F477322

General Info

Members Datasets Scaffolds Average Seq Length
720 365 684 222

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0158880|Ga0466967_0158880_288_1070
Length 260
Sequence LRFGGHKPFAFAGFSAWAALASVLEFFSGHTQGQLSLIELAPSILSADFAHLAAAVQAVAEGGATVLHVDVMDGHFVPNITIGPPVVASLRKVTNLPLDVHLMIENPDQFIPAFVEAGADWISVHQEACVHLHRTLELIQNHGADAGVVINPATPVSMLEEVLDMVHHVLVMSVNPGFGGQKFIPFTLDKLRKLVMMRAERRANFRIEIDGGISTETVTEVVRAGAEILVAGNAVFGHGRPRENVQQLLKLAGEATLQKV

Samples

Sample ID Description Type Environment
1 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
2 2643221729 Bacillus sp. Root11 Isolate Unclassified
3 2643221730 Bacillus sp. Root131 Isolate Unclassified
4 2643221731 Bacillus sp. Root147 Isolate Unclassified
5 2684622632 Bacillus cereus 905 Isolate Unclassified
6 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
7 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
8 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
9 2738541358 Bacillus sp. OV752 Isolate Unclassified
10 2738543006 Bacillus sp. OK077 Isolate Unclassified
11 2738543017 Bacillus sp. OV186 Isolate Unclassified
12 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
13 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
14 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
15 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
16 2857586860 Bacillus sp. R-71935 Isolate Unclassified
17 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
18 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
19 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
20 2938917290 Bacillus sp. CR71 Isolate Unclassified
21 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
22 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
23 2965761152 Bacillus sp. COPE52 Isolate Unclassified
24 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
25 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
26 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
27 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
134 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
203 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
221 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
241 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
358 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
359 8022792930 Bacillus sp. Xin Isolate Rhizosphere
360 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
361 8023438354 Bacillus sp. BH2 Isolate Unclassified
362 8023444577 Bacillus sp. BH32 Isolate Unclassified
363 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
364 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
365 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 1.67
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.75
Nodule 0
Rhizoplane 3.06
Rhizosphere 86.53
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003344 3300002987 Bacteria 5720
2 JGI25159J45721_1009643 3300002987 Bacteria 2530
3 JGI25151J46595_10007057 3300003187 Bacteria 5548
4 JGI25151J46595_10011988 3300003187 Bacteria 3958
5 rootH1_10001147 3300003316 Bacteria 54261
6 rootL2_10074625 3300003322 Bacteria 23985
7 Ga0006562J51391_1001252 3300003578 Bacteria 15410
8 Ga0055528_1002612 3300003790 Bacteria 9541
9 Ga0058862_10154010 3300004803 Bacteria 4254
10 Ga0058862_11897790 3300004803 Bacteria 1301
11 Ga0070683_100818071 3300005329 Bacteria 893
12 Ga0070690_100098394 3300005330 Bacteria 1936
13 Ga0068869_100217399 3300005334 Bacteria 1513
14 Ga0070666_10004404 3300005335 Bacteria 8576
15 Ga0070680_100003696 3300005336 Bacteria 11428
16 Ga0070680_100067788 3300005336 Bacteria 2927
17 Ga0070680_100277938 3300005336 Bacteria 1418
18 Ga0070682_100080613 3300005337 Bacteria 2105
19 Ga0068868_100390657 3300005338 Bacteria 1199
20 Ga0070660_100035330 3300005339 Bacteria 3782
21 Ga0070689_100765956 3300005340 Bacteria 847
22 Ga0070691_10004289 3300005341 Bacteria 6476
23 Ga0070661_100034522 3300005344 Bacteria 3668
24 Ga0070668_100020184 3300005347 Bacteria 5025
25 Ga0070669_100131906 3300005353 Bacteria 1918
26 Ga0070675_100046170 3300005354 Bacteria 3566
27 Ga0070671_100025544 3300005355 Bacteria 4848
28 Ga0070671_100202723 3300005355 Bacteria 1682
29 Ga0070674_100288097 3300005356 Bacteria 1304
30 Ga0070673_100144172 3300005364 Bacteria 2012
31 Ga0070688_100532674 3300005365 Bacteria 890
32 Ga0070659_100021466 3300005366 Bacteria 4919
33 Ga0070667_100002113 3300005367 Bacteria 17509
34 Ga0070667_100076545 3300005367 Bacteria 2857
35 Ga0070667_100128619 3300005367 Bacteria 2209
36 Ga0070709_10029758 3300005434 Bacteria 3270
37 Ga0070714_100000045 3300005435 Bacteria 113749
38 Ga0070713_100028460 3300005436 Bacteria 4413
39 Ga0070713_100369270 3300005436 Bacteria 1335
40 Ga0070711_100319627 3300005439 Bacteria 1240
41 Ga0070711_100430166 3300005439 Bacteria 1077
42 Ga0070700_100488353 3300005441 Bacteria 945
43 Ga0070694_100495454 3300005444 Bacteria 971
44 Ga0070681_10001506 3300005458 Bacteria 20626
45 Ga0070681_10010687 3300005458 Bacteria 9074
46 Ga0070681_10104818 3300005458 Bacteria 2769
47 Ga0070681_10195653 3300005458 Bacteria 1941
48 Ga0070681_10202467 3300005458 Bacteria 1903
49 Ga0070681_11071672 3300005458 Bacteria 726
50 Ga0068867_100827992 3300005459 Bacteria 827
51 Ga0070679_100007294 3300005530 Bacteria 10325
52 Ga0070679_100016917 3300005530 Bacteria 7050
53 Ga0070679_100076140 3300005530 Bacteria 3345
54 Ga0070684_100002498 3300005535 Bacteria 13554
55 Ga0070684_100007045 3300005535 Bacteria 8739
56 Ga0070684_100056735 3300005535 Bacteria 3418
57 Ga0070684_100119564 3300005535 Bacteria 2370
58 Ga0070697_100001968 3300005536 Bacteria 15713
59 Ga0068853_100056726 3300005539 Bacteria 3379
60 Ga0068853_100114412 3300005539 Bacteria 2400
61 Ga0070695_100168657 3300005545 Bacteria 1543
62 Ga0070695_100172867 3300005545 Bacteria 1525
63 Ga0070696_100351671 3300005546 Bacteria 1141
64 Ga0070693_100013404 3300005547 Bacteria 4176
65 Ga0070665_100000795 3300005548 Bacteria 41370
66 Ga0070665_100002296 3300005548 Bacteria 21239
67 Ga0070665_100109204 3300005548 Bacteria 2768
68 Ga0068855_100002276 3300005563 Bacteria 23723
69 Ga0068855_100023639 3300005563 Bacteria 7360
70 Ga0068855_100029565 3300005563 Bacteria 6549
71 Ga0068855_100223618 3300005563 Bacteria 2110
72 Ga0070664_100943194 3300005564 Bacteria 810
73 Ga0068857_100000716 3300005577 Bacteria 24726
74 Ga0068857_100007977 3300005577 Bacteria 9139
75 Ga0068857_100275686 3300005577 Bacteria 1546
76 Ga0068854_100206509 3300005578 Bacteria 1547
77 Ga0068854_100227187 3300005578 Bacteria 1480
78 Ga0068856_100000584 3300005614 Bacteria 39905
79 Ga0068856_100043815 3300005614 Bacteria 4402
80 Ga0068856_100084692 3300005614 Bacteria 3149
81 Ga0068856_100227285 3300005614 Bacteria 1882
82 Ga0068856_100510144 3300005614 Bacteria 1224
83 Ga0068852_100006091 3300005616 Bacteria 8693
84 Ga0068852_100051595 3300005616 Bacteria 3531
85 Ga0068852_100388270 3300005616 Bacteria 1371
86 Ga0068864_100351442 3300005618 Bacteria 1391
87 Ga0068864_100983929 3300005618 Bacteria 836
88 Ga0068866_10046767 3300005718 Bacteria 2178
89 Ga0068866_10273778 3300005718 Bacteria 1043
90 Ga0068861_100070646 3300005719 Bacteria 2704
91 Ga0068863_100000591 3300005841 Bacteria 36891
92 Ga0068863_100015005 3300005841 Bacteria 7441
93 Ga0068863_100225095 3300005841 Bacteria 1808
94 Ga0068863_100500124 3300005841 Bacteria 1197
95 Ga0068858_100008753 3300005842 Bacteria 9712
96 Ga0068858_100050136 3300005842 Bacteria 3864
97 Ga0068858_100059432 3300005842 Bacteria 3533
98 Ga0068858_100114451 3300005842 Bacteria 2520
99 Ga0068858_100152337 3300005842 Bacteria 2174
100 Ga0068858_100193074 3300005842 Bacteria 1924
101 Ga0068858_100722015 3300005842 Bacteria 970
102 Ga0068860_100000124 3300005843 Bacteria 124227
103 Ga0068860_100985489 3300005843 Bacteria 860
104 Ga0068862_100015848 3300005844 Bacteria 6262
105 Ga0068862_100137563 3300005844 Bacteria 2166
106 Ga0081540_1002336 3300005983 Bacteria 15529
107 Ga0081539_10004900 3300005985 Bacteria 14269
108 Ga0075368_10027029 3300006042 Bacteria 2211
109 Ga0075364_10001655 3300006051 Bacteria 12245
110 Ga0070715_10028218 3300006163 Bacteria 2249
111 Ga0070715_10139930 3300006163 Bacteria 1174
112 Ga0070716_100000492 3300006173 Bacteria 16423
113 Ga0070716_100017030 3300006173 Bacteria 3760
114 Ga0070712_100024963 3300006175 Bacteria 3967
115 Ga0070712_100047342 3300006175 Bacteria 2976
116 Ga0070712_100048193 3300006175 Bacteria 2953
117 Ga0075367_10003446 3300006178 Bacteria 7546
118 Ga0097621_100002374 3300006237 Bacteria 12906
119 Ga0097621_100116456 3300006237 Bacteria 2263
120 Ga0097621_100201538 3300006237 Bacteria 1728
121 Ga0075370_10000403 3300006353 Bacteria 15977
122 Ga0068871_100317720 3300006358 Bacteria 1370
123 Ga0068871_100405234 3300006358 Bacteria 1215
124 Ga0068871_100522318 3300006358 Bacteria 1072
125 Ga0075428_100011720 3300006844 Bacteria 9759
126 Ga0075430_100292626 3300006846 Unclassified 1347
127 Ga0075431_100045681 3300006847 Bacteria 4515
128 Ga0075431_100073774 3300006847 Bacteria 3521
129 Ga0075433_10000173 3300006852 Bacteria 35469
130 Ga0075434_100055879 3300006871 Bacteria 3922
131 Ga0075434_100514936 3300006871 Bacteria 1217
132 Ga0075434_100726014 3300006871 Bacteria 1011
133 Ga0075429_100027316 3300006880 Bacteria 4953
134 Ga0075429_100040499 3300006880 Bacteria 4057
135 Ga0075429_100042492 3300006880 Bacteria 3956
136 Ga0068865_100088713 3300006881 Bacteria 2238
137 Ga0099794_10248010 3300007265 Bacteria 918
138 Ga0105251_10033177 3300009011 Bacteria 2566
139 Ga0105244_10029566 3300009036 Bacteria 2926
140 Ga0105244_10060400 3300009036 Bacteria 1910
141 Ga0105244_10175224 3300009036 Bacteria 1019
142 Ga0105250_10000710 3300009092 Bacteria 20530
143 Ga0105250_10004303 3300009092 Bacteria 6573
144 Ga0105250_10007605 3300009092 Bacteria 4645
145 Ga0105250_10044738 3300009092 Bacteria 1775
146 Ga0105250_10164818 3300009092 Bacteria 926
147 Ga0105240_10008022 3300009093 Bacteria 15200
148 Ga0105240_10008522 3300009093 Bacteria 14654
149 Ga0105240_10018690 3300009093 Bacteria 9287
