
343 Ga0207652_10009178 3300025921 Bacteria 7960
344 Ga0207652_10078610 3300025921 Bacteria 2881
345 Ga0207652_10111378 3300025921 Bacteria 2427
346 Ga0207652_10447328 3300025921 Bacteria 1165
347 Ga0207646_10000447 3300025922 Bacteria 55120
348 Ga0207694_10002271 3300025924 Bacteria 15729
349 Ga0207694_10003426 3300025924 Bacteria 12624
350 Ga0207694_10009451 3300025924 Bacteria 7349
351 Ga0207694_10051476 3300025924 Bacteria 3192
352 Ga0207694_10096390 3300025924 Bacteria 2339
353 Ga0207694_10151685 3300025924 Bacteria 1867
354 Ga0207694_10192305 3300025924 Bacteria 1658
355 Ga0207659_10149339 3300025926 Bacteria 1823
356 Ga0207687_10023621 3300025927 Bacteria 4101
357 Ga0207687_10025790 3300025927 Bacteria 3934
358 Ga0207687_10174634 3300025927 Bacteria 1660
359 Ga0207687_10355395 3300025927 Bacteria 1195
360 Ga0207700_10108197 3300025928 Bacteria 2232
361 Ga0207700_10123466 3300025928 Bacteria 2103
362 Ga0207644_10013253 3300025931 Bacteria 5493
363 Ga0207709_10060594 3300025935 Bacteria 2360
364 Ga0207704_10162165 3300025938 Bacteria 1592
365 Ga0207691_10093132 3300025940 Bacteria 2698
366 Ga0207711_10000062 3300025941 Bacteria 125048
367 Ga0207711_10003507 3300025941 Bacteria 13580
368 Ga0207711_10048173 3300025941 Bacteria 3646
369 Ga0207711_10274577 3300025941 Bacteria 1551
370 Ga0207711_10466262 3300025941 Bacteria 1176
371 Ga0207689_10025222 3300025942 Bacteria 4984
372 Ga0207689_10197476 3300025942 Bacteria 1660
373 Ga0207661_10028768 3300025944 Bacteria 4260
374 Ga0207661_10031447 3300025944 Bacteria 4100
375 Ga0207661_10131306 3300025944 Bacteria 2145
376 Ga0207661_10309717 3300025944 Bacteria 1417
377 Ga0207661_10543208 3300025944 Bacteria 1064
378 Ga0207667_10001746 3300025949 Bacteria 27378
379 Ga0207667_10015000 3300025949 Bacteria 8814
380 Ga0207667_10021589 3300025949 Bacteria 7132
381 Ga0207667_10039308 3300025949 Bacteria 5044
382 Ga0207667_10050214 3300025949 Bacteria 4402
383 Ga0207667_10140890 3300025949 Bacteria 2483
384 Ga0207712_10106426 3300025961 Bacteria 2095
385 Ga0207668_10030442 3300025972 Bacteria 3547
386 Ga0207668_10118986 3300025972 Bacteria 1997
387 Ga0207677_10003453 3300026023 Bacteria 8374
388 Ga0207677_10162637 3300026023 Bacteria 1736
389 Ga0207703_10010141 3300026035 Bacteria 7385
390 Ga0207703_10012257 3300026035 Bacteria 6685
391 Ga0207703_10026240 3300026035 Unclassified 4584
392 Ga0207703_10033766 3300026035 Unclassified 4058
393 Ga0207703_10045889 3300026035 Bacteria 3516
394 Ga0207703_10054895 3300026035 Bacteria 3241
395 Ga0207703_10080867 3300026035 Bacteria 2707
396 Ga0207639_10035103 3300026041 Bacteria 3709
397 Ga0207678_10274679 3300026067 Unclassified 1446
398 Ga0207708_10190444 3300026075 Bacteria 1632
399 Ga0207702_10003891 3300026078 Bacteria 13446
400 Ga0207702_10045510 3300026078 Bacteria 3691
401 Ga0207702_10067007 3300026078 Unclassified 3080
402 Ga0207702_10153726 3300026078 Bacteria 2095
403 Ga0207641_10298302 3300026088 Bacteria 1521
404 Ga0207676_10015283 3300026095 Bacteria 5536
405 Ga0207676_10018647 3300026095 Bacteria 5050
406 Ga0207676_10120766 3300026095 Bacteria 2209
407 Ga0207674_10000503 3300026116 Bacteria 51625
408 Ga0207674_10002123 3300026116 Bacteria 25062
409 Ga0207674_10006162 3300026116 Bacteria 14164
410 Ga0207675_100352431 3300026118 Bacteria 1443
411 Ga0207683_10240206 3300026121 Bacteria 1652
412 Ga0207683_10461022 3300026121 Unclassified 1172
413 Ga0207698_10013952 3300026142 Bacteria 5322
414 Ga0207698_10015980 3300026142 Bacteria 5047
415 Ga0207698_10618425 3300026142 Bacteria 1070
416 Ga0209974_10016501 3300027876 Bacteria 2453
417 Ga0207428_10002460 3300027907 Bacteria 18500
418 Ga0268266_10003198 3300028379 Bacteria 16572
419 Ga0268266_10204867 3300028379 Unclassified 1807
420 Ga0268266_10228066 3300028379 Bacteria 1715
421 Ga0268266_10422514 3300028379 Bacteria 1263
422 Ga0268265_10000008 3300028380 Bacteria 417328
423 Ga0268264_10008000 3300028381 Bacteria 8793
424 Ga0268264_10025531 3300028381 Unclassified 4828
425 Ga0265338_10001562 3300028800 Bacteria 36957
426 Ga0265338_10056535 3300028800 Bacteria 3479
427 Ga0265338_10241884 3300028800 Bacteria 1336
428 Ga0265330_10004925 3300031235 Bacteria 6725
429 Ga0265330_10007010 3300031235 Bacteria 5531
430 Ga0265330_10022903 3300031235 Bacteria 2839
431 Ga0265330_10038588 3300031235 Bacteria 2123
432 Ga0265325_10041187 3300031241 Bacteria 2421
433 Ga0265329_10030458 3300031242 Bacteria 1758
434 Ga0265339_10000166 3300031249 Bacteria 55317
435 Ga0265339_10021965 3300031249 Bacteria 3703