150 Ga0105240_10071151 3300009093 Unclassified 4302
151 Ga0105240_10097720 3300009093 Bacteria 3578
152 Ga0105240_10159088 3300009093 Bacteria 2685
153 Ga0105240_10167387 3300009093 Bacteria 2606
154 Ga0105240_11386896 3300009093 Bacteria 739
155 Ga0111539_10004974 3300009094 Bacteria 17299
156 Ga0111539_10023605 3300009094 Bacteria 7557
157 Ga0105245_10005954 3300009098 Bacteria 10713
158 Ga0105245_10013777 3300009098 Bacteria 7042
159 Ga0105245_10071261 3300009098 Bacteria 3156
160 Ga0105245_10219974 3300009098 Bacteria 1832
161 Ga0105247_10420735 3300009101 Bacteria 956
162 Ga0114129_10001310 3300009147 Bacteria 33247
163 Ga0114129_10003757 3300009147 Bacteria 21399
164 Ga0114129_10017346 3300009147 Bacteria 10250
165 Ga0114129_10047535 3300009147 Bacteria 6029
166 Ga0105243_10002974 3300009148 Bacteria 14002
167 Ga0105243_10382311 3300009148 Bacteria 1302
168 Ga0105241_10022091 3300009174 Bacteria 4711
169 Ga0105241_10037389 3300009174 Bacteria 3657
170 Ga0105241_10043990 3300009174 Bacteria 3383
171 Ga0105241_10294231 3300009174 Bacteria 1391
172 Ga0105242_10002299 3300009176 Bacteria 15093
173 Ga0105242_10023253 3300009176 Bacteria 4886
174 Ga0105242_10067385 3300009176 Bacteria 2959
175 Ga0105242_11300227 3300009176 Bacteria 751
176 Ga0105248_10006547 3300009177 Bacteria 12771
177 Ga0105248_10026324 3300009177 Bacteria 6471
178 Ga0105248_10080063 3300009177 Bacteria 3671
179 Ga0105248_10205546 3300009177 Bacteria 2219
180 Ga0105248_10300709 3300009177 Bacteria 1807
181 Ga0105237_10010352 3300009545 Bacteria 9931
182 Ga0105237_10074953 3300009545 Bacteria 3376
183 Ga0105237_10172548 3300009545 Bacteria 2163
184 Ga0105237_10236500 3300009545 Bacteria 1828
185 Ga0105237_10831996 3300009545 Bacteria 930
186 Ga0105238_10000959 3300009551 Bacteria 29509
187 Ga0105238_10048977 3300009551 Bacteria 4257
188 Ga0105238_10088840 3300009551 Bacteria 3077
189 Ga0105238_10092899 3300009551 Bacteria 3005
190 Ga0105238_10206995 3300009551 Bacteria 1938
191 Ga0105238_10284513 3300009551 Bacteria 1635
192 Ga0105238_10626012 3300009551 Bacteria 1085
193 Ga0105238_10677785 3300009551 Bacteria 1042
194 Ga0105249_10038241 3300009553 Bacteria 4353
195 Ga0105249_10075349 3300009553 Bacteria 3125
196 Ga0105249_10095664 3300009553 Bacteria 2785
197 Ga0105249_10106935 3300009553 Bacteria 2640
198 Ga0105239_10003659 3300010375 Bacteria 18789
199 Ga0105239_10006626 3300010375 Bacteria 13408
200 Ga0105239_10215460 3300010375 Bacteria 2153
201 Ga0105239_10294677 3300010375 Bacteria 1827
202 Ga0105239_10754315 3300010375 Bacteria 1114
203 Ga0105246_10003746 3300011119 Bacteria 9215
204 Ga0105246_10028473 3300011119 Bacteria 3671
205 Ga0105246_10114094 3300011119 Bacteria 1990
206 Ga0157370_10013077 3300013104 Bacteria 8567
207 Ga0157370_10024501 3300013104 Bacteria 5977
208 Ga0157370_10097743 3300013104 Bacteria 2754
209 Ga0157369_10001499 3300013105 Bacteria 28639
210 Ga0157369_10001507 3300013105 Bacteria 28572
211 Ga0157369_10018212 3300013105 Bacteria 7876
212 Ga0157369_10252479 3300013105 Bacteria 1840
213 Ga0157369_10272458 3300013105 Bacteria 1763
214 Ga0157369_10572370 3300013105 Bacteria 1167
215 Ga0157369_10578404 3300013105 Bacteria 1160
216 Ga0157374_10005352 3300013296 Bacteria 10776
217 Ga0157374_10014588 3300013296 Bacteria 6877
218 Ga0157374_10017559 3300013296 Bacteria 6302
219 Ga0157374_10073087 3300013296 Bacteria 3237
220 Ga0157374_10848251 3300013296 Bacteria 930
221 Ga0157378_10005189 3300013297 Bacteria 11435
222 Ga0163162_10002954 3300013306 Bacteria 16227
223 Ga0163162_10623743 3300013306 Bacteria 1203
224 Ga0163162_11180641 3300013306 Unclassified 868
225 Ga0157372_10087374 3300013307 Bacteria 3538
226 Ga0157372_10171146 3300013307 Bacteria 2513
227 Ga0157375_10002682 3300013308 Bacteria 15421
228 Ga0163163_10034926 3300014325 Bacteria 4874
229 Ga0163163_10425915 3300014325 Bacteria 1386
230 Ga0163163_10451957 3300014325 Bacteria 1345
231 Ga0163163_10651804 3300014325 Bacteria 1116
232 Ga0157380_10034195 3300014326 Bacteria 3919
233 Ga0157380_10127585 3300014326 Bacteria 2165
234 Ga0157379_10035876 3300014968 Bacteria 4422
235 Ga0157379_10040329 3300014968 Bacteria 4167
236 Ga0157379_10172217 3300014968 Bacteria 1954
237 Ga0157376_10030719 3300014969 Bacteria 4293
238 Ga0157376_10128559 3300014969 Bacteria 2257
239 Ga0157376_10206628 3300014969 Bacteria 1810
240 Ga0163161_10501316 3300017792 Bacteria 989
241 Ga0206356_10960057 3300020070 Bacteria 880
242 Ga0206355_1406151 3300020076 Bacteria 2889
243 Ga0206352_10796245 3300020078 Bacteria 884
244 Ga0206350_10164359 3300020080 Bacteria 1398
245 Ga0206354_10243924 3300020081 Bacteria 1434
246 Ga0224712_10010938 3300022467 Bacteria 2794
247 Ga0224712_10014748 3300022467 Bacteria 2525
248 Ga0209566_100054 3300025225 Bacteria 221422
249 Ga0209147_100147 3300025229 Bacteria 103478
250 Ga0209147_101339 3300025229 Bacteria 9360
251 Ga0209233_1003995 3300025261 Bacteria 5111
252 Ga0209673_1008114 3300025273 Bacteria 4721
253 Ga0209130_1002308 3300025284 Bacteria 9757
254 Ga0209130_1024027 3300025284 Bacteria 1336
255 Ga0209675_1048704 3300025291 Bacteria 885
256 Ga0209676_1000671 3300025292 Bacteria 48631
257 Ga0209025_1001474 3300025294 Bacteria 30636
258 Ga0209025_1001829 3300025294 Bacteria 25005
259 Ga0209025_1005920 3300025294 Bacteria 9748
260 Ga0209025_1011722 3300025294 Bacteria 5727
261 Ga0209025_1016024 3300025294 Bacteria 4461
262 Ga0209025_1039336 3300025294 Bacteria 2064
263 Ga0209025_1050244 3300025294 Bacteria 1669
264 Ga0207696_1000943 3300025711 Bacteria 17794
265 Ga0207696_1001826 3300025711 Bacteria 10960
266 Ga0207696_1002435 3300025711 Bacteria 9133
267 Ga0207696_1021931 3300025711 Bacteria 2038
268 Ga0207655_1003259 3300025728 Bacteria 12183
269 Ga0207655_1006507 3300025728 Bacteria 7728
270 Ga0207713_1000974 3300025735 Bacteria 25301
271 Ga0207713_1036567 3300025735 Bacteria 2104
272 Ga0207642_10020980 3300025899 Bacteria 2563
273 Ga0207642_10110248 3300025899 Bacteria 1400
274 Ga0207710_10248944 3300025900 Bacteria 888
275 Ga0207685_10099717 3300025905 Bacteria 1239
276 Ga0207685_10195231 3300025905 Bacteria 947
277 Ga0207699_10011912 3300025906 Bacteria 4408
278 Ga0207699_10014021 3300025906 Bacteria 4120
279 Ga0207699_10186218 3300025906 Bacteria 1398
280 Ga0207705_10153379 3300025909 Bacteria 1727
281 Ga0207654_10009007 3300025911 Bacteria 5065
282 Ga0207654_10026740 3300025911 Bacteria 3128
283 Ga0207654_10030605 3300025911 Bacteria 2956
284 Ga0207654_10048711 3300025911 Bacteria 2426
285 Ga0207654_10411921 3300025911 Bacteria 942
286 Ga0207707_10000224 3300025912 Bacteria 60855
287 Ga0207707_10003625 3300025912 Bacteria 13691
288 Ga0207707_10126777 3300025912 Bacteria 2232
289 Ga0207707_10401577 3300025912 Bacteria 1176
290 Ga0207695_10000533 3300025913 Bacteria 79615
291 Ga0207695_10013787 3300025913 Bacteria 9617
292 Ga0207695_10052088 3300025913 Bacteria 4291
293 Ga0207695_10110840 3300025913 Bacteria 2724
294 Ga0207695_10172671 3300025913 Bacteria 2086
295 Ga0207695_10181126 3300025913 Unclassified 2028
296 Ga0207671_10042259 3300025914 Bacteria 3374
297 Ga0207671_10060807 3300025914 Bacteria 2803
298 Ga0207693_10000187 3300025915 Bacteria 56636
299 Ga0207693_10012450 3300025915 Bacteria 6874
300 Ga0207693_10020483 3300025915 Bacteria 5259
301 Ga0207663_10039723 3300025916 Bacteria 2853
302 Ga0207663_10180119 3300025916 Bacteria 1508
303 Ga0207660_10015178 3300025917 Bacteria 5081
304 Ga0207660_10280497 3300025917 Bacteria 1322
305 Ga0207657_10047663 3300025919 Bacteria 3745
306 Ga0207657_10540860 3300025919 Bacteria 911
307 Ga0207649_10428252 3300025920 Bacteria 995
308 Ga0207652_10005967 3300025921 Bacteria 9856
309 Ga0207652_10009933 3300025921 Bacteria 7660
310 Ga0207694_10000545 3300025924 Bacteria 34152
311 Ga0207694_10006193 3300025924 Bacteria 9136
312 Ga0207694_10018377 3300025924 Bacteria 5284
313 Ga0207694_10024007 3300025924 Bacteria 4631
314 Ga0207694_10053086 3300025924 Bacteria 3142
315 Ga0207659_10069659 3300025926 Bacteria 2562
316 Ga0207687_10004677 3300025927 Bacteria 9108
317 Ga0207687_10096701 3300025927 Bacteria 2165
318 Ga0207687_10114119 3300025927 Bacteria 2010
319 Ga0207687_10147137 3300025927 Bacteria 1793
320 Ga0207700_10421456 3300025928 Bacteria 1173
321 Ga0207664_10000063 3300025929 Bacteria 113763
322 Ga0207664_10696174 3300025929 Bacteria 914
323 Ga0207644_10024273 3300025931 Bacteria 4161
324 Ga0207644_10045343 3300025931 Bacteria 3128
325 Ga0207706_10092503 3300025933 Bacteria 2659
326 Ga0207686_10006947 3300025934 Bacteria 6093
327 Ga0207686_10020281 3300025934 Bacteria 3795
328 Ga0207686_10057549 3300025934 Bacteria 2448
329 Ga0207686_10533698 3300025934 Bacteria 915
330 Ga0207709_10004912 3300025935 Bacteria 7655
331 Ga0207709_10109909 3300025935 Bacteria 1841
332 Ga0207670_10356275 3300025936 Bacteria 1160
333 Ga0207669_10288569 3300025937 Bacteria 1241
334 Ga0207665_10001360 3300025939 Bacteria 16473
335 Ga0207711_10001263 3300025941 Bacteria 23968
336 Ga0207711_10018860 3300025941 Bacteria 5735
337 Ga0207711_10063146 3300025941 Bacteria 3196
338 Ga0207711_10162091 3300025941 Bacteria 2025
339 Ga0207689_10145563 3300025942 Bacteria 1952
340 Ga0207689_10179387 3300025942 Bacteria 1747
341 Ga0207689_10303167 3300025942 Bacteria 1324
342 Ga0207689_10618072 3300025942 Bacteria 912
343 Ga0207661_10012672 3300025944 Bacteria 6137
344 Ga0207661_10026842 3300025944 Bacteria 4393
345 Ga0207661_10101200 3300025944 Bacteria 2420
346 Ga0207661_10128582 3300025944 Bacteria 2166
347 Ga0207661_10195276 3300025944 Bacteria 1777
348 Ga0207661_10744324 3300025944 Bacteria 902
349 Ga0207679_10617753 3300025945 Bacteria 978
350 Ga0207667_10000322 3300025949 Bacteria 66404
351 Ga0207667_10030375 3300025949 Bacteria 5846
352 Ga0207667_10176447 3300025949 Bacteria 2195
353 Ga0207667_10666148 3300025949 Bacteria 1045
354 Ga0207651_10054764 3300025960 Bacteria 2735
355 Ga0207651_10410067 3300025960 Bacteria 1154
356 Ga0207712_10060408 3300025961 Bacteria 2687
357 Ga0207712_10500148 3300025961 Bacteria 1039
358 Ga0207712_10616138 3300025961 Bacteria 940
359 Ga0207668_10006517 3300025972 Bacteria 6897