436 Ga0265331_10007181 3300031250 Bacteria 6476
437 Ga0265316_10001544 3300031344 Bacteria 24695
438 Ga0265316_10004170 3300031344 Bacteria 14449
439 Ga0265316_10013362 3300031344 Bacteria 7297
440 Ga0265316_10116486 3300031344 Bacteria 2020
441 Ga0265316_10174139 3300031344 Bacteria 1604
442 Ga0307408_100015360 3300031548 Bacteria 5097
443 Ga0265313_10003840 3300031595 Bacteria 11854
444 Ga0265313_10008990 3300031595 Bacteria 6552
445 Ga0265314_10237486 3300031711 Bacteria 1053
446 Ga0265342_10004295 3300031712 Bacteria 11284
447 Ga0265342_10055883 3300031712 Bacteria 2342
448 Ga0316576_10010783 3300031727 Bacteria 5953
449 Ga0307410_10243692 3300031852 Bacteria 1394
450 Ga0307406_10104875 3300031901 Bacteria 1933
451 Ga0307406_10173181 3300031901 Bacteria 1564
452 Ga0307409_100013621 3300031995 Bacteria 5246
453 Ga0307411_10023799 3300032005 Bacteria 3637
454 Ga0307411_10188687 3300032005 Bacteria 1572
455 Ga0307415_100139531 3300032126 Bacteria 1849
456 Ga0373929_0000001 3300035085 Bacteria 956023
457 Ga0373934_0013316 3300035086 Bacteria 3108
458 Ga0373936_0021787 3300035113 Bacteria 2493
459 Ga0373954_0099487 3300035118 Bacteria 1402
460 Ga0373954_0136727 3300035118 Bacteria 1194
461 Ga0373956_0007033 3300035119 Bacteria 4525
462 Ga0373957_0030295 3300035120 Bacteria 1982
463 Ga0373957_0096527 3300035120 Bacteria 1180
464 Ga0373943_0021984 3300035170 Bacteria 2950
465 Ga0373943_0304227 3300035170 Unclassified 906
466 Ga0373946_0061604 3300035171 Bacteria 1598
467 Ga0373955_0043801 3300035172 Bacteria 2408
468 Ga0373955_0132194 3300035172 Bacteria 1457
469 Ga0316574_0007195 3300035398 Bacteria 6082
470 Ga0373935_0200642 3300035692 Bacteria 1378
471 Ga0373935_0239424 3300035692 Unclassified 1266
472 Ga0373927_0001504 3300035695 Bacteria 17541
473 Ga0373927_0006461 3300035695 Bacteria 7985
474 Ga0373927_0007949 3300035695 Bacteria 7161
475 Ga0373933_0009825 3300035724 Bacteria 5237
476 Ga0373947_0000236 3300035725 Bacteria 31165
477 Ga0373947_0104728 3300035725 Unclassified 1782
478 Ga0373947_0153208 3300035725 Bacteria 1486
479 Ga0373947_0185495 3300035725 Bacteria 1356
480 Ga0373937_0007488 3300036401 Bacteria 9448
481 Ga0373937_0029905 3300036401 Unclassified 4934
482 Ga0373937_0052871 3300036401 Bacteria 3726
483 Ga0373937_0063437 3300036401 Bacteria 3398
484 Ga0373937_0127978 3300036401 Bacteria 2370
485 Ga0373937_0323476 3300036401 Bacteria 1459
486 Ga0373937_0381349 3300036401 Bacteria 1337
487 Ga0373925_0000139 3300037068 Bacteria 77722
488 Ga0373925_0025741 3300037068 Bacteria 4302
489 Ga0373925_0094477 3300037068 Bacteria 2290
490 Ga0373925_0112771 3300037068 Bacteria 2102
491 Ga0373925_0654404 3300037068 Bacteria 866
492 Ga0395900_0334769 3300037418 Unclassified 1491
493 Ga0436364_0082088 3300037853 Bacteria 178031
494 Ga0436364_0096221 3300037853 Bacteria 10527
495 Ga0436364_0197022 3300037853 Bacteria 80312
496 Ga0436364_0199614 3300037853 Unclassified 2306
497 Ga0436364_0313932 3300037853 Bacteria 7755
498 Ga0436364_0366372 3300037853 Bacteria 231753
499 Ga0436364_0452996 3300037853 Bacteria 6077
500 Ga0436364_0472599 3300037853 Bacteria 2421
501 Ga0436364_1023107 3300037853 Bacteria 4470
502 Ga0436364_1046789 3300037853 Bacteria 1565
503 Ga0436364_1239453 3300037853 Bacteria 9049
504 Ga0436364_1247308 3300037853 Unclassified 2502
505 Ga0436364_1265083 3300037853 Bacteria 3197
506 Ga0436364_1326320 3300037853 Bacteria 13298
507 Ga0400483_130213 3300039062 Bacteria 38867
508 Ga0400483_164907 3300039062 Bacteria 38857
509 Ga0436365_0500041 3300039437 Bacteria 2754
510 Ga0436365_0586387 3300039437 Bacteria 1803
511 Ga0436365_1155152 3300039437 Bacteria 27379
512 Ga0436365_1532991 3300039437 Unclassified 1409
513 Ga0436365_1557740 3300039437 Bacteria 2674
514 Ga0436365_1806953 3300039437 Bacteria 11991
515 Ga0436365_1870226 3300039437 Unclassified 2652
516 Ga0436360_0212151 3300039438 Bacteria 1614
517 Ga0436361_0126076 3300039447 Bacteria 97470
518 Ga0436363_0052707 3300039450 Bacteria 4459
519 Ga0436363_0305072 3300039450 Bacteria 3553
520 Ga0436363_0647531 3300039450 Bacteria 1759
521 Ga0436363_1068053 3300039450 Unclassified 1723
522 Ga0436362_0471056 3300039453 Bacteria 3856
523 Ga0436362_0556739 3300039453 Bacteria 2633
524 Ga0436362_0890112 3300039453 Bacteria 1315
525 Ga0436362_0963183 3300039453 Unclassified 2394
526 Ga0439439_0000364 3300041406 Bacteria 7408
527 Ga0439433_0041527 3300041999 Bacteria 1071
528 Ga0439449_0000684 3300042007 Bacteria 12908
529 Ga0439462_0001458 3300042015 Bacteria 5275