360 Ga0207640_10262427 3300025981 Bacteria 1347
361 Ga0207658_10002789 3300025986 Bacteria 12579
362 Ga0207658_10234417 3300025986 Bacteria 1551
363 Ga0207677_10456619 3300026023 Bacteria 1096
364 Ga0207703_10023134 3300026035 Bacteria 4880
365 Ga0207703_10046850 3300026035 Bacteria 3484
366 Ga0207703_10055839 3300026035 Bacteria 3214
367 Ga0207703_10077462 3300026035 Bacteria 2760
368 Ga0207703_10093470 3300026035 Bacteria 2533
369 Ga0207703_10116212 3300026035 Bacteria 2290
370 Ga0207639_10055457 3300026041 Bacteria 3034
371 Ga0207639_10061393 3300026041 Bacteria 2903
372 Ga0207639_10644942 3300026041 Bacteria 979
373 Ga0207702_10001895 3300026078 Bacteria 20447
374 Ga0207702_10061034 3300026078 Bacteria 3215
375 Ga0207702_10355599 3300026078 Bacteria 1403
376 Ga0207641_10002289 3300026088 Bacteria 17837
377 Ga0207641_10144934 3300026088 Bacteria 2147
378 Ga0207641_10295845 3300026088 Bacteria 1527
379 Ga0207648_10016334 3300026089 Bacteria 6787
380 Ga0207676_10211464 3300026095 Bacteria 1721
381 Ga0207676_10341431 3300026095 Bacteria 1382
382 Ga0207676_10951875 3300026095 Bacteria 844
383 Ga0207674_10000350 3300026116 Bacteria 59446
384 Ga0207674_10008397 3300026116 Bacteria 11938
385 Ga0207674_10215474 3300026116 Bacteria 1869
386 Ga0207675_100041628 3300026118 Bacteria 4290
387 Ga0207675_100766752 3300026118 Bacteria 976
388 Ga0207683_10221335 3300026121 Bacteria 1725
389 Ga0207698_10002809 3300026142 Bacteria 10409
390 Ga0207698_10135643 3300026142 Bacteria 2111
391 Ga0207428_10011746 3300027907 Bacteria 7724
392 Ga0207428_10019602 3300027907 Bacteria 5764
393 Ga0268266_10002662 3300028379 Bacteria 18798
394 Ga0268266_10028502 3300028379 Bacteria 4745
395 Ga0268266_10627155 3300028379 Bacteria 1034
396 Ga0268265_10031658 3300028380 Bacteria 3822
397 Ga0268265_10110565 3300028380 Bacteria 2242
398 Ga0268264_10000027 3300028381 Bacteria 440852
399 Ga0268264_10461161 3300028381 Bacteria 1233
400 Ga0265338_10066134 3300028800 Bacteria 3130
401 Ga0237817_10064 3300030083 Bacteria 35967
402 Ga0268256_1005862 3300030500 Bacteria 4708
403 Ga0265320_10012925 3300031240 Bacteria 4826
404 Ga0265327_10070510 3300031251 Bacteria 1751
405 Ga0307408_100035921 3300031548 Bacteria 3480
406 Ga0307408_100281684 3300031548 Bacteria 1385
407 Ga0265313_10011168 3300031595 Bacteria 5600
408 Ga0316575_10003764 3300031665 Bacteria 5274
409 Ga0316575_10024198 3300031665 Bacteria 2349
410 Ga0316579_10045790 3300031691 Bacteria 2040
411 Ga0265314_10011222 3300031711 Bacteria 7414
412 Ga0316576_10039421 3300031727 Bacteria 3391
413 Ga0316576_10100611 3300031727 Bacteria 2160
414 Ga0316578_10049089 3300031728 Unclassified 2466
415 Ga0316578_10274690 3300031728 Bacteria 1009
416 Ga0316577_10004002 3300031733 Bacteria 7544
417 Ga0316577_10038292 3300031733 Bacteria 2682
418 Ga0307410_10054611 3300031852 Bacteria 2709
419 Ga0307410_10355537 3300031852 Bacteria 1172
420 Ga0307406_10107466 3300031901 Bacteria 1913
421 Ga0307407_10643107 3300031903 Bacteria 794
422 Ga0307416_100490958 3300032002 Bacteria 1290
423 Ga0307416_100493374 3300032002 Bacteria 1287
424 Ga0307416_100898158 3300032002 Bacteria 986
425 Ga0307411_10303630 3300032005 Bacteria 1281
426 Ga0307415_100108285 3300032126 Bacteria 2055
427 Ga0316583_10000274 3300032133 Bacteria 14265
428 Ga0316583_10000560 3300032133 Bacteria 11244
429 Ga0316583_10024747 3300032133 Bacteria 2144
430 Ga0316583_10033001 3300032133 Bacteria 1840
431 Ga0316583_10084614 3300032133 Bacteria 1108
432 Ga0316580_10026637 3300032139 Bacteria 1788
433 Ga0373928_0002459 3300035084 Bacteria 3589
434 Ga0373934_0004823 3300035086 Bacteria 4988
435 Ga0373934_0028363 3300035086 Bacteria 2181
436 Ga0373923_0039399 3300035111 Bacteria 1940
437 Ga0373932_0013385 3300035112 Bacteria 2039
438 Ga0373953_0017659 3300035117 Bacteria 2627
439 Ga0373953_0168681 3300035117 Bacteria 942
440 Ga0373954_0033937 3300035118 Bacteria 2361
441 Ga0373956_0075611 3300035119 Bacteria 1541
442 Ga0373957_0055352 3300035120 Bacteria 1525
443 Ga0373955_0172783 3300035172 Bacteria 1280
444 Ga0373955_0189369 3300035172 Bacteria 1223
445 Ga0373955_0397501 3300035172 Bacteria 837
446 Ga0316574_0001779 3300035398 Bacteria 10466
447 Ga0373935_0212804 3300035692 Bacteria 1340
448 Ga0373935_0387181 3300035692 Bacteria 1002
449 Ga0373933_0020180 3300035724 Bacteria 3776
450 Ga0373933_0195727 3300035724 Bacteria 1292
451 Ga0373947_0074466 3300035725 Bacteria 2089
452 Ga0373937_0028222 3300036401 Bacteria 5077
453 Ga0373937_0100194 3300036401 Bacteria 2688
454 Ga0373937_0110421 3300036401 Bacteria 2557
455 Ga0373937_0116026 3300036401 Bacteria 2494
456 Ga0373937_0308972 3300036401 Bacteria 1495
457 Ga0316582_0009984 3300036647 Bacteria 5181
458 Ga0316582_0026331 3300036647 Bacteria 3500
459 Ga0316584_0031977 3300036712 Bacteria 3892
460 Ga0316584_0111966 3300036712 Bacteria 2042
461 Ga0316584_0155297 3300036712 Bacteria 1702
462 Ga0316584_0217793 3300036712 Bacteria 1404
463 Ga0373925_0524231 3300037068 Bacteria 974
464 Ga0373925_0650746 3300037068 Bacteria 868
465 Ga0395905_0046662 3300037471 Bacteria 4063
466 Ga0316581_0006044 3300037588 Bacteria 3187
467 Ga0237819_00110 3300038705 Bacteria 30255
468 Ga0451577_0000241 3300042876 Bacteria 108191
469 Ga0451577_0039495 3300042876 Bacteria 4241
470 Ga0451577_0043115 3300042876 Bacteria 4042
471 Ga0451577_0132601 3300042876 Bacteria 2236
472 Ga0451577_0152727 3300042876 Bacteria 2078
473 Ga0453683_0010518 3300044673 Bacteria 6128
474 Ga0453683_0030579 3300044673 Bacteria 3404
475 Ga0453683_0196294 3300044673 Bacteria 1281
476 Ga0466963_0572464 3300044694 Bacteria 798
477 Ga0453684_0000366 3300044712 Bacteria 186117
478 Ga0453684_0013557 3300044712 Bacteria 13222
479 Ga0453684_0219653 3300044712 Bacteria 2202
480 Ga0453684_0272620 3300044712 Bacteria 1933
481 Ga0453684_0309482 3300044712 Bacteria 1793
482 Ga0453684_0635008 3300044712 Bacteria 1167
483 Ga0451576_0000138 3300045051 Bacteria 185167
484 Ga0451576_0005856 3300045051 Bacteria 15266
485 Ga0451576_0098529 3300045051 Bacteria 3041
486 Ga0451576_0346470 3300045051 Bacteria 1555
487 Ga0451576_0400010 3300045051 Bacteria 1440
488 Ga0451576_0576249 3300045051 Bacteria 1183
489 Ga0466967_0000014 3300045976 Bacteria 99206
490 Ga0466967_0005146 3300045976 Bacteria 8996
491 Ga0466967_0113279 3300045976 Bacteria 2495
492 Ga0466967_0158880 3300045976 Bacteria 2120
493 Ga0466967_0781440 3300045976 Bacteria 948
494 Ga0466967_0948172 3300045976 Bacteria 856
495 Ga0495603_0095625 3300046455 Bacteria 1736
496 Ga0495603_0245693 3300046455 Bacteria 1030
497 Ga0495641_0003534 3300046461 Bacteria 11613
498 Ga0495651_0047803 3300046462 Bacteria 3306
499 Ga0495651_0077715 3300046462 Bacteria 2512
500 Ga0495580_0127040 3300046472 Bacteria 1770
501 Ga0495582_0004318 3300046473 Bacteria 7992
502 Ga0495582_0014794 3300046473 Bacteria 4287
503 Ga0495605_0077786 3300046474 Bacteria 1556
504 Ga0495605_0080546 3300046474 Bacteria 1524
505 Ga0495664_0076901 3300046477 Bacteria 1998
506 Ga0495584_0014741 3300046491 Bacteria 3982
507 Ga0495585_0036363 3300046492 Bacteria 2778
508 Ga0495594_0053576 3300046499 Bacteria 2222
509 Ga0495596_0035078 3300046500 Unclassified 1990
510 Ga0495628_0416205 3300046516 Bacteria 980
511 Ga0495644_0001174 3300046523 Bacteria 10747
512 Ga0495652_0014290 3300046529 Bacteria 7130
513 Ga0495665_0026826 3300046531 Bacteria 3093
514 Ga0495586_0044955 3300046535 Bacteria 2379
515 Ga0495587_0005456 3300046536 Bacteria 8296
516 Ga0495587_0109951 3300046536 Bacteria 1584
517 Ga0495587_0157970 3300046536 Bacteria 1291
518 Ga0495621_0111627 3300046539 Bacteria 1049
519 Ga0495645_0009695 3300046543 Bacteria 6735
520 Ga0495667_0035399 3300046559 Bacteria 3337
521 Ga0495656_0041097 3300046615 Bacteria 1930
522 Ga0495656_0052955 3300046615 Unclassified 1742
523 Ga0495635_0029998 3300046663 Bacteria 3781
524 Ga0495588_0117258 3300046674 Bacteria 1403
525 Ga0495599_0000343 3300046678 Bacteria 27587
526 Ga0495623_0066892 3300046679 Bacteria 2244
527 Ga0495623_0074015 3300046679 Bacteria 2117
528 Ga0495647_0090080 3300046681 Bacteria 1257
529 Ga0495669_0009653 3300046684 Bacteria 4072
530 Ga0495669_0029100 3300046684 Bacteria 2421
531 Ga0495669_0061916 3300046684 Unclassified 1695
532 Ga0495669_0107071 3300046684 Bacteria 1303
533 Ga0495613_0134083 3300046689 Bacteria 1773
534 Ga0495613_0420195 3300046689 Bacteria 910
535 Ga0495589_0171192 3300046794 Bacteria 1032
536 Ga0495600_0176426 3300046809 Bacteria 1378
537 Ga0495600_0265862 3300046809 Bacteria 1089
538 Ga0495604_0066714 3300047317 Bacteria 2736
539 Ga0495676_0058211 3300047321 Bacteria 3042
540 Ga0495680_0062275 3300047322 Bacteria 2869
541 Ga0495683_0180603 3300047323 Bacteria 964
542 Ga0495675_0012462 3300047444 Bacteria 5352
543 Ga0495675_0025880 3300047444 Bacteria 3739
544 Ga0495675_0297709 3300047444 Bacteria 959
545 Ga0495677_0021330 3300047445 Bacteria 2348
546 Ga0495685_124043 3300047447 Bacteria 847
547 Ga0495684_0002760 3300047471 Bacteria 13871
548 Ga0495686_0372459 3300047472 Bacteria 772
549 Ga0495602_0211814 3300048088 Bacteria 1470
550 Ga0496100_0000498 3300048903 Bacteria 18867
551 Ga0496101_0000571 3300048904 Bacteria 22550
552 Ga0496102_0002229 3300048905 Bacteria 16619
553 Ga0496102_0543397 3300048905 Bacteria 1085
554 Ga0496103_0000697 3300048906 Bacteria 24934
555 Ga0496104_0030123 3300048907 Bacteria 5040
556 Ga0496104_0353665 3300048907 Bacteria 1382
557 Ga0496105_0001675 3300048908 Bacteria 15800
558 Ga0496106_0000192 3300048909 Bacteria 43140
559 Ga0496107_0000406 3300048910 Bacteria 23295
560 Ga0496108_0000290 3300048911 Bacteria 43303
561 Ga0496109_0001566 3300048912 Bacteria 19050
562 Ga0496110_0000108 3300048913 Bacteria 45034
563 Ga0496110_0001866 3300048913 Bacteria 15570
564 Ga0496110_0257991 3300048913 Bacteria 1587
565 Ga0496111_0000587 3300048914 Bacteria 19083
566 Ga0496112_0001734 3300048915 Bacteria 17071
567 Ga0496112_0255072 3300048915 Bacteria 1704
568 Ga0496113_0065573 3300048916 Bacteria 2749
569 Ga0496113_0072136 3300048916 Bacteria 2627
570 Ga0496115_0082454 3300048918 Bacteria 2620