530 Ga0450923_021441 3300042125 Bacteria 1260
531 Ga0451577_0553201 3300042876 Unclassified 1045
532 Ga0466961_0050872 3300044693 Bacteria 2646
533 Ga0466963_0003571 3300044694 Bacteria 8933
534 Ga0453684_0037846 3300044712 Bacteria 6614
535 Ga0453684_0061499 3300044712 Bacteria 4820
536 Ga0451576_0000417 3300045051 Bacteria 98902
537 Ga0451576_0140758 3300045051 Bacteria 2516
538 Ga0451576_0224788 3300045051 Bacteria 1960
539 Ga0451576_0659283 3300045051 Bacteria 1100
540 Ga0466967_0018179 3300045976 Bacteria 5610
541 Ga0495592_0041600 3300046454 Bacteria 3444
542 Ga0495592_0149165 3300046454 Bacteria 1619
543 Ga0495651_0059928 3300046462 Bacteria 2917
544 Ga0495651_0118703 3300046462 Bacteria 1946
545 Ga0495580_0004196 3300046472 Bacteria 12119
546 Ga0495580_0015979 3300046472 Bacteria 5646
547 Ga0495580_0026187 3300046472 Bacteria 4255
548 Ga0495580_0029946 3300046472 Bacteria 3946
549 Ga0495580_0048971 3300046472 Bacteria 2990
550 Ga0495580_0080968 3300046472 Bacteria 2263
551 Ga0495580_0114366 3300046472 Bacteria 1874
552 Ga0495580_0139981 3300046472 Bacteria 1677
553 Ga0495582_0076753 3300046473 Bacteria 1852
554 Ga0495582_0083217 3300046473 Bacteria 1778
555 Ga0495639_0064283 3300046475 Bacteria 1686
556 Ga0495664_0074207 3300046477 Bacteria 2035
557 Ga0495594_0017572 3300046499 Bacteria 3781
558 Ga0495628_0118358 3300046516 Unclassified 2034
559 Ga0495628_0529843 3300046516 Bacteria 848
560 Ga0495648_0199001 3300046524 Bacteria 1004
561 Ga0495652_0105876 3300046529 Bacteria 2272
562 Ga0495652_0129100 3300046529 Bacteria 2004
563 Ga0495665_0091083 3300046531 Bacteria 1602
564 Ga0495586_0096141 3300046535 Bacteria 1640
565 Ga0495586_0148444 3300046535 Bacteria 1318
566 Ga0495668_0000277 3300046616 Bacteria 71164
567 Ga0495634_0017369 3300046642 Bacteria 5135
568 Ga0495661_0072108 3300046665 Bacteria 2016
569 Ga0495623_0161155 3300046679 Unclassified 1318
570 Ga0495658_0399063 3300046683 Archaea 877
571 Ga0495624_0169747 3300046690 Unclassified 1331
572 Ga0495680_0107329 3300047322 Bacteria 2074
573 Ga0495675_0242017 3300047444 Bacteria 1086
574 Ga0495684_0223931 3300047471 Unclassified 1378
575 Ga0495602_0182331 3300048088 Bacteria 1618
576 Ga0495626_0015994 3300048091 Bacteria 3824
577 Ga0496102_0361519 3300048905 Bacteria 1367
578 Ga0496102_0376505 3300048905 Bacteria 1336
579 Ga0496104_0068796 3300048907 Bacteria 3364
580 Ga0496105_0011415 3300048908 Bacteria 7017
581 Ga0496105_0168540 3300048908 Bacteria 1796
582 Ga0496107_0195116 3300048910 Bacteria 1505
583 Ga0496108_0028771 3300048911 Bacteria 4597
584 Ga0496108_0186754 3300048911 Bacteria 1796
585 Ga0496109_0000016 3300048912 Bacteria 212455
586 Ga0496109_0011620 3300048912 Bacteria 7571
587 Ga0496109_0018772 3300048912 Bacteria 6082
588 Ga0496109_0022922 3300048912 Bacteria 5535
589 Ga0496109_0105115 3300048912 Bacteria 2622
590 Ga0496109_0121729 3300048912 Bacteria 2431
591 Ga0496109_0134749 3300048912 Bacteria 2307
592 Ga0496109_0582679 3300048912 Bacteria 1054
593 Ga0496110_0033002 3300048913 Bacteria 4475
594 Ga0496111_0037135 3300048914 Bacteria 3486
595 Ga0496111_0120134 3300048914 Bacteria 1941
596 Ga0496112_0100369 3300048915 Bacteria 2864
597 Ga0496112_0396347 3300048915 Bacteria 1320
598 Ga0496113_0301789 3300048916 Bacteria 1282
599 Ga0496115_0062817 3300048918 Bacteria 2997
600 Ga0496115_0083150 3300048918 Bacteria 2609
601 Ga0496116_0000687 3300048919 Bacteria 43932
602 Ga0496116_0003007 3300048919 Bacteria 17088
603 Ga0496116_0018895 3300048919 Bacteria 5292
604 Ga0496116_0043105 3300048919 Bacteria 3077
605 Ga0496117_0000161 3300048920 Bacteria 141379
606 Ga0496117_0034956 3300048920 Bacteria 3780
607 Ga0496118_0007983 3300048921 Bacteria 11063
608 Ga0496118_0035679 3300048921 Bacteria 4034
609 Ga0496118_0064168 3300048921 Bacteria 2697
610 Ga0496118_0126232 3300048921 Bacteria 1655
611 Ga0496119_0000042 3300048922 Bacteria 200701
612 Ga0496119_0024040 3300048922 Bacteria 4300
613 Ga0496119_0169212 3300048922 Bacteria 1155
614 Ga0496120_0000083 3300048923 Bacteria 157876
615 Ga0496120_0000283 3300048923 Bacteria 85428
616 Ga0496120_0002496 3300048923 Bacteria 18464
617 Ga0496120_0005499 3300048923 Bacteria 10087
618 Ga0496121_0048366 3300048924 Bacteria 3618
619 Ga0496121_0089174 3300048924 Bacteria 2415
620 Ga0496121_0169988 3300048924 Bacteria 1585
621 Ga0496122_0000012 3300048925 Bacteria 526837
622 Ga0496122_0009285 3300048925 Bacteria 10399
623 Ga0496122_0025502 3300048925 Bacteria 5131
624 Ga0496123_0001574 3300048926 Bacteria 31186
625 Ga0496123_0005728 3300048926 Bacteria 12374
626 Ga0496123_0011656 3300048926 Bacteria 7588
627 Ga0496125_0000010 3300048928 Bacteria 671167
628 Ga0496125_0000431 3300048928 Bacteria 77252
629 Ga0496125_0001417 3300048928 Bacteria 35011
630 Ga0496126_0000008 3300048929 Bacteria 781752
631 Ga0496126_0000461 3300048929 Bacteria 80907
632 Ga0496126_0017417 3300048929 Bacteria 7158
633 Ga0501031_0027847 3300049568 Bacteria 3683
634 Ga0501032_0015200 3300049569 Bacteria 5434
635 Ga0501038_0003585 3300049574 Bacteria 14445
636 Ga0501039_0042482 3300049575 Bacteria 3513
637 Ga0501041_0156690 3300049577 Bacteria 1423
638 Ga0501046_0390600 3300049580 Bacteria 1006
639 Ga0501047_0001292 3300049581 Bacteria 24708
640 Ga0501047_0221804 3300049581 Bacteria 1747
641 Ga0501067_0040970 3300049583 Bacteria 2572
642 Ga0501068_0000108 3300049584 Bacteria 35756
643 Ga0501069_0001287 3300049585 Bacteria 12294
644 Ga0501070_0350958 3300049586 Bacteria 1197
645 Ga0501072_0000002 3300049588 Bacteria 319523
646 Ga0501073_0004186 3300049589 Bacteria 10819
647 Ga0501074_0002365 3300049590 Bacteria 13131
648 Ga0501074_0410645 3300049590 Bacteria 960
649 Ga0501075_0170278 3300049591 Bacteria 1662
650 Ga0501076_0003889 3300049592 Bacteria 10524
651 Ga0501077_0148822 3300049593 Bacteria 1485
652 Ga0501079_0207833 3300049741 Bacteria 1529
653 Ga0501080_0092520 3300049742 Bacteria 2808
654 Ga0501083_0001967 3300049744 Bacteria 14120
655 Ga0501044_0017299 3300049823 Bacteria 7732
656 nmdc:mga05p37_454675_c1 3300050507 Bacteria 1481
657 nmdc:mga0qj67_92397_c1 3300050509 Bacteria 2433
658 nmdc:mga06r32_66914_c1 3300050510 Bacteria 3468
659 nmdc:mga06r32_722291_c1 3300050510 Bacteria 961
660 nmdc:mga08y16_13302_c1 3300050511 Bacteria 8655
661 nmdc:mga08y16_286600_c1 3300050511 Bacteria 1698
662 nmdc:mga0n895_514_c1 3300050512 Bacteria 26317
663 nmdc:mga0rr50_287013_c1 3300050513 Bacteria 1374
664 nmdc:mga0rr50_8099_c1 3300050513 Bacteria 6523
665 nmdc:mga08x19_12901_c1 3300050514 Bacteria 5042
666 nmdc:mga08x19_827_c2 3300050514 Bacteria 15119
667 Ga0495601_0122703 3300053077 Bacteria 1688
668 Ga0495612_0019411 3300053078 Bacteria 2722
669 Ga0501084_0000054 3300054114 Bacteria 90236
670 Ga0501084_0087935 3300054114 Bacteria 2609
671 Ga0501084_0340003 3300054114 Bacteria 1268
672 Ga0590071_003190 3300059421 Bacteria 4047
673 Ga0590075_011613 3300059424 Bacteria 2131
674 Ga0590077_000882 3300059426 Bacteria 7687
675 Ga0590077_012694 3300059426 Bacteria 1748
676 Ga0501082_0016842 3300060353 Bacteria 6293
677 Ga0530510_0080386 3300061734 Bacteria 2372
678 2506866930 2506783011 Bacteria 5323186
679 2508674004 2508501039 Bacteria 9978592
680 2517764687 2517572101 Bacteria 6884336
681 2524190811 2524023129 Bacteria 6762600
682 2528203559 2527291627 Bacteria 5309833
683 2528214317 2527291629 Bacteria 5267418
684 2546948322 2546825537 Bacteria 5389291
685 2579749639 2576861822 Bacteria 5004595
686 2579858163 2579778521 Bacteria 7624758
687 2619859104 2619618881 Bacteria 7521104
688 2620354158 2619619003 Bacteria 7619552
689 2626639121 2626541554 Bacteria 7741902
690 2676198933 2675902999 Bacteria 9438463
691 2686537516 2684623035 Bacteria 8032739
692 2686544800 2684623036 Bacteria 5199090
693 2689962385 2687453737 Bacteria 11203906
694 2689991307 2687453743 Bacteria 8361025
695 2710601910 2710264753 Bacteria 5455564
696 2723602272 2721755693 Bacteria 6126117
697 2730138407 2728369359 Bacteria 5621728
698 2745166234 2744054657 Bacteria 5016802
699 2753809140 2751185905 Bacteria 6142767
700 2774843511 2773857921 Bacteria 9435764
701 2774863645 2773857924 Bacteria 5256821
702 2802439498 2802428803 Bacteria 5806948
703 2817618061 2816332336 Bacteria 5207640
704 2889278356 2889276214 Bacteria 5979355
705 2895890913 2895880812 Bacteria 11255272
706 2904118188 2904113452 Bacteria 7796941
707 2904600143 2904595352 Bacteria 6124848
708 2919414511 2919414237 Bacteria 5429133
709 2925328343 2925326138 Bacteria 9652120
710 2939706290 2939702853 Bacteria 5139229
711 2996709459 2996706504 Bacteria 5757485
712 3006973210 3006969106 Bacteria 4739423
713 637878829 637000116 Bacteria 5433628
714 648168812 648028048 Bacteria 5394884
715 8002779324 8002775197 Bacteria 10728764
716 8002784165 8002784119 Bacteria 9788632
717 8054915258 8054913762 Bacteria 7713009
718 8054922172 8054920844 Bacteria 7068637
719 8057477220 8057473075 Bacteria 5892720
720 8057978998 8057977335 Bacteria 5694872
721 Ga0213876_10071368
722 MBSR1b_contig_2607737
723 LJQas_1000007