571 Ga0496115_0136994 3300048918 Bacteria 2018
572 Ga0496116_0002109 3300048919 Bacteria 21219
573 Ga0496116_0006026 3300048919 Bacteria 11104
574 Ga0496116_0057934 3300048919 Bacteria 2529
575 Ga0496117_0065254 3300048920 Bacteria 2476
576 Ga0496117_0081889 3300048920 Bacteria 2116
577 Ga0496117_0238440 3300048920 Bacteria 1000
578 Ga0496119_0000166 3300048922 Bacteria 92117
579 Ga0496119_0002606 3300048922 Bacteria 19566
580 Ga0496120_0000406 3300048923 Bacteria 69216
581 Ga0496120_0169544 3300048923 Bacteria 1081
582 Ga0496122_0008068 3300048925 Bacteria 11482
583 Ga0496122_0029071 3300048925 Bacteria 4673
584 Ga0496122_0073114 3300048925 Bacteria 2433
585 Ga0496122_0142246 3300048925 Bacteria 1498
586 Ga0496123_0200478 3300048926 Bacteria 1023
587 Ga0496124_0000748 3300048927 Bacteria 53309
588 Ga0496124_0200152 3300048927 Bacteria 1520
589 Ga0496125_0018356 3300048928 Bacteria 6647
590 Ga0496126_0000005 3300048929 Bacteria 891906
591 Ga0496126_0002339 3300048929 Bacteria 25958
592 Ga0496126_0020601 3300048929 Bacteria 6458
593 Ga0496126_0024562 3300048929 Bacteria 5815
594 Ga0496126_0111183 3300048929 Bacteria 2386
595 Ga0501031_0027664 3300049568 Bacteria 3696
596 Ga0501032_0025975 3300049569 Bacteria 4033
597 Ga0501033_0002225 3300049570 Bacteria 16675
598 Ga0501033_0002400 3300049570 Bacteria 15945
599 Ga0501034_0139736 3300049571 Bacteria 2402
600 Ga0501034_0343343 3300049571 Bacteria 1422
601 Ga0501036_0008381 3300049572 Bacteria 8473
602 Ga0501036_0025068 3300049572 Bacteria 5029
603 Ga0501037_0008257 3300049573 Bacteria 7633
604 Ga0501037_0029373 3300049573 Bacteria 4061
605 Ga0501038_0021989 3300049574 Bacteria 5720
606 Ga0501038_0404691 3300049574 Bacteria 1055
607 Ga0501041_0054308 3300049577 Bacteria 2444
608 Ga0501041_0103824 3300049577 Bacteria 1761
609 Ga0501042_0023694 3300049578 Bacteria 4298
610 Ga0501046_0007059 3300049580 Bacteria 9890
611 Ga0501046_0124708 3300049580 Bacteria 1957
612 Ga0501047_0147928 3300049581 Bacteria 2225
613 Ga0501047_0196946 3300049581 Bacteria 1876
614 Ga0501048_0004626 3300049582 Bacteria 10470
615 Ga0501048_0061649 3300049582 Bacteria 2655
616 Ga0501048_0195348 3300049582 Bacteria 1434
617 Ga0501067_0015673 3300049583 Bacteria 4195
618 Ga0501067_0060736 3300049583 Bacteria 2092
619 Ga0501067_0200595 3300049583 Bacteria 1111
620 Ga0501068_0240801 3300049584 Bacteria 1151
621 Ga0501069_0051305 3300049585 Bacteria 2295
622 Ga0501069_0062438 3300049585 Bacteria 2080
623 Ga0501070_0007501 3300049586 Bacteria 9265
624 Ga0501070_0016879 3300049586 Bacteria 6126
625 Ga0501072_0445484 3300049588 Bacteria 1026
626 Ga0501073_0004269 3300049589 Bacteria 10713
627 Ga0501073_0012733 3300049589 Bacteria 6136
628 Ga0501073_0036396 3300049589 Bacteria 3497
629 Ga0501073_0067110 3300049589 Bacteria 2501
630 Ga0501074_0016785 3300049590 Bacteria 5312
631 Ga0501074_0054576 3300049590 Bacteria 2881
632 Ga0501074_0059424 3300049590 Bacteria 2754
633 Ga0501075_0033309 3300049591 Bacteria 3833
634 Ga0501075_0629376 3300049591 Bacteria 818
635 Ga0501076_0064479 3300049592 Bacteria 2920
636 Ga0501076_0167765 3300049592 Bacteria 1789
637 Ga0501076_0337170 3300049592 Bacteria 1237
638 Ga0501077_0189360 3300049593 Bacteria 1307
639 Ga0501079_0026084 3300049741 Bacteria 4481
640 Ga0501080_0039188 3300049742 Bacteria 4422
641 Ga0501080_0111404 3300049742 Bacteria 2537
642 Ga0501080_0245188 3300049742 Bacteria 1634
643 Ga0501080_0265592 3300049742 Bacteria 1563
644 Ga0501081_0142666 3300049743 Bacteria 1717
645 Ga0501083_0083175 3300049744 Bacteria 2120
646 Ga0501035_0003044 3300049822 Bacteria 16081
647 Ga0501035_0042588 3300049822 Bacteria 4094
648 Ga0501044_0084139 3300049823 Bacteria 3215
649 Ga0501045_0012697 3300049824 Bacteria 5931
650 Ga0501045_0133929 3300049824 Bacteria 1842
651 nmdc:mga00v17_49926_c1 3300050491 Bacteria 2540
652 nmdc:mga05p37_2171_c1 3300050507 Bacteria 22880
653 nmdc:mga05p37_24128_c1 3300050507 Bacteria 7388
654 nmdc:mga05p37_253602_c1 3300050507 Bacteria 2109
655 nmdc:mga05p37_560471_c1 3300050507 Bacteria 1298
656 nmdc:mga05p37_65410_c1 3300050507 Bacteria 4473
657 nmdc:mga09592_141350_c1 3300050508 Bacteria 2075
658 nmdc:mga09592_32991_c1 3300050508 Bacteria 4319
659 nmdc:mga06r32_117824_c1 3300050510 Unclassified 2617
660 nmdc:mga06r32_1186919_c1 3300050510 Bacteria 710
661 nmdc:mga06r32_31344_c1 3300050510 Bacteria 4992
662 nmdc:mga08y16_173730_c1 3300050511 Bacteria 2237
663 nmdc:mga08y16_18169_c1 3300050511 Bacteria 7409
664 nmdc:mga08y16_8741_c1 3300050511 Bacteria 10623
665 nmdc:mga0n895_187168_c1 3300050512 Bacteria 2101
666 nmdc:mga0rr50_293762_c1 3300050513 Bacteria 1358
667 nmdc:mga0a205_155444_c1 3300050515 Bacteria 2186
668 nmdc:mga0a205_328794_c1 3300050515 Bacteria 1398
669 nmdc:mga0a205_470_c1 3300050515 Bacteria 31351
670 Ga0495601_0276036 3300053077 Bacteria 1096
671 Ga0495619_0025784 3300053085 Bacteria 3778
672 Ga0495619_0065570 3300053085 Bacteria 2423
673 Ga0500616_0005077 3300053153 Bacteria 9085
674 Ga0501084_0000888 3300054114 Bacteria 23116
675 Ga0501084_0075701 3300054114 Bacteria 2820
676 Ga0501084_0083136 3300054114 Bacteria 2687
677 Ga0587073_0006030 3300059492 Bacteria 1842
678 Ga0587092_022268 3300059512 Bacteria 990
679 Ga0501082_0013571 3300060353 Bacteria 7000
680 Ga0501082_0059687 3300060353 Bacteria 3287
681 Ga0501082_0090722 3300060353 Bacteria 2639
682 Ga0501082_0098401 3300060353 Bacteria 2530
683 Ga0501082_0211932 3300060353 Bacteria 1685
684 Ga0530510_0292969 3300061734 Bacteria 1217

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0003534 Ga0495641_0003534_913_1596 186
2 3300047472 Ga0495686_0372459 Ga0495686_0372459_135_719 186
3 3300026121 Ga0207683_10221335 Ga0207683_102213352 187
4 3300005335 Ga0070666_10004404 Ga0070666_100044046 190
5 3300006847 Ga0075431_100073774 Ga0075431_1000737743 198
6 3300006880 Ga0075429_100027316 Ga0075429_1000273162 198
7 3300009147 Ga0114129_10001310 Ga0114129_1000131019 198
8 3300050507 nmdc:mga05p37_2171_c1 nmdc:mga05p37_2171_c1_7927_8619 198
9 3300050508 nmdc:mga09592_141350_c1 nmdc:mga09592_141350_c1_221_913 198
10 3300050510 nmdc:mga06r32_31344_c1 nmdc:mga06r32_31344_c1_270_962 198
11 3300050515 nmdc:mga0a205_155444_c1 nmdc:mga0a205_155444_c1_189_881 198
12 3300035692 Ga0373935_0387181 Ga0373935_0387181_188_838 199
13 3300049568 Ga0501031_0027664 Ga0501031_0027664_785_1459 202
14 3300049569 Ga0501032_0025975 Ga0501032_0025975_2667_3341 202
15 3300049570 Ga0501033_0002225 Ga0501033_0002225_15547_16221 202
16 3300049571 Ga0501034_0139736 Ga0501034_0139736_555_1229 202
17 3300049572 Ga0501036_0025068 Ga0501036_0025068_2799_3473 202
18 3300049573 Ga0501037_0029373 Ga0501037_0029373_441_1115 202
19 3300049574 Ga0501038_0021989 Ga0501038_0021989_3260_3934 202
20 3300049580 Ga0501046_0124708 Ga0501046_0124708_758_1432 202
21 3300049581 Ga0501047_0147928 Ga0501047_0147928_700_1374 202
22 3300049582 Ga0501048_0004626 Ga0501048_0004626_7390_8064 202
23 3300049583 Ga0501067_0015673 Ga0501067_0015673_370_1044 202
24 3300049584 Ga0501068_0240801 Ga0501068_0240801_58_732 202
25 3300049585 Ga0501069_0062438 Ga0501069_0062438_87_761 202
26 3300049586 Ga0501070_0007501 Ga0501070_0007501_4120_4794 202
27 3300049588 Ga0501072_0445484 Ga0501072_0445484_46_720 202
28 3300049589 Ga0501073_0012733 Ga0501073_0012733_4289_4963 202
29 3300049590 Ga0501074_0054576 Ga0501074_0054576_623_1297 202
30 3300049742 Ga0501080_0039188 Ga0501080_0039188_3302_3976 202
31 3300049744 Ga0501083_0083175 Ga0501083_0083175_182_856 202
32 3300049822 Ga0501035_0042588 Ga0501035_0042588_848_1522 202
33 3300049823 Ga0501044_0084139 Ga0501044_0084139_1558_2232 202
34 3300049824 Ga0501045_0133929 Ga0501045_0133929_1147_1821 202
35 3300050507 nmdc:mga05p37_65410_c1 nmdc:mga05p37_65410_c1_3312_4043 202
36 3300049570 Ga0501033_0002400 Ga0501033_0002400_4662_5336 203
37 3300049571 Ga0501034_0343343 Ga0501034_0343343_710_1384 203
38 3300049572 Ga0501036_0008381 Ga0501036_0008381_7670_8344 203
39 3300049573 Ga0501037_0008257 Ga0501037_0008257_2517_3191 203
40 3300049580 Ga0501046_0007059 Ga0501046_0007059_4554_5228 203
41 3300049581 Ga0501047_0196946 Ga0501047_0196946_402_1076 203
42 3300049582 Ga0501048_0061649 Ga0501048_0061649_1827_2501 203
43 3300049583 Ga0501067_0200595 Ga0501067_0200595_391_1065 203
44 3300049585 Ga0501069_0051305 Ga0501069_0051305_186_860 203
45 3300049586 Ga0501070_0016879 Ga0501070_0016879_1867_2541 203
46 3300049590 Ga0501074_0016785 Ga0501074_0016785_1053_1727 203
47 3300049741 Ga0501079_0026084 Ga0501079_0026084_3769_4443 203
48 3300049742 Ga0501080_0245188 Ga0501080_0245188_47_721 203
49 3300049822 Ga0501035_0003044 Ga0501035_0003044_10181_10855 203
50 3300054114 Ga0501084_0000888 Ga0501084_0000888_1746_2420 203
51 3300060353 Ga0501082_0013571 Ga0501082_0013571_3838_4512 203
52 3300013297 Ga0157378_10005189 Ga0157378_100051893 205
53 3300025294 Ga0209025_1039336 Ga0209025_10393363 206
54 3300031548 Ga0307408_100281684 Ga0307408_1002816842 206
55 3300036712 Ga0316584_0111966 Ga0316584_0111966_1047_1703 206
56 3300005618 Ga0068864_100983929 Ga0068864_1009839292 208
57 3300014969 Ga0157376_10030719 Ga0157376_100307196 208
58 3300026095 Ga0207676_10951875 Ga0207676_109518752 208
59 3300035172 Ga0373955_0189369 Ga0373955_0189369_307_987 208
60 3300046663 Ga0495635_0029998 Ga0495635_0029998_2178_2858 208
61 3300046681 Ga0495647_0090080 Ga0495647_0090080_47_727 208
62 3300047322 Ga0495680_0062275 Ga0495680_0062275_30_710 208
63 3300053077 Ga0495601_0276036 Ga0495601_0276036_259_939 208
64 3300053085 Ga0495619_0065570 Ga0495619_0065570_183_863 208
65 3300061734 Ga0530510_0292969 Ga0530510_0292969_379_1029 208
66 3300006880 Ga0075429_100042492 Ga0075429_1000424922 209
67 3300045051 Ga0451576_0400010 Ga0451576_0400010_182_838 209
68 3300046500 Ga0495596_0035078 Ga0495596_0035078_839_1528 209
69 3300046523 Ga0495644_0001174 Ga0495644_0001174_36_725 209
70 3300046615 Ga0495656_0041097 Ga0495656_0041097_876_1565 209
71 3300050508 nmdc:mga09592_32991_c1 nmdc:mga09592_32991_c1_902_1558 209
72 3300050510 nmdc:mga06r32_1186919_c1 nmdc:mga06r32_1186919_c1_32_688 209