724 JGI25406J46586_10031864
725 Ga0055541_1006232
726 Ga0065704_10093027
727 Ga0065715_10124535
728 Ga0070658_10017385
729 Ga0070658_10169684
730 Ga0070683_100013341
731 Ga0070683_100018105
732 Ga0070683_100046079
733 Ga0070683_100263147
734 Ga0070690_100053341
735 Ga0070690_100386479
736 Ga0068869_100023139
737 Ga0070680_100009354
738 Ga0070680_100010904
739 Ga0070680_100038161
740 Ga0070680_100307333
741 Ga0068868_100002275
742 Ga0070660_100034314
743 Ga0070660_100167511
744 Ga0070689_100034718
745 Ga0070691_10017606
746 Ga0070661_100013004
747 Ga0070661_100026126
748 Ga0070661_100115847
749 Ga0070661_100286029
750 Ga0070668_100049194
751 Ga0070675_100155155
752 Ga0070671_100312434
753 Ga0070674_100020577
754 Ga0070659_100083707
755 Ga0070709_10106829
756 Ga0070709_10127394
757 Ga0070709_10301612
758 Ga0070713_100093866
759 Ga0070713_100147555
760 Ga0070713_100211971
761 Ga0070711_100030940
762 Ga0070711_100242037
763 Ga0070711_100277359
764 Ga0070700_100403488
765 Ga0070694_100037348
766 Ga0070708_100015506
767 Ga0070708_100081034
768 Ga0070678_100179288
769 Ga0070678_100219297
770 Ga0070681_10000605
771 Ga0070681_10005377
772 Ga0070681_10034973
773 Ga0070681_10043027
774 Ga0070681_10150205
775 Ga0070681_10213804
776 Ga0070706_100027585
777 Ga0070707_100089736
778 Ga0070707_100156247
779 Ga0070707_100294931
780 Ga0070699_100024627
781 Ga0070699_100208234
782 Ga0070679_100005804
783 Ga0070679_100009024
784 Ga0070679_100140602
785 Ga0070679_100170443
786 Ga0070684_100002114
787 Ga0070684_100022521
788 Ga0070684_100249089
789 Ga0070697_100036073
790 Ga0070697_100037641
791 Ga0070697_100046586
792 Ga0068853_100038145
793 Ga0068853_100081151
794 Ga0068853_100314152
795 Ga0070672_100246532
796 Ga0070686_100071878
797 Ga0070695_100016987
798 Ga0070695_100026911
799 Ga0070695_100060897
800 Ga0070696_100040063
801 Ga0070693_100006824
802 Ga0070665_100048003
803 Ga0070665_100175928
804 Ga0070665_100238239
805 Ga0070704_100248779
806 Ga0068855_100004587
807 Ga0068855_100007492
808 Ga0068855_100049900
809 Ga0068855_100058864
810 Ga0068855_100085120
811 Ga0068855_100093880
812 Ga0068855_100095978
813 Ga0068855_100189752
814 Ga0070664_100176442
815 Ga0070664_100309057
816 Ga0070664_100336510
817 Ga0068857_100003819
818 Ga0068857_100007396
819 Ga0068854_100142677
820 Ga0068856_100010972
821 Ga0068856_100022526
822 Ga0068856_100027489
823 Ga0068856_100036394
824 Ga0068856_100040539
825 Ga0068856_100086445
826 Ga0068856_100118059
827 Ga0068856_100125226
828 Ga0068856_100218103
829 Ga0068852_100210130
830 Ga0068852_100264604
831 Ga0068852_100284848
832 Ga0068859_100000054
833 Ga0068859_100001223
834 Ga0068859_100024538
835 Ga0068859_100043795
836 Ga0068859_100058013
837 Ga0068859_100281892
838 Ga0068864_100020562
839 Ga0068864_100129878
840 Ga0068864_100225252
841 Ga0068861_100301950
842 Ga0068863_100419081
843 Ga0068863_100474461
844 Ga0068858_100005980
845 Ga0068858_100068750
846 Ga0068858_100072117
847 Ga0068858_100073980
848 Ga0068858_100129946
849 Ga0068858_100147216
850 Ga0068858_100272745
851 Ga0068860_100030585
852 Ga0068862_100000037
853 Ga0068862_100265430
854 Ga0081455_10007431
855 Ga0081455_10027970
856 Ga0081455_10133534
857 Ga0081539_10001047
858 Ga0081539_10008121
859 Ga0070717_10023812
860 Ga0070717_10451066
861 Ga0070712_100162944
862 Ga0070712_100310671
863 Ga0097621_100012173
864 Ga0097621_100059860
865 Ga0097621_100454928
866 Ga0097621_100456789
867 Ga0097621_100629932
868 Ga0068871_100005987
869 Ga0068871_100043122
870 Ga0068871_100262525
871 Ga0068871_100275505
872 Ga0068871_100503766
873 Ga0075428_100005577
874 Ga0075430_100013130
875 Ga0075431_100045761
876 Ga0075433_10003719
877 Ga0075434_100000069
878 Ga0075434_100319193
879 Ga0068865_100030146
880 Ga0075436_100007970
881 Ga0075436_100016687
882 Ga0097620_100000054
883 Ga0097620_100001223
884 Ga0097620_100024538
885 Ga0097620_100043791
886 Ga0097620_100058013
887 Ga0097620_100281880
888 Ga0075435_100106627
889 Ga0075435_100116985
890 Ga0099794_10069567
891 Ga0105240_10003303
892 Ga0105240_10003832
893 Ga0105240_10013706
894 Ga0105240_10037802
895 Ga0105240_10063307
896 Ga0105240_10084091
897 Ga0105240_10156934
898 Ga0105240_10664710
899 Ga0105240_10716684
900 Ga0111539_10077847
901 Ga0111539_10263308
902 Ga0111539_10340307
903 Ga0105245_10002254
904 Ga0105245_10061145
905 Ga0105245_10107928
906 Ga0105245_10157114
907 Ga0105245_10262345
908 Ga0105247_10000125
909 Ga0105247_10005102
910 Ga0105247_10071278
911 Ga0114129_10299524
912 Ga0114129_10333590