73 iso_pu_bacteria 8022948649 8022949529 209
74 3300005347 Ga0070668_100020184 Ga0070668_1000201846 210
75 3300005355 Ga0070671_100025544 Ga0070671_1000255444 210
76 3300005367 Ga0070667_100002113 Ga0070667_10000211313 210
77 3300005435 Ga0070714_100000045 Ga0070714_10000004550 210
78 3300005842 Ga0068858_100114451 Ga0068858_1001144512 210
79 3300009553 Ga0105249_10095664 Ga0105249_100956642 210
80 3300014968 Ga0157379_10035876 Ga0157379_100358762 210
81 3300025929 Ga0207664_10000063 Ga0207664_1000006363 210
82 3300025961 Ga0207712_10616138 Ga0207712_106161381 210
83 3300026035 Ga0207703_10093470 Ga0207703_100934703 210
84 3300028379 Ga0268266_10028502 Ga0268266_100285023 210
85 3300031901 Ga0307406_10107466 Ga0307406_101074662 210
86 3300032126 Ga0307415_100108285 Ga0307415_1001082851 210
87 3300048916 Ga0496113_0072136 Ga0496113_0072136_47_718 210
88 iso_pu_bacteria 2551306519 2553391037 210
89 iso_pu_bacteria 2643221729 2644705245 210
90 iso_pu_bacteria 2643221730 2644709938 210
91 iso_pu_bacteria 2643221731 2644716082 210
92 iso_pu_bacteria 2684622632 2685151825 210
93 iso_pu_bacteria 2695420987 2698321339 210
94 iso_pu_bacteria 2703719227 2705995771 210
95 iso_pu_bacteria 2718218445 2721506991 210
96 iso_pu_bacteria 2738541358 2739154973 210
97 iso_pu_bacteria 2738543006 2739207655 210
98 iso_pu_bacteria 2738543017 2739268617 210
99 iso_pu_bacteria 2818991443 2819581048 210
100 iso_pu_bacteria 2818991465 2819709554 210
101 iso_pu_bacteria 2857465823 2857467074 210
102 iso_pu_bacteria 2857586860 2857588646 210
103 iso_pu_bacteria 2857591370 2857592990 210
104 iso_pu_bacteria 2929233124 2929237517 210
105 iso_pu_bacteria 2938917290 2938921711 210
106 iso_pu_bacteria 2947426588 2947430602 210
107 iso_pu_bacteria 2960319331 2960320538 210
108 iso_pu_bacteria 2965761152 2965765216 210
109 iso_pu_bacteria 2979083700 2979087480 210
110 iso_pu_bacteria 3001267043 3001267570 210
111 iso_pu_bacteria 3006973921 3006974786 210
112 iso_pu_bacteria 3006988479 3006989660 210
113 iso_pu_bacteria 8002317523 8002322322 210
114 iso_pu_bacteria 8022621104 8022623729 210
115 iso_pu_bacteria 8022792930 8022793895 210
116 iso_pu_bacteria 8023438354 8023440606 210
117 iso_pu_bacteria 8023444577 8023444709 210
118 iso_pu_bacteria 8046991243 8046997782 210
119 iso_pu_bacteria 8057582654 8057586287 210
120 iso_pu_bacteria 8057632132 8057634149 210
121 3300044712 Ga0453684_0219653 Ga0453684_0219653_907_1563 211
122 iso_pu_bacteria 2929297113 2929297739 211
123 3300005458 Ga0070681_10202467 Ga0070681_102024672 212
124 3300005548 Ga0070665_100000795 Ga0070665_10000079536 212
125 3300005841 Ga0068863_100000591 Ga0068863_10000059121 212
126 3300005843 Ga0068860_100000124 Ga0068860_10000012462 212
127 3300009551 Ga0105238_10677785 Ga0105238_106777851 212
128 3300025931 Ga0207644_10024273 Ga0207644_100242732 212
129 3300025972 Ga0207668_10006517 Ga0207668_100065174 212
130 3300025986 Ga0207658_10002789 Ga0207658_100027897 212
131 3300026088 Ga0207641_10002289 Ga0207641_1000228912 212
132 3300028381 Ga0268264_10000027 Ga0268264_1000002761 212
133 3300032002 Ga0307416_100898158 Ga0307416_1008981582 212
134 3300045976 Ga0466967_0781440 Ga0466967_0781440_99_743 212
135 3300048929 Ga0496126_0111183 Ga0496126_0111183_425_1099 212
136 3300053085 Ga0495619_0025784 Ga0495619_0025784_2411_3079 212
137 3300005983 Ga0081540_1002336 Ga0081540_10023364 213
138 3300005985 Ga0081539_10004900 Ga0081539_1000490016 213
139 3300010375 Ga0105239_10294677 Ga0105239_102946772 213
140 3300031691 Ga0316579_10045790 Ga0316579_100457902 213
141 3300031903 Ga0307407_10643107 Ga0307407_106431071 213
142 3300032133 Ga0316583_10024747 Ga0316583_100247472 213
143 3300036647 Ga0316582_0009984 Ga0316582_0009984_3219_3878 213
144 3300049577 Ga0501041_0103824 Ga0501041_0103824_568_1242 213
145 3300049593 Ga0501077_0189360 Ga0501077_0189360_228_902 213
146 3300050507 nmdc:mga05p37_560471_c1 nmdc:mga05p37_560471_c1_607_1287 213
147 3300053153 Ga0500616_0005077 Ga0500616_0005077_3162_3824 213
148 3300002987 JGI25159J45721_1003344 JGI25159J45721_10033442 214
149 3300002987 JGI25159J45721_1009643 JGI25159J45721_10096431 214
150 3300003187 JGI25151J46595_10007057 JGI25151J46595_100070572 214
151 3300003187 JGI25151J46595_10011988 JGI25151J46595_100119882 214
152 3300003316 rootH1_10001147 rootH1_1000114747 214
153 3300003322 rootL2_10074625 rootL2_1007462517 214
154 3300003578 Ga0006562J51391_1001252 Ga0006562J51391_100125214 214
155 3300003790 Ga0055528_1002612 Ga0055528_10026126 214
156 3300004803 Ga0058862_10154010 Ga0058862_101540101 214
157 3300004803 Ga0058862_11897790 Ga0058862_118977902 214
158 3300005329 Ga0070683_100818071 Ga0070683_1008180712 214
159 3300005330 Ga0070690_100098394 Ga0070690_1000983942 214
160 3300005334 Ga0068869_100217399 Ga0068869_1002173992 214
161 3300005336 Ga0070680_100003696 Ga0070680_1000036965 214
162 3300005336 Ga0070680_100067788 Ga0070680_1000677882 214
163 3300005336 Ga0070680_100277938 Ga0070680_1002779381 214
164 3300005337 Ga0070682_100080613 Ga0070682_1000806132 214
165 3300005338 Ga0068868_100390657 Ga0068868_1003906571 214
166 3300005339 Ga0070660_100035330 Ga0070660_1000353304 214
167 3300005340 Ga0070689_100765956 Ga0070689_1007659561 214
168 3300005341 Ga0070691_10004289 Ga0070691_100042896 214
169 3300005344 Ga0070661_100034522 Ga0070661_1000345225 214
170 3300005353 Ga0070669_100131906 Ga0070669_1001319062 214
171 3300005354 Ga0070675_100046170 Ga0070675_1000461702 214
172 3300005355 Ga0070671_100202723 Ga0070671_1002027232 214
173 3300005356 Ga0070674_100288097 Ga0070674_1002880971 214
174 3300005364 Ga0070673_100144172 Ga0070673_1001441722 214
175 3300005365 Ga0070688_100532674 Ga0070688_1005326741 214
176 3300005366 Ga0070659_100021466 Ga0070659_1000214663 214
177 3300005367 Ga0070667_100076545 Ga0070667_1000765454 214
178 3300005367 Ga0070667_100128619 Ga0070667_1001286192 214
179 3300005434 Ga0070709_10029758 Ga0070709_100297582 214
180 3300005436 Ga0070713_100028460 Ga0070713_1000284603 214
181 3300005436 Ga0070713_100369270 Ga0070713_1003692702 214
182 3300005439 Ga0070711_100319627 Ga0070711_1003196272 214
183 3300005439 Ga0070711_100430166 Ga0070711_1004301662 214
184 3300005441 Ga0070700_100488353 Ga0070700_1004883531 214
185 3300005444 Ga0070694_100495454 Ga0070694_1004954541 214
186 3300005458 Ga0070681_10001506 Ga0070681_1000150612 214
187 3300005458 Ga0070681_10010687 Ga0070681_100106873 214
188 3300005458 Ga0070681_10104818 Ga0070681_101048182 214
189 3300005458 Ga0070681_10195653 Ga0070681_101956532 214
190 3300005458 Ga0070681_11071672 Ga0070681_110716721 214
191 3300005459 Ga0068867_100827992 Ga0068867_1008279921 214
192 3300005530 Ga0070679_100007294 Ga0070679_10000729410 214
193 3300005530 Ga0070679_100016917 Ga0070679_1000169173 214
194 3300005530 Ga0070679_100076140 Ga0070679_1000761403 214
195 3300005535 Ga0070684_100002498 Ga0070684_1000024989 214
196 3300005535 Ga0070684_100007045 Ga0070684_1000070451 214
197 3300005535 Ga0070684_100056735 Ga0070684_1000567353 214
198 3300005535 Ga0070684_100119564 Ga0070684_1001195642 214
199 3300005536 Ga0070697_100001968 Ga0070697_1000019683 214
200 3300005539 Ga0068853_100056726 Ga0068853_1000567264 214
201 3300005539 Ga0068853_100114412 Ga0068853_1001144122 214
202 3300005545 Ga0070695_100168657 Ga0070695_1001686573 214
203 3300005545 Ga0070695_100172867 Ga0070695_1001728672 214
204 3300005546 Ga0070696_100351671 Ga0070696_1003516711 214
205 3300005547 Ga0070693_100013404 Ga0070693_1000134042 214
206 3300005548 Ga0070665_100002296 Ga0070665_1000022968 214
207 3300005548 Ga0070665_100109204 Ga0070665_1001092042 214
208 3300005563 Ga0068855_100002276 Ga0068855_10000227620 214
209 3300005563 Ga0068855_100023639 Ga0068855_1000236393 214
210 3300005563 Ga0068855_100029565 Ga0068855_1000295657 214
211 3300005563 Ga0068855_100223618 Ga0068855_1002236182 214
212 3300005564 Ga0070664_100943194 Ga0070664_1009431941 214
213 3300005577 Ga0068857_100000716 Ga0068857_10000071622 214
214 3300005577 Ga0068857_100007977 Ga0068857_10000797710 214
215 3300005577 Ga0068857_100275686 Ga0068857_1002756862 214
216 3300005578 Ga0068854_100206509 Ga0068854_1002065092 214
217 3300005578 Ga0068854_100227187 Ga0068854_1002271872 214
218 3300005614 Ga0068856_100000584 Ga0068856_10000058415 214
219 3300005614 Ga0068856_100043815 Ga0068856_1000438155 214
220 3300005614 Ga0068856_100084692 Ga0068856_1000846924 214
221 3300005614 Ga0068856_100227285 Ga0068856_1002272852 214
222 3300005614 Ga0068856_100510144 Ga0068856_1005101442 214
223 3300005616 Ga0068852_100006091 Ga0068852_10000609110 214
224 3300005616 Ga0068852_100051595 Ga0068852_1000515953 214
225 3300005616 Ga0068852_100388270 Ga0068852_1003882702 214
226 3300005618 Ga0068864_100351442 Ga0068864_1003514422 214
227 3300005718 Ga0068866_10046767 Ga0068866_100467673 214
228 3300005718 Ga0068866_10273778 Ga0068866_102737782 214
229 3300005719 Ga0068861_100070646 Ga0068861_1000706463 214
230 3300005841 Ga0068863_100015005 Ga0068863_10001500510 214
231 3300005841 Ga0068863_100225095 Ga0068863_1002250952 214
232 3300005841 Ga0068863_100500124 Ga0068863_1005001243 214
233 3300005842 Ga0068858_100008753 Ga0068858_1000087532 214
234 3300005842 Ga0068858_100050136 Ga0068858_1000501363 214
235 3300005842 Ga0068858_100059432 Ga0068858_1000594324 214
236 3300005842 Ga0068858_100152337 Ga0068858_1001523371 214
237 3300005842 Ga0068858_100193074 Ga0068858_1001930742 214
238 3300005842 Ga0068858_100722015 Ga0068858_1007220152 214
239 3300005843 Ga0068860_100985489 Ga0068860_1009854891 214
240 3300005844 Ga0068862_100015848 Ga0068862_1000158483 214
241 3300005844 Ga0068862_100137563 Ga0068862_1001375632 214
242 3300006042 Ga0075368_10027029 Ga0075368_100270292 214
243 3300006051 Ga0075364_10001655 Ga0075364_1000165513 214
244 3300006163 Ga0070715_10028218 Ga0070715_100282182 214
245 3300006163 Ga0070715_10139930 Ga0070715_101399302 214
246 3300006173 Ga0070716_100000492 Ga0070716_10000049212 214
247 3300006173 Ga0070716_100017030 Ga0070716_1000170303 214
248 3300006175 Ga0070712_100024963 Ga0070712_1000249635 214
249 3300006175 Ga0070712_100047342 Ga0070712_1000473425 214
250 3300006175 Ga0070712_100048193 Ga0070712_1000481933 214
251 3300006178 Ga0075367_10003446 Ga0075367_100034468 214
252 3300006237 Ga0097621_100002374 Ga0097621_1000023746 214
253 3300006237 Ga0097621_100116456 Ga0097621_1001164563 214
254 3300006237 Ga0097621_100201538 Ga0097621_1002015382 214
255 3300006353 Ga0075370_10000403 Ga0075370_100004032 214
256 3300006358 Ga0068871_100317720 Ga0068871_1003177202 214
257 3300006358 Ga0068871_100405234 Ga0068871_1004052342 214
258 3300006358 Ga0068871_100522318 Ga0068871_1005223181 214
259 3300006844 Ga0075428_100011720 Ga0075428_1000117207 214
260 3300006846 Ga0075430_100292626 Ga0075430_1002926262 214
261 3300006847 Ga0075431_100045681 Ga0075431_1000456812 214
262 3300006852 Ga0075433_10000173 Ga0075433_1000017323 214
263 3300006871 Ga0075434_100055879 Ga0075434_1000558793 214
264 3300006871 Ga0075434_100514936 Ga0075434_1005149362 214
265 3300006871 Ga0075434_100726014 Ga0075434_1007260142 214
266 3300006880 Ga0075429_100040499 Ga0075429_1000404994 214
267 3300006881 Ga0068865_100088713 Ga0068865_1000887133 214
268 3300007265 Ga0099794_10248010 Ga0099794_102480102 214
269 3300009011 Ga0105251_10033177 Ga0105251_100331773 214
270 3300009036 Ga0105244_10029566 Ga0105244_100295663 214
271 3300009036 Ga0105244_10060400 Ga0105244_100604002 214
272 3300009036 Ga0105244_10175224 Ga0105244_101752242 214
273 3300009092 Ga0105250_10000710 Ga0105250_100007103 214
274 3300009092 Ga0105250_10004303 Ga0105250_100043033 214
275 3300009092 Ga0105250_10007605 Ga0105250_100076053 214
276 3300009092 Ga0105250_10044738 Ga0105250_100447381 214
277 3300009092 Ga0105250_10164818 Ga0105250_101648181 214
278 3300009093 Ga0105240_10008022 Ga0105240_100080227 214
279 3300009093 Ga0105240_10008522 Ga0105240_100085224 214
280 3300009093 Ga0105240_10018690 Ga0105240_100186906 214
281 3300009093 Ga0105240_10071151 Ga0105240_100711515 214
282 3300009093 Ga0105240_10097720 Ga0105240_100977202 214
283 3300009093 Ga0105240_10159088 Ga0105240_101590882 214
284 3300009093 Ga0105240_10167387 Ga0105240_101673872 214
285 3300009093 Ga0105240_11386896 Ga0105240_113868961 214
286 3300009094 Ga0111539_10004974 Ga0111539_1000497410 214
287 3300009094 Ga0111539_10023605 Ga0111539_100236053 214
288 3300009098 Ga0105245_10005954 Ga0105245_100059544 214
289 3300009098 Ga0105245_10013777 Ga0105245_100137773 214
290 3300009098 Ga0105245_10071261 Ga0105245_100712612 214
291 3300009098 Ga0105245_10219974 Ga0105245_102199742 214
292 3300009101 Ga0105247_10420735 Ga0105247_104207351 214
293 3300009147 Ga0114129_10003757 Ga0114129_1000375714 214
294 3300009147 Ga0114129_10017346 Ga0114129_100173465 214
295 3300009147 Ga0114129_10047535 Ga0114129_100475354 214
296 3300009148 Ga0105243_10002974 Ga0105243_100029749 214
297 3300009148 Ga0105243_10382311 Ga0105243_103823112 214
298 3300009174 Ga0105241_10022091 Ga0105241_100220916 214
299 3300009174 Ga0105241_10037389 Ga0105241_100373894 214
300 3300009174 Ga0105241_10043990 Ga0105241_100439903 214
301 3300009174 Ga0105241_10294231 Ga0105241_102942312 214
302 3300009176 Ga0105242_10002299 Ga0105242_100022998 214
303 3300009176 Ga0105242_10023253 Ga0105242_100232533 214
304 3300009176 Ga0105242_10067385 Ga0105242_100673852 214
305 3300009176 Ga0105242_11300227 Ga0105242_113002271 214
306 3300009177 Ga0105248_10006547 Ga0105248_1000654711 214
307 3300009177 Ga0105248_10026324 Ga0105248_100263244 214
308 3300009177 Ga0105248_10080063 Ga0105248_100800635 214
309 3300009177 Ga0105248_10205546 Ga0105248_102055463 214
310 3300009177 Ga0105248_10300709 Ga0105248_103007092 214
311 3300009545 Ga0105237_10010352 Ga0105237_100103522 214
312 3300009545 Ga0105237_10074953 Ga0105237_100749532 214
313 3300009545 Ga0105237_10172548 Ga0105237_101725482 214
314 3300009545 Ga0105237_10236500 Ga0105237_102365002 214
315 3300009545 Ga0105237_10831996 Ga0105237_108319961 214
316 3300009551 Ga0105238_10000959 Ga0105238_100009592 214
317 3300009551 Ga0105238_10048977 Ga0105238_100489772 214
318 3300009551 Ga0105238_10088840 Ga0105238_100888402 214
319 3300009551 Ga0105238_10092899 Ga0105238_100928992 214
320 3300009551 Ga0105238_10206995 Ga0105238_102069951 214
321 3300009551 Ga0105238_10284513 Ga0105238_102845131 214
322 3300009551 Ga0105238_10626012 Ga0105238_106260122 214
323 3300009553 Ga0105249_10038241 Ga0105249_100382412 214
324 3300009553 Ga0105249_10075349 Ga0105249_100753492 214
325 3300009553 Ga0105249_10106935 Ga0105249_101069354 214
326 3300010375 Ga0105239_10003659 Ga0105239_1000365910 214
327 3300010375 Ga0105239_10006626 Ga0105239_100066267 214
328 3300010375 Ga0105239_10215460 Ga0105239_102154601 214
329 3300010375 Ga0105239_10754315 Ga0105239_107543152 214
330 3300011119 Ga0105246_10003746 Ga0105246_100037465 214
331 3300011119 Ga0105246_10028473 Ga0105246_100284735 214
332 3300011119 Ga0105246_10114094 Ga0105246_101140942 214
333 3300013104 Ga0157370_10013077 Ga0157370_100130779 214
334 3300013104 Ga0157370_10024501 Ga0157370_100245012 214
335 3300013104 Ga0157370_10097743 Ga0157370_100977432 214
336 3300013105 Ga0157369_10001499 Ga0157369_100014992 214
337 3300013105 Ga0157369_10001507 Ga0157369_1000150722 214
338 3300013105 Ga0157369_10018212 Ga0157369_100182122 214
339 3300013105 Ga0157369_10252479 Ga0157369_102524791 214
340 3300013105 Ga0157369_10272458 Ga0157369_102724582 214
341 3300013105 Ga0157369_10572370 Ga0157369_105723701 214
342 3300013105 Ga0157369_10578404 Ga0157369_105784041 214
343 3300013296 Ga0157374_10005352 Ga0157374_100053524 214
344 3300013296 Ga0157374_10014588 Ga0157374_100145885 214
345 3300013296 Ga0157374_10017559 Ga0157374_100175596 214
346 3300013296 Ga0157374_10073087 Ga0157374_100730872 214
347 3300013296 Ga0157374_10848251 Ga0157374_108482512 214
348 3300013306 Ga0163162_10002954 Ga0163162_100029542 214
349 3300013306 Ga0163162_10623743 Ga0163162_106237432 214
350 3300013306 Ga0163162_11180641 Ga0163162_111806412 214
351 3300013307 Ga0157372_10087374 Ga0157372_100873742 214
352 3300013307 Ga0157372_10171146 Ga0157372_101711463 214
353 3300013308 Ga0157375_10002682 Ga0157375_100026828 214
354 3300014325 Ga0163163_10034926 Ga0163163_100349263 214
355 3300014325 Ga0163163_10425915 Ga0163163_104259151 214
356 3300014325 Ga0163163_10451957 Ga0163163_104519572 214
357 3300014325 Ga0163163_10651804 Ga0163163_106518041 214
358 3300014326 Ga0157380_10034195 Ga0157380_100341953 214
359 3300014326 Ga0157380_10127585 Ga0157380_101275852 214
360 3300014968 Ga0157379_10040329 Ga0157379_100403294 214
361 3300014968 Ga0157379_10172217 Ga0157379_101722172 214
362 3300014969 Ga0157376_10128559 Ga0157376_101285592 214
363 3300014969 Ga0157376_10206628 Ga0157376_102066282 214
364 3300017792 Ga0163161_10501316 Ga0163161_105013162 214
365 3300020070 Ga0206356_10960057 Ga0206356_109600571 214
366 3300020076 Ga0206355_1406151 Ga0206355_14061513 214
367 3300020078 Ga0206352_10796245 Ga0206352_107962452 214
368 3300020080 Ga0206350_10164359 Ga0206350_101643591 214
369 3300020081 Ga0206354_10243924 Ga0206354_102439241 214
370 3300022467 Ga0224712_10010938 Ga0224712_100109382 214
371 3300022467 Ga0224712_10014748 Ga0224712_100147481 214
372 3300025225 Ga0209566_100054 Ga0209566_100054137 214
373 3300025229 Ga0209147_100147 Ga0209147_10014726 214
374 3300025229 Ga0209147_101339 Ga0209147_1013393 214
375 3300025261 Ga0209233_1003995 Ga0209233_10039952 214
376 3300025273 Ga0209673_1008114 Ga0209673_10081143 214
377 3300025284 Ga0209130_1002308 Ga0209130_10023083 214
378 3300025284 Ga0209130_1024027 Ga0209130_10240272 214
379 3300025291 Ga0209675_1048704 Ga0209675_10487042 214
380 3300025292 Ga0209676_1000671 Ga0209676_100067114 214
381 3300025294 Ga0209025_1001474 Ga0209025_10014743 214
382 3300025294 Ga0209025_1001829 Ga0209025_100182923 214
383 3300025294 Ga0209025_1005920 Ga0209025_10059209 214
384 3300025294 Ga0209025_1011722 Ga0209025_10117223 214
385 3300025294 Ga0209025_1016024 Ga0209025_10160243 214
386 3300025294 Ga0209025_1050244 Ga0209025_10502442 214
387 3300025711 Ga0207696_1000943 Ga0207696_10009436 214
388 3300025711 Ga0207696_1001826 Ga0207696_10018265 214
389 3300025711 Ga0207696_1002435 Ga0207696_10024353 214
390 3300025711 Ga0207696_1021931 Ga0207696_10219312 214
391 3300025728 Ga0207655_1003259 Ga0207655_10032597 214
392 3300025728 Ga0207655_1006507 Ga0207655_10065076 214
393 3300025735 Ga0207713_1000974 Ga0207713_100097416 214
394 3300025735 Ga0207713_1036567 Ga0207713_10365672 214
395 3300025899 Ga0207642_10020980 Ga0207642_100209804 214
396 3300025899 Ga0207642_10110248 Ga0207642_101102482 214
397 3300025900 Ga0207710_10248944 Ga0207710_102489441 214
398 3300025905 Ga0207685_10099717 Ga0207685_100997171 214
399 3300025905 Ga0207685_10195231 Ga0207685_101952312 214
400 3300025906 Ga0207699_10011912 Ga0207699_100119123 214
401 3300025906 Ga0207699_10014021 Ga0207699_100140213 214
402 3300025906 Ga0207699_10186218 Ga0207699_101862181 214
403 3300025909 Ga0207705_10153379 Ga0207705_101533792 214
404 3300025911 Ga0207654_10009007 Ga0207654_100090072 214
405 3300025911 Ga0207654_10026740 Ga0207654_100267403 214
406 3300025911 Ga0207654_10030605 Ga0207654_100306053 214
407 3300025911 Ga0207654_10048711 Ga0207654_100487112 214
408 3300025911 Ga0207654_10411921 Ga0207654_104119211 214
409 3300025912 Ga0207707_10000224 Ga0207707_1000022424 214
410 3300025912 Ga0207707_10003625 Ga0207707_1000362510 214
411 3300025912 Ga0207707_10126777 Ga0207707_101267772 214
412 3300025912 Ga0207707_10401577 Ga0207707_104015771 214
413 3300025913 Ga0207695_10000533 Ga0207695_1000053340 214
414 3300025913 Ga0207695_10013787 Ga0207695_100137874 214
415 3300025913 Ga0207695_10052088 Ga0207695_100520882 214
416 3300025913 Ga0207695_10110840 Ga0207695_101108402 214
417 3300025913 Ga0207695_10172671 Ga0207695_101726712 214
418 3300025913 Ga0207695_10181126 Ga0207695_101811262 214
419 3300025914 Ga0207671_10042259 Ga0207671_100422592 214
420 3300025914 Ga0207671_10060807 Ga0207671_100608072 214