913 Ga0105243_10090788
914 Ga0105241_10008535
915 Ga0105241_10045243
916 Ga0105241_10138018
917 Ga0105242_10013866
918 Ga0105248_10000018
919 Ga0105248_10003078
920 Ga0105248_10045759
921 Ga0105248_10054531
922 Ga0105248_10085631
923 Ga0105248_10107131
924 Ga0105248_10232588
925 Ga0105248_10239066
926 Ga0105248_10332995
927 Ga0105237_10000223
928 Ga0105237_10021372
929 Ga0105237_10046509
930 Ga0105237_10077423
931 Ga0105237_10110999
932 Ga0105237_10173473
933 Ga0105237_10457109
934 Ga0105238_10008033
935 Ga0105238_10008204
936 Ga0105238_10011819
937 Ga0105238_10018386
938 Ga0105238_10062169
939 Ga0105238_10063942
940 Ga0105238_10118213
941 Ga0105249_10089219
942 Ga0105249_10134884
943 Ga0105249_10150578
944 Ga0105249_10237101
945 Ga0105239_10006113
946 Ga0105239_10018215
947 Ga0105239_10019814
948 Ga0105239_10020900
949 Ga0105239_10226136
950 Ga0105239_10242934
951 Ga0105246_10190773
952 Ga0157370_10005991
953 Ga0157370_10006307
954 Ga0157370_10016399
955 Ga0157370_10040560
956 Ga0157370_10057435
957 Ga0157370_10065457
958 Ga0157369_10008782
959 Ga0157369_10012845
960 Ga0157369_10013263
961 Ga0157369_10016965
962 Ga0157369_10063670
963 Ga0157369_10112426
964 Ga0157369_10152686
965 Ga0157369_10204804
966 Ga0157374_10012136
967 Ga0157374_10067061
968 Ga0157374_10258466
969 Ga0157374_10303284
970 Ga0157378_10054675
971 Ga0157378_10166445
972 Ga0157378_10184073
973 Ga0157378_10365856
974 Ga0163162_10013500
975 Ga0163162_10086353
976 Ga0163162_10124049
977 Ga0163162_10209761
978 Ga0163162_10258956
979 Ga0163162_10512574
980 Ga0163162_10799954
981 Ga0157372_10007318
982 Ga0157372_10020322
983 Ga0157372_10057171
984 Ga0157372_10118462
985 Ga0157372_10374825
986 Ga0157372_10665210
987 Ga0157375_10005690
988 Ga0157375_10159781
989 Ga0157375_10249317
990 Ga0157375_10327530
991 Ga0157375_10700022
992 Ga0163163_10002598
993 Ga0163163_10018126
994 Ga0163163_10040514
995 Ga0163163_10043155
996 Ga0163163_10152034
997 Ga0163163_10266364
998 Ga0163163_10451920
999 Ga0163163_10511951
1000 Ga0163163_10875955
1001 Ga0182008_10078939
1002 Ga0182008_10080883
1003 Ga0157379_10050360
1004 Ga0157379_10065070
1005 Ga0157379_10269986
1006 Ga0157379_10469430
1007 Ga0157376_10096022
1008 Ga0157376_10182786
1009 Ga0157376_10354898
1010 Ga0157376_10525925
1011 Ga0182006_1057686
1012 Ga0213872_10000182
1013 Ga0213874_10011049
1014 Ga0213874_10061087
1015 Ga0213876_10003589
1016 Ga0213876_10014097
1017 Ga0213876_10025225
1018 Ga0213875_10000019
1019 Ga0213875_10000109
1020 Ga0213875_10000137
1021 Ga0213875_10001103
1022 Ga0213875_10003448
1023 Ga0213875_10059306
1024 Ga0213875_10091566
1025 Ga0213875_10092868
1026 Ga0209566_100108
1027 Ga0209675_1030371
1028 Ga0209025_1004716
1029 Ga0207656_10029760
1030 Ga0207710_10000149
1031 Ga0207710_10002412
1032 Ga0207680_10044635
1033 Ga0207647_10206988
1034 Ga0207705_10047594
1035 Ga0207705_10067567
1036 Ga0207684_10071762
1037 Ga0207684_10127316
1038 Ga0207684_10220381
1039 Ga0207654_10078752
1040 Ga0207707_10000372
1041 Ga0207707_10007147
1042 Ga0207707_10007166
1043 Ga0207707_10057693
1044 Ga0207707_10060292
1045 Ga0207707_10248489
1046 Ga0207707_10292634
1047 Ga0207695_10000563
1048 Ga0207695_10001447
1049 Ga0207695_10008730
1050 Ga0207695_10016938
1051 Ga0207695_10035763
1052 Ga0207695_10220905
1053 Ga0207695_10305061
1054 Ga0207671_10000256
1055 Ga0207660_10023863
1056 Ga0207660_10052210
1057 Ga0207660_10087896
1058 Ga0207660_10390683
1059 Ga0207657_10008514
1060 Ga0207657_10022801
1061 Ga0207657_10141762
1062 Ga0207652_10008525
1063 Ga0207652_10009178
1064 Ga0207652_10078610
1065 Ga0207652_10111378
1066 Ga0207652_10447328
1067 Ga0207646_10000447
1068 Ga0207694_10002271
1069 Ga0207694_10003426
1070 Ga0207694_10009451
1071 Ga0207694_10051476
1072 Ga0207694_10096390
1073 Ga0207694_10151685
1074 Ga0207694_10192305
1075 Ga0207659_10149339
1076 Ga0207687_10023621
1077 Ga0207687_10025790
1078 Ga0207687_10174634
1079 Ga0207687_10355395
1080 Ga0207700_10108197
1081 Ga0207700_10123466
1082 Ga0207644_10013253
1083 Ga0207709_10060594
1084 Ga0207704_10162165
1085 Ga0207691_10093132
1086 Ga0207711_10000062
1087 Ga0207711_10003507
1088 Ga0207711_10048173
1089 Ga0207711_10274577
1090 Ga0207711_10466262
1091 Ga0207689_10025222
1092 Ga0207689_10197476
1093 Ga0207661_10028768
1094 Ga0207661_10031447
1095 Ga0207661_10131306
1096 Ga0207661_10309717
1097 Ga0207661_10543208
1098 Ga0207667_10001746
1099 Ga0207667_10015000
1100 Ga0207667_10021589
1101 Ga0207667_10039308
1102 Ga0207667_10050214
1103 Ga0207667_10140890
1104 Ga0207712_10106426