421 3300025915 Ga0207693_10000187 Ga0207693_1000018723 214
422 3300025915 Ga0207693_10012450 Ga0207693_100124504 214
423 3300025915 Ga0207693_10020483 Ga0207693_100204834 214
424 3300025916 Ga0207663_10039723 Ga0207663_100397232 214
425 3300025916 Ga0207663_10180119 Ga0207663_101801192 214
426 3300025917 Ga0207660_10015178 Ga0207660_100151783 214
427 3300025917 Ga0207660_10280497 Ga0207660_102804972 214
428 3300025919 Ga0207657_10047663 Ga0207657_100476634 214
429 3300025919 Ga0207657_10540860 Ga0207657_105408601 214
430 3300025920 Ga0207649_10428252 Ga0207649_104282521 214
431 3300025921 Ga0207652_10005967 Ga0207652_100059672 214
432 3300025921 Ga0207652_10009933 Ga0207652_100099333 214
433 3300025924 Ga0207694_10000545 Ga0207694_1000054528 214
434 3300025924 Ga0207694_10006193 Ga0207694_100061932 214
435 3300025924 Ga0207694_10018377 Ga0207694_100183773 214
436 3300025924 Ga0207694_10024007 Ga0207694_100240075 214
437 3300025924 Ga0207694_10053086 Ga0207694_100530862 214
438 3300025926 Ga0207659_10069659 Ga0207659_100696593 214
439 3300025927 Ga0207687_10004677 Ga0207687_100046772 214
440 3300025927 Ga0207687_10096701 Ga0207687_100967013 214
441 3300025927 Ga0207687_10114119 Ga0207687_101141193 214
442 3300025927 Ga0207687_10147137 Ga0207687_101471372 214
443 3300025928 Ga0207700_10421456 Ga0207700_104214562 214
444 3300025929 Ga0207664_10696174 Ga0207664_106961741 214
445 3300025931 Ga0207644_10045343 Ga0207644_100453431 214
446 3300025933 Ga0207706_10092503 Ga0207706_100925032 214
447 3300025934 Ga0207686_10006947 Ga0207686_100069473 214
448 3300025934 Ga0207686_10020281 Ga0207686_100202813 214
449 3300025934 Ga0207686_10057549 Ga0207686_100575494 214
450 3300025934 Ga0207686_10533698 Ga0207686_105336982 214
451 3300025935 Ga0207709_10004912 Ga0207709_100049125 214
452 3300025935 Ga0207709_10109909 Ga0207709_101099092 214
453 3300025936 Ga0207670_10356275 Ga0207670_103562752 214
454 3300025937 Ga0207669_10288569 Ga0207669_102885692 214
455 3300025939 Ga0207665_10001360 Ga0207665_100013607 214
456 3300025941 Ga0207711_10001263 Ga0207711_1000126310 214
457 3300025941 Ga0207711_10018860 Ga0207711_100188605 214
458 3300025941 Ga0207711_10063146 Ga0207711_100631462 214
459 3300025941 Ga0207711_10162091 Ga0207711_101620912 214
460 3300025942 Ga0207689_10145563 Ga0207689_101455632 214
461 3300025942 Ga0207689_10179387 Ga0207689_101793872 214
462 3300025942 Ga0207689_10303167 Ga0207689_103031672 214
463 3300025942 Ga0207689_10618072 Ga0207689_106180721 214
464 3300025944 Ga0207661_10012672 Ga0207661_100126727 214
465 3300025944 Ga0207661_10026842 Ga0207661_100268423 214
466 3300025944 Ga0207661_10101200 Ga0207661_101012002 214
467 3300025944 Ga0207661_10128582 Ga0207661_101285822 214
468 3300025944 Ga0207661_10195276 Ga0207661_101952761 214
469 3300025944 Ga0207661_10744324 Ga0207661_107443242 214
470 3300025945 Ga0207679_10617753 Ga0207679_106177532 214
471 3300025949 Ga0207667_10000322 Ga0207667_1000032237 214
472 3300025949 Ga0207667_10030375 Ga0207667_100303758 214
473 3300025949 Ga0207667_10176447 Ga0207667_101764472 214
474 3300025949 Ga0207667_10666148 Ga0207667_106661481 214
475 3300025960 Ga0207651_10054764 Ga0207651_100547642 214
476 3300025960 Ga0207651_10410067 Ga0207651_104100671 214
477 3300025961 Ga0207712_10060408 Ga0207712_100604082 214
478 3300025961 Ga0207712_10500148 Ga0207712_105001482 214
479 3300025981 Ga0207640_10262427 Ga0207640_102624272 214
480 3300025986 Ga0207658_10234417 Ga0207658_102344172 214
481 3300026023 Ga0207677_10456619 Ga0207677_104566192 214
482 3300026035 Ga0207703_10023134 Ga0207703_100231342 214
483 3300026035 Ga0207703_10046850 Ga0207703_100468505 214
484 3300026035 Ga0207703_10055839 Ga0207703_100558392 214
485 3300026035 Ga0207703_10077462 Ga0207703_100774623 214
486 3300026035 Ga0207703_10116212 Ga0207703_101162121 214
487 3300026041 Ga0207639_10055457 Ga0207639_100554573 214
488 3300026041 Ga0207639_10061393 Ga0207639_100613932 214
489 3300026041 Ga0207639_10644942 Ga0207639_106449421 214
490 3300026078 Ga0207702_10001895 Ga0207702_100018957 214
491 3300026078 Ga0207702_10061034 Ga0207702_100610342 214
492 3300026078 Ga0207702_10355599 Ga0207702_103555992 214
493 3300026088 Ga0207641_10144934 Ga0207641_101449343 214
494 3300026088 Ga0207641_10295845 Ga0207641_102958452 214
495 3300026089 Ga0207648_10016334 Ga0207648_100163346 214
496 3300026095 Ga0207676_10211464 Ga0207676_102114642 214
497 3300026095 Ga0207676_10341431 Ga0207676_103414312 214
498 3300026116 Ga0207674_10000350 Ga0207674_1000035025 214
499 3300026116 Ga0207674_10008397 Ga0207674_1000839712 214
500 3300026116 Ga0207674_10215474 Ga0207674_102154743 214
501 3300026118 Ga0207675_100041628 Ga0207675_1000416283 214
502 3300026118 Ga0207675_100766752 Ga0207675_1007667522 214
503 3300026142 Ga0207698_10002809 Ga0207698_100028097 214
504 3300026142 Ga0207698_10135643 Ga0207698_101356432 214
505 3300027907 Ga0207428_10011746 Ga0207428_100117463 214
506 3300027907 Ga0207428_10019602 Ga0207428_100196025 214
507 3300028379 Ga0268266_10002662 Ga0268266_100026625 214
508 3300028379 Ga0268266_10627155 Ga0268266_106271552 214
509 3300028380 Ga0268265_10031658 Ga0268265_100316582 214
510 3300028380 Ga0268265_10110565 Ga0268265_101105652 214
511 3300028381 Ga0268264_10461161 Ga0268264_104611612 214
512 3300028800 Ga0265338_10066134 Ga0265338_100661342 214
513 3300030083 Ga0237817_10064 Ga0237817_1006418 214
514 3300030500 Ga0268256_1005862 Ga0268256_10058624 214
515 3300031240 Ga0265320_10012925 Ga0265320_100129254 214
516 3300031251 Ga0265327_10070510 Ga0265327_100705101 214
517 3300031548 Ga0307408_100035921 Ga0307408_1000359213 214
518 3300031595 Ga0265313_10011168 Ga0265313_100111688 214
519 3300031665 Ga0316575_10003764 Ga0316575_100037645 214
520 3300031665 Ga0316575_10024198 Ga0316575_100241983 214
521 3300031711 Ga0265314_10011222 Ga0265314_100112225 214
522 3300031727 Ga0316576_10039421 Ga0316576_100394214 214
523 3300031727 Ga0316576_10100611 Ga0316576_101006112 214
524 3300031728 Ga0316578_10049089 Ga0316578_100490892 214
525 3300031728 Ga0316578_10274690 Ga0316578_102746901 214
526 3300031733 Ga0316577_10004002 Ga0316577_100040026 214
527 3300031733 Ga0316577_10038292 Ga0316577_100382924 214
528 3300031852 Ga0307410_10054611 Ga0307410_100546113 214
529 3300031852 Ga0307410_10355537 Ga0307410_103555372 214
530 3300032002 Ga0307416_100490958 Ga0307416_1004909581 214
531 3300032002 Ga0307416_100493374 Ga0307416_1004933742 214
532 3300032005 Ga0307411_10303630 Ga0307411_103036302 214
533 3300032133 Ga0316583_10000274 Ga0316583_1000027411 214
534 3300032133 Ga0316583_10000560 Ga0316583_100005603 214
535 3300032133 Ga0316583_10033001 Ga0316583_100330011 214
536 3300032133 Ga0316583_10084614 Ga0316583_100846141 214
537 3300032139 Ga0316580_10026637 Ga0316580_100266372 214
538 3300035084 Ga0373928_0002459 Ga0373928_0002459_1688_2353 214
539 3300035086 Ga0373934_0004823 Ga0373934_0004823_3936_4628 214
540 3300035086 Ga0373934_0028363 Ga0373934_0028363_1105_1779 214
541 3300035111 Ga0373923_0039399 Ga0373923_0039399_1140_1832 214
542 3300035112 Ga0373932_0013385 Ga0373932_0013385_283_948 214
543 3300035117 Ga0373953_0017659 Ga0373953_0017659_583_1275 214
544 3300035117 Ga0373953_0168681 Ga0373953_0168681_116_790 214
545 3300035118 Ga0373954_0033937 Ga0373954_0033937_1427_2119 214
546 3300035119 Ga0373956_0075611 Ga0373956_0075611_467_1159 214
547 3300035120 Ga0373957_0055352 Ga0373957_0055352_450_1142 214
548 3300035172 Ga0373955_0172783 Ga0373955_0172783_20_694 214
549 3300035172 Ga0373955_0397501 Ga0373955_0397501_47_739 214
550 3300035398 Ga0316574_0001779 Ga0316574_0001779_2955_3611 214
551 3300035692 Ga0373935_0212804 Ga0373935_0212804_368_1060 214
552 3300035724 Ga0373933_0020180 Ga0373933_0020180_187_879 214
553 3300035724 Ga0373933_0195727 Ga0373933_0195727_225_899 214
554 3300035725 Ga0373947_0074466 Ga0373947_0074466_912_1586 214
555 3300036401 Ga0373937_0028222 Ga0373937_0028222_1744_2418 214
556 3300036401 Ga0373937_0100194 Ga0373937_0100194_1772_2464 214
557 3300036401 Ga0373937_0110421 Ga0373937_0110421_1252_1944 214
558 3300036401 Ga0373937_0116026 Ga0373937_0116026_1079_1795 214
559 3300036401 Ga0373937_0308972 Ga0373937_0308972_259_933 214
560 3300036647 Ga0316582_0026331 Ga0316582_0026331_392_1048 214
561 3300036712 Ga0316584_0031977 Ga0316584_0031977_902_1552 214
562 3300036712 Ga0316584_0155297 Ga0316584_0155297_112_768 214
563 3300036712 Ga0316584_0217793 Ga0316584_0217793_183_839 214
564 3300037068 Ga0373925_0524231 Ga0373925_0524231_173_847 214
565 3300037068 Ga0373925_0650746 Ga0373925_0650746_154_828 214
566 3300037471 Ga0395905_0046662 Ga0395905_0046662_38_796 214
567 3300037588 Ga0316581_0006044 Ga0316581_0006044_2375_3046 214
568 3300038705 Ga0237819_00110 Ga0237819_00110_12107_12751 214
569 3300042876 Ga0451577_0000241 Ga0451577_0000241_15445_16119 214
570 3300042876 Ga0451577_0039495 Ga0451577_0039495_318_983 214
571 3300042876 Ga0451577_0043115 Ga0451577_0043115_3005_3679 214
572 3300042876 Ga0451577_0132601 Ga0451577_0132601_733_1404 214
573 3300042876 Ga0451577_0152727 Ga0451577_0152727_1258_1932 214
574 3300044673 Ga0453683_0010518 Ga0453683_0010518_2881_3567 214
575 3300044673 Ga0453683_0030579 Ga0453683_0030579_95_769 214
576 3300044673 Ga0453683_0196294 Ga0453683_0196294_548_1222 214
577 3300044694 Ga0466963_0572464 Ga0466963_0572464_59_748 214
578 3300044712 Ga0453684_0000366 Ga0453684_0000366_165246_165920 214
579 3300044712 Ga0453684_0013557 Ga0453684_0013557_657_1307 214
580 3300044712 Ga0453684_0272620 Ga0453684_0272620_1109_1795 214
581 3300044712 Ga0453684_0309482 Ga0453684_0309482_985_1656 214
582 3300044712 Ga0453684_0635008 Ga0453684_0635008_282_956 214
583 3300045051 Ga0451576_0000138 Ga0451576_0000138_73497_74162 214
584 3300045051 Ga0451576_0005856 Ga0451576_0005856_8946_9620 214
585 3300045051 Ga0451576_0098529 Ga0451576_0098529_589_1263 214
586 3300045051 Ga0451576_0346470 Ga0451576_0346470_490_1164 214
587 3300045051 Ga0451576_0576249 Ga0451576_0576249_168_842 214
588 3300045976 Ga0466967_0000014 Ga0466967_0000014_37087_37731 214
589 3300045976 Ga0466967_0005146 Ga0466967_0005146_1297_1971 214
590 3300045976 Ga0466967_0113279 Ga0466967_0113279_1341_2015 214
591 3300045976 Ga0466967_0158880 Ga0466967_0158880_288_1070 214
592 3300045976 Ga0466967_0948172 Ga0466967_0948172_119_793 214
593 3300046455 Ga0495603_0095625 Ga0495603_0095625_885_1559 214
594 3300046455 Ga0495603_0245693 Ga0495603_0245693_31_687 214
595 3300046462 Ga0495651_0047803 Ga0495651_0047803_1493_2167 214
596 3300046462 Ga0495651_0077715 Ga0495651_0077715_404_1096 214
597 3300046472 Ga0495580_0127040 Ga0495580_0127040_1065_1739 214
598 3300046473 Ga0495582_0004318 Ga0495582_0004318_2873_3547 214
599 3300046473 Ga0495582_0014794 Ga0495582_0014794_2712_3428 214
600 3300046474 Ga0495605_0077786 Ga0495605_0077786_344_1000 214
601 3300046474 Ga0495605_0080546 Ga0495605_0080546_399_1073 214
602 3300046477 Ga0495664_0076901 Ga0495664_0076901_68_742 214
603 3300046491 Ga0495584_0014741 Ga0495584_0014741_3298_3954 214
604 3300046492 Ga0495585_0036363 Ga0495585_0036363_1513_2169 214
605 3300046499 Ga0495594_0053576 Ga0495594_0053576_1287_1961 214
606 3300046516 Ga0495628_0416205 Ga0495628_0416205_257_931 214
607 3300046529 Ga0495652_0014290 Ga0495652_0014290_2423_3097 214
608 3300046531 Ga0495665_0026826 Ga0495665_0026826_2337_3053 214
609 3300046535 Ga0495586_0044955 Ga0495586_0044955_274_948 214
610 3300046536 Ga0495587_0005456 Ga0495587_0005456_1545_2219 214
611 3300046536 Ga0495587_0109951 Ga0495587_0109951_358_1032 214
612 3300046536 Ga0495587_0157970 Ga0495587_0157970_342_1034 214
613 3300046539 Ga0495621_0111627 Ga0495621_0111627_288_974 214
614 3300046543 Ga0495645_0009695 Ga0495645_0009695_3734_4408 214
615 3300046559 Ga0495667_0035399 Ga0495667_0035399_1536_2210 214
616 3300046615 Ga0495656_0052955 Ga0495656_0052955_509_1189 214
617 3300046674 Ga0495588_0117258 Ga0495588_0117258_564_1280 214
618 3300046678 Ga0495599_0000343 Ga0495599_0000343_25081_25755 214
619 3300046679 Ga0495623_0066892 Ga0495623_0066892_375_1049 214
620 3300046679 Ga0495623_0074015 Ga0495623_0074015_420_1094 214
621 3300046684 Ga0495669_0009653 Ga0495669_0009653_730_1404 214
622 3300046684 Ga0495669_0029100 Ga0495669_0029100_1143_1823 214
623 3300046684 Ga0495669_0061916 Ga0495669_0061916_932_1612 214
624 3300046684 Ga0495669_0107071 Ga0495669_0107071_431_1105 214
625 3300046689 Ga0495613_0134083 Ga0495613_0134083_355_1047 214
626 3300046689 Ga0495613_0420195 Ga0495613_0420195_52_726 214
627 3300046794 Ga0495589_0171192 Ga0495589_0171192_73_729 214
628 3300046809 Ga0495600_0176426 Ga0495600_0176426_406_1080 214
629 3300046809 Ga0495600_0265862 Ga0495600_0265862_85_777 214
630 3300047317 Ga0495604_0066714 Ga0495604_0066714_1309_1983 214
631 3300047321 Ga0495676_0058211 Ga0495676_0058211_2170_2826 214
632 3300047323 Ga0495683_0180603 Ga0495683_0180603_53_709 214
633 3300047444 Ga0495675_0012462 Ga0495675_0012462_1428_2102 214
634 3300047444 Ga0495675_0025880 Ga0495675_0025880_805_1479 214
635 3300047444 Ga0495675_0297709 Ga0495675_0297709_39_713 214
636 3300047445 Ga0495677_0021330 Ga0495677_0021330_800_1474 214
637 3300047447 Ga0495685_124043 Ga0495685_124043_151_825 214
638 3300047471 Ga0495684_0002760 Ga0495684_0002760_10615_11307 214
639 3300048088 Ga0495602_0211814 Ga0495602_0211814_227_919 214
640 3300048903 Ga0496100_0000498 Ga0496100_0000498_15998_16654 214
641 3300048904 Ga0496101_0000571 Ga0496101_0000571_6025_6681 214
642 3300048905 Ga0496102_0002229 Ga0496102_0002229_2887_3543 214
643 3300048905 Ga0496102_0543397 Ga0496102_0543397_97_771 214
644 3300048906 Ga0496103_0000697 Ga0496103_0000697_21294_21950 214
645 3300048907 Ga0496104_0030123 Ga0496104_0030123_2491_3147 214
646 3300048907 Ga0496104_0353665 Ga0496104_0353665_341_1015 214
647 3300048908 Ga0496105_0001675 Ga0496105_0001675_9333_9989 214
648 3300048909 Ga0496106_0000192 Ga0496106_0000192_39628_40284 214
649 3300048910 Ga0496107_0000406 Ga0496107_0000406_1346_2002 214
650 3300048911 Ga0496108_0000290 Ga0496108_0000290_5490_6146 214
651 3300048912 Ga0496109_0001566 Ga0496109_0001566_784_1440 214
652 3300048913 Ga0496110_0000108 Ga0496110_0000108_19688_20338 214
653 3300048913 Ga0496110_0001866 Ga0496110_0001866_2887_3543 214
654 3300048913 Ga0496110_0257991 Ga0496110_0257991_346_990 214
655 3300048914 Ga0496111_0000587 Ga0496111_0000587_15998_16654 214
656 3300048915 Ga0496112_0001734 Ga0496112_0001734_2887_3543 214
657 3300048915 Ga0496112_0255072 Ga0496112_0255072_214_888 214
658 3300048916 Ga0496113_0065573 Ga0496113_0065573_1204_1878 214
659 3300048918 Ga0496115_0082454 Ga0496115_0082454_875_1555 214
660 3300048918 Ga0496115_0136994 Ga0496115_0136994_664_1347 214
661 3300048919 Ga0496116_0002109 Ga0496116_0002109_14130_14798 214
662 3300048919 Ga0496116_0006026 Ga0496116_0006026_4474_5130 214
663 3300048919 Ga0496116_0057934 Ga0496116_0057934_1719_2402 214
664 3300048920 Ga0496117_0065254 Ga0496117_0065254_1747_2415 214
665 3300048920 Ga0496117_0081889 Ga0496117_0081889_638_1294 214
666 3300048920 Ga0496117_0238440 Ga0496117_0238440_31_717 214
667 3300048922 Ga0496119_0000166 Ga0496119_0000166_27552_28220 214
668 3300048922 Ga0496119_0002606 Ga0496119_0002606_2857_3513 214
669 3300048923 Ga0496120_0000406 Ga0496120_0000406_65082_65750 214
670 3300048923 Ga0496120_0169544 Ga0496120_0169544_240_896 214
671 3300048925 Ga0496122_0008068 Ga0496122_0008068_9446_10102 214
672 3300048925 Ga0496122_0029071 Ga0496122_0029071_3954_4622 214
673 3300048925 Ga0496122_0073114 Ga0496122_0073114_1464_2132 214
674 3300048925 Ga0496122_0142246 Ga0496122_0142246_391_1074 214
675 3300048926 Ga0496123_0200478 Ga0496123_0200478_139_807 214
676 3300048927 Ga0496124_0000748 Ga0496124_0000748_29340_30008 214
677 3300048927 Ga0496124_0200152 Ga0496124_0200152_396_1052 214
678 3300048928 Ga0496125_0018356 Ga0496125_0018356_3741_4397 214
679 3300048929 Ga0496126_0000005 Ga0496126_0000005_783121_783807 214
680 3300048929 Ga0496126_0002339 Ga0496126_0002339_86_742 214
681 3300048929 Ga0496126_0020601 Ga0496126_0020601_971_1639 214
682 3300048929 Ga0496126_0024562 Ga0496126_0024562_4826_5494 214
683 3300049574 Ga0501038_0404691 Ga0501038_0404691_176_847 214
684 3300049577 Ga0501041_0054308 Ga0501041_0054308_713_1384 214
685 3300049578 Ga0501042_0023694 Ga0501042_0023694_1515_2186 214
686 3300049582 Ga0501048_0195348 Ga0501048_0195348_46_717 214
687 3300049583 Ga0501067_0060736 Ga0501067_0060736_547_1221 214
688 3300049589 Ga0501073_0004269 Ga0501073_0004269_6645_7319 214
689 3300049589 Ga0501073_0036396 Ga0501073_0036396_1222_1974 214
690 3300049589 Ga0501073_0067110 Ga0501073_0067110_278_949 214
691 3300049590 Ga0501074_0059424 Ga0501074_0059424_739_1440 214
692 3300049591 Ga0501075_0033309 Ga0501075_0033309_2732_3403 214
693 3300049591 Ga0501075_0629376 Ga0501075_0629376_19_720 214
694 3300049592 Ga0501076_0064479 Ga0501076_0064479_51_722 214
695 3300049592 Ga0501076_0167765 Ga0501076_0167765_309_1010 214
696 3300049592 Ga0501076_0337170 Ga0501076_0337170_204_860 214
697 3300049742 Ga0501080_0111404 Ga0501080_0111404_457_1128 214
698 3300049742 Ga0501080_0265592 Ga0501080_0265592_42_743 214
699 3300049743 Ga0501081_0142666 Ga0501081_0142666_131_802 214
700 3300049824 Ga0501045_0012697 Ga0501045_0012697_3299_3970 214
701 3300050491 nmdc:mga00v17_49926_c1 nmdc:mga00v17_49926_c1_376_1056 214
702 3300050507 nmdc:mga05p37_24128_c1 nmdc:mga05p37_24128_c1_2937_3611 214
703 3300050507 nmdc:mga05p37_253602_c1 nmdc:mga05p37_253602_c1_1269_1943 214
704 3300050510 nmdc:mga06r32_117824_c1 nmdc:mga06r32_117824_c1_914_1597 214
705 3300050511 nmdc:mga08y16_173730_c1 nmdc:mga08y16_173730_c1_101_784 214
706 3300050511 nmdc:mga08y16_18169_c1 nmdc:mga08y16_18169_c1_4954_5637 214
707 3300050511 nmdc:mga08y16_8741_c1 nmdc:mga08y16_8741_c1_3147_3833 214
708 3300050512 nmdc:mga0n895_187168_c1 nmdc:mga0n895_187168_c1_42_722 214
709 3300050513 nmdc:mga0rr50_293762_c1 nmdc:mga0rr50_293762_c1_102_776 214
710 3300050515 nmdc:mga0a205_328794_c1 nmdc:mga0a205_328794_c1_286_966 214
711 3300050515 nmdc:mga0a205_470_c1 nmdc:mga0a205_470_c1_14680_15354 214
712 3300054114 Ga0501084_0075701 Ga0501084_0075701_549_1223 214
713 3300054114 Ga0501084_0083136 Ga0501084_0083136_632_1333 214
714 3300059492 Ga0587073_0006030 Ga0587073_0006030_885_1559 214
715 3300059512 Ga0587092_022268 Ga0587092_022268_260_934 214
716 3300060353 Ga0501082_0059687 Ga0501082_0059687_2522_3223 214
717 3300060353 Ga0501082_0090722 Ga0501082_0090722_686_1357 214
718 3300060353 Ga0501082_0098401 Ga0501082_0098401_1249_1905 214
719 3300060353 Ga0501082_0211932 Ga0501082_0211932_24_776 214
720 iso_pu_bacteria 2831905167 2831906955 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

39

236

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9787 2 213
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9782 2 214
1tqj-assembly1.cif.gz_F crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9767 2 213
1tqj-assembly1.cif.gz_D crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9763 2 214
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9762 2 213
ID Description Score Start End Superfamily
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9763 2 214 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9731 1 213 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9709 1 213 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9691 1 213 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9642 1 213 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2T5V3H4-F1-model_v4 deleted 0.9894 1 214
AF-A0A7C7ZVP7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.984 1 213 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1G8AT52-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9838 1 213 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1G6NA90-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9838 1 213 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A0K0G810-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9836 1 212 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.72 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map