1105 Ga0207668_10030442
1106 Ga0207668_10118986
1107 Ga0207677_10003453
1108 Ga0207677_10162637
1109 Ga0207703_10010141
1110 Ga0207703_10012257
1111 Ga0207703_10026240
1112 Ga0207703_10033766
1113 Ga0207703_10045889
1114 Ga0207703_10054895
1115 Ga0207703_10080867
1116 Ga0207639_10035103
1117 Ga0207678_10274679
1118 Ga0207708_10190444
1119 Ga0207702_10003891
1120 Ga0207702_10045510
1121 Ga0207702_10067007
1122 Ga0207702_10153726
1123 Ga0207641_10298302
1124 Ga0207676_10015283
1125 Ga0207676_10018647
1126 Ga0207676_10120766
1127 Ga0207674_10000503
1128 Ga0207674_10002123
1129 Ga0207674_10006162
1130 Ga0207675_100352431
1131 Ga0207683_10240206
1132 Ga0207683_10461022
1133 Ga0207698_10013952
1134 Ga0207698_10015980
1135 Ga0207698_10618425
1136 Ga0209974_10016501
1137 Ga0207428_10002460
1138 Ga0268266_10003198
1139 Ga0268266_10204867
1140 Ga0268266_10228066
1141 Ga0268266_10422514
1142 Ga0268265_10000008
1143 Ga0268264_10008000
1144 Ga0268264_10025531
1145 Ga0265338_10001562
1146 Ga0265338_10056535
1147 Ga0265338_10241884
1148 Ga0265330_10004925
1149 Ga0265330_10007010
1150 Ga0265330_10022903
1151 Ga0265330_10038588
1152 Ga0265325_10041187
1153 Ga0265329_10030458
1154 Ga0265339_10000166
1155 Ga0265339_10021965
1156 Ga0265331_10007181
1157 Ga0265316_10001544
1158 Ga0265316_10004170
1159 Ga0265316_10013362
1160 Ga0265316_10116486
1161 Ga0265316_10174139
1162 Ga0307408_100015360
1163 Ga0265313_10003840
1164 Ga0265313_10008990
1165 Ga0265314_10237486
1166 Ga0265342_10004295
1167 Ga0265342_10055883
1168 Ga0316576_10010783
1169 Ga0307410_10243692
1170 Ga0307406_10104875
1171 Ga0307406_10173181
1172 Ga0307409_100013621
1173 Ga0307411_10023799
1174 Ga0307411_10188687
1175 Ga0307415_100139531
1176 Ga0373929_0000001
1177 Ga0373934_0013316
1178 Ga0373936_0021787
1179 Ga0373954_0099487
1180 Ga0373954_0136727
1181 Ga0373956_0007033
1182 Ga0373957_0030295
1183 Ga0373957_0096527
1184 Ga0373943_0021984
1185 Ga0373943_0304227
1186 Ga0373946_0061604
1187 Ga0373955_0043801
1188 Ga0373955_0132194
1189 Ga0316574_0007195
1190 Ga0373935_0200642
1191 Ga0373935_0239424
1192 Ga0373927_0001504
1193 Ga0373927_0006461
1194 Ga0373927_0007949
1195 Ga0373933_0009825
1196 Ga0373947_0000236
1197 Ga0373947_0104728
1198 Ga0373947_0153208
1199 Ga0373947_0185495
1200 Ga0373937_0007488
1201 Ga0373937_0029905
1202 Ga0373937_0052871
1203 Ga0373937_0063437
1204 Ga0373937_0127978
1205 Ga0373937_0323476
1206 Ga0373937_0381349
1207 Ga0373925_0000139
1208 Ga0373925_0025741
1209 Ga0373925_0094477
1210 Ga0373925_0112771
1211 Ga0373925_0654404
1212 Ga0395900_0334769
1213 Ga0436364_0082088
1214 Ga0436364_0096221
1215 Ga0436364_0197022
1216 Ga0436364_0199614
1217 Ga0436364_0313932
1218 Ga0436364_0366372
1219 Ga0436364_0452996
1220 Ga0436364_0472599
1221 Ga0436364_1023107
1222 Ga0436364_1046789
1223 Ga0436364_1239453
1224 Ga0436364_1247308
1225 Ga0436364_1265083
1226 Ga0436364_1326320
1227 Ga0400483_130213
1228 Ga0400483_164907
1229 Ga0436365_0500041
1230 Ga0436365_0586387
1231 Ga0436365_1155152
1232 Ga0436365_1532991
1233 Ga0436365_1557740
1234 Ga0436365_1806953
1235 Ga0436365_1870226
1236 Ga0436360_0212151
1237 Ga0436361_0126076
1238 Ga0436363_0052707
1239 Ga0436363_0305072
1240 Ga0436363_0647531
1241 Ga0436363_1068053
1242 Ga0436362_0471056
1243 Ga0436362_0556739
1244 Ga0436362_0890112
1245 Ga0436362_0963183
1246 Ga0439439_0000364
1247 Ga0439433_0041527
1248 Ga0439449_0000684
1249 Ga0439462_0001458
1250 Ga0450923_021441
1251 Ga0451577_0553201
1252 Ga0466961_0050872
1253 Ga0466963_0003571
1254 Ga0453684_0037846
1255 Ga0453684_0061499
1256 Ga0451576_0000417
1257 Ga0451576_0140758
1258 Ga0451576_0224788
1259 Ga0451576_0659283
1260 Ga0466967_0018179
1261 Ga0495592_0041600
1262 Ga0495592_0149165
1263 Ga0495651_0059928
1264 Ga0495651_0118703
1265 Ga0495580_0004196
1266 Ga0495580_0015979
1267 Ga0495580_0026187
1268 Ga0495580_0029946
1269 Ga0495580_0048971
1270 Ga0495580_0080968
1271 Ga0495580_0114366
1272 Ga0495580_0139981
1273 Ga0495582_0076753
1274 Ga0495582_0083217
1275 Ga0495639_0064283
1276 Ga0495664_0074207
1277 Ga0495594_0017572
1278 Ga0495628_0118358
1279 Ga0495628_0529843
1280 Ga0495648_0199001
1281 Ga0495652_0105876
1282 Ga0495652_0129100
1283 Ga0495665_0091083
1284 Ga0495586_0096141
1285 Ga0495586_0148444
1286 Ga0495668_0000277
1287 Ga0495634_0017369
1288 Ga0495661_0072108
1289 Ga0495623_0161155
1290 Ga0495658_0399063
1291 Ga0495624_0169747
1292 Ga0495680_0107329
1293 Ga0495675_0242017
1294 Ga0495684_0223931
1295 Ga0495602_0182331
1296 Ga0495626_0015994
1297 Ga0496102_0361519
1298 Ga0496102_0376505
1299 Ga0496104_0068796
1300 Ga0496105_0011415
1301 Ga0496105_0168540
1302 Ga0496107_0195116
1303 Ga0496108_0028771
1304 Ga0496108_0186754
1305 Ga0496109_0000016
1306 Ga0496109_0011620
1307 Ga0496109_0018772
1308 Ga0496109_0022922
1309 Ga0496109_0105115
1310 Ga0496109_0121729
1311 Ga0496109_0134749
1312 Ga0496109_0582679
1313 Ga0496110_0033002
1314 Ga0496111_0037135
1315 Ga0496111_0120134
1316 Ga0496112_0100369
1317 Ga0496112_0396347
1318 Ga0496113_0301789
1319 Ga0496115_0062817
1320 Ga0496115_0083150
1321 Ga0496116_0000687
1322 Ga0496116_0003007
1323 Ga0496116_0018895
1324 Ga0496116_0043105
1325 Ga0496117_0000161
1326 Ga0496117_0034956
1327 Ga0496118_0007983
1328 Ga0496118_0035679
1329 Ga0496118_0064168
1330 Ga0496118_0126232
1331 Ga0496119_0000042
1332 Ga0496119_0024040
1333 Ga0496119_0169212
1334 Ga0496120_0000083
1335 Ga0496120_0000283
1336 Ga0496120_0002496
1337 Ga0496120_0005499
1338 Ga0496121_0048366
1339 Ga0496121_0089174
1340 Ga0496121_0169988
1341 Ga0496122_0000012
1342 Ga0496122_0009285
1343 Ga0496122_0025502
1344 Ga0496123_0001574
1345 Ga0496123_0005728
1346 Ga0496123_0011656
1347 Ga0496125_0000010
1348 Ga0496125_0000431
1349 Ga0496125_0001417
1350 Ga0496126_0000008
1351 Ga0496126_0000461
1352 Ga0496126_0017417
1353 Ga0501031_0027847
1354 Ga0501032_0015200
1355 Ga0501038_0003585
1356 Ga0501039_0042482
1357 Ga0501041_0156690
1358 Ga0501046_0390600
1359 Ga0501047_0001292
1360 Ga0501047_0221804
1361 Ga0501067_0040970
1362 Ga0501068_0000108
1363 Ga0501069_0001287
1364 Ga0501070_0350958
1365 Ga0501072_0000002
1366 Ga0501073_0004186
1367 Ga0501074_0002365
1368 Ga0501074_0410645
1369 Ga0501075_0170278
1370 Ga0501076_0003889
1371 Ga0501077_0148822
1372 Ga0501079_0207833
1373 Ga0501080_0092520
1374 Ga0501083_0001967
1375 Ga0501044_0017299
1376 nmdc:mga05p37_454675_c1
1377 nmdc:mga0qj67_92397_c1
1378 nmdc:mga06r32_66914_c1
1379 nmdc:mga06r32_722291_c1
1380 nmdc:mga08y16_13302_c1
1381 nmdc:mga08y16_286600_c1
1382 nmdc:mga0n895_514_c1
1383 nmdc:mga0rr50_287013_c1
1384 nmdc:mga0rr50_8099_c1
1385 nmdc:mga08x19_12901_c1
1386 nmdc:mga08x19_827_c2
1387 Ga0495601_0122703
1388 Ga0495612_0019411
1389 Ga0501084_0000054
1390 Ga0501084_0087935
1391 Ga0501084_0340003
1392 Ga0590071_003190
1393 Ga0590075_011613
1394 Ga0590077_000882
1395 Ga0590077_012694
1396 Ga0501082_0016842
1397 Ga0530510_0080386
1398 2506866930
1399 2508674004
1400 2517764687
1401 2524190811
1402 2528203559
1403 2528214317
1404 2546948322
1405 2579749639
1406 2579858163
1407 2619859104
1408 2620354158
1409 2626639121
1410 2676198933
1411 2686537516
1412 2686544800
1413 2689962385
1414 2689991307
1415 2710601910
1416 2723602272
1417 2730138407
1418 2745166234
1419 2753809140
1420 2774843511
1421 2774863645
1422 2802439498
1423 2817618061
1424 2889278356
1425 2895890913
1426 2904118188
1427 2904600143
1428 2919414511
1429 2925328343
1430 2939706290
1431 2996709459
1432 3006973210
1433 637878829
1434 648168812
1435 8002779324
1436 8002784165
1437 8054915258
1438 8054922172
1439 8057477220
1440 8057978998

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

32

146

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

149

330

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9654 2 303
2c2y-assembly1.cif.gz_A-2 three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis 0.9653 3 302
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9592 3 301
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9587 2 303
2c2y-assembly1.cif.gz_A-2 three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis 0.9552 3 302
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9976 34 114 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9911 34 115 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9908 13 125 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9855 34 114 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9849 31 115 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A6N6S1Z9-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9989 3 121 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2S8LSJ0-F1-model_v4 deleted 0.9981 40 122
AF-A0A3C1LSI1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9947 8 105 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A353JZC0-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9923 1 107 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A382NA53-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.992 1 109 GO:0004477
GO:0004488
GO:0005829
GO:0035999

Map