F477322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 720 | 365 | 684 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0158880|Ga0466967_0158880_288_1070 |
| Length | 260 |
| Sequence | LRFGGHKPFAFAGFSAWAALASVLEFFSGHTQGQLSLIELAPSILSADFAHLAAAVQAVAEGGATVLHVDVMDGHFVPNITIGPPVVASLRKVTNLPLDVHLMIENPDQFIPAFVEAGADWISVHQEACVHLHRTLELIQNHGADAGVVINPATPVSMLEEVLDMVHHVLVMSVNPGFGGQKFIPFTLDKLRKLVMMRAERRANFRIEIDGGISTETVTEVVRAGAEILVAGNAVFGHGRPRENVQQLLKLAGEATLQKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 2 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 3 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 4 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 5 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 6 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 7 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 8 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 9 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 10 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 11 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 12 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 13 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 14 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 15 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 16 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 17 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 18 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 19 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 20 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 21 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 22 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 23 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 24 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 25 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 26 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 27 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 28 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 29 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 30 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 134 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 203 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 209 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 221 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 241 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 306 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 357 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 358 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 359 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 360 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 361 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 362 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 363 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 364 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 365 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.33 |
| Metatranscriptomes | 1.67 |
| Isolates | 5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.75 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 86.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1003344 | 3300002987 | Bacteria | 5720 |
| 2 | JGI25159J45721_1009643 | 3300002987 | Bacteria | 2530 |
| 3 | JGI25151J46595_10007057 | 3300003187 | Bacteria | 5548 |
| 4 | JGI25151J46595_10011988 | 3300003187 | Bacteria | 3958 |
| 5 | rootH1_10001147 | 3300003316 | Bacteria | 54261 |
| 6 | rootL2_10074625 | 3300003322 | Bacteria | 23985 |
| 7 | Ga0006562J51391_1001252 | 3300003578 | Bacteria | 15410 |
| 8 | Ga0055528_1002612 | 3300003790 | Bacteria | 9541 |
| 9 | Ga0058862_10154010 | 3300004803 | Bacteria | 4254 |
| 10 | Ga0058862_11897790 | 3300004803 | Bacteria | 1301 |
| 11 | Ga0070683_100818071 | 3300005329 | Bacteria | 893 |
| 12 | Ga0070690_100098394 | 3300005330 | Bacteria | 1936 |
| 13 | Ga0068869_100217399 | 3300005334 | Bacteria | 1513 |
| 14 | Ga0070666_10004404 | 3300005335 | Bacteria | 8576 |
| 15 | Ga0070680_100003696 | 3300005336 | Bacteria | 11428 |
| 16 | Ga0070680_100067788 | 3300005336 | Bacteria | 2927 |
| 17 | Ga0070680_100277938 | 3300005336 | Bacteria | 1418 |
| 18 | Ga0070682_100080613 | 3300005337 | Bacteria | 2105 |
| 19 | Ga0068868_100390657 | 3300005338 | Bacteria | 1199 |
| 20 | Ga0070660_100035330 | 3300005339 | Bacteria | 3782 |
| 21 | Ga0070689_100765956 | 3300005340 | Bacteria | 847 |
| 22 | Ga0070691_10004289 | 3300005341 | Bacteria | 6476 |
| 23 | Ga0070661_100034522 | 3300005344 | Bacteria | 3668 |
| 24 | Ga0070668_100020184 | 3300005347 | Bacteria | 5025 |
| 25 | Ga0070669_100131906 | 3300005353 | Bacteria | 1918 |
| 26 | Ga0070675_100046170 | 3300005354 | Bacteria | 3566 |
| 27 | Ga0070671_100025544 | 3300005355 | Bacteria | 4848 |
| 28 | Ga0070671_100202723 | 3300005355 | Bacteria | 1682 |
| 29 | Ga0070674_100288097 | 3300005356 | Bacteria | 1304 |
| 30 | Ga0070673_100144172 | 3300005364 | Bacteria | 2012 |
| 31 | Ga0070688_100532674 | 3300005365 | Bacteria | 890 |
| 32 | Ga0070659_100021466 | 3300005366 | Bacteria | 4919 |
| 33 | Ga0070667_100002113 | 3300005367 | Bacteria | 17509 |
| 34 | Ga0070667_100076545 | 3300005367 | Bacteria | 2857 |
| 35 | Ga0070667_100128619 | 3300005367 | Bacteria | 2209 |
| 36 | Ga0070709_10029758 | 3300005434 | Bacteria | 3270 |
| 37 | Ga0070714_100000045 | 3300005435 | Bacteria | 113749 |
| 38 | Ga0070713_100028460 | 3300005436 | Bacteria | 4413 |
| 39 | Ga0070713_100369270 | 3300005436 | Bacteria | 1335 |
| 40 | Ga0070711_100319627 | 3300005439 | Bacteria | 1240 |
| 41 | Ga0070711_100430166 | 3300005439 | Bacteria | 1077 |
| 42 | Ga0070700_100488353 | 3300005441 | Bacteria | 945 |
| 43 | Ga0070694_100495454 | 3300005444 | Bacteria | 971 |
| 44 | Ga0070681_10001506 | 3300005458 | Bacteria | 20626 |
| 45 | Ga0070681_10010687 | 3300005458 | Bacteria | 9074 |
| 46 | Ga0070681_10104818 | 3300005458 | Bacteria | 2769 |
| 47 | Ga0070681_10195653 | 3300005458 | Bacteria | 1941 |
| 48 | Ga0070681_10202467 | 3300005458 | Bacteria | 1903 |
| 49 | Ga0070681_11071672 | 3300005458 | Bacteria | 726 |
| 50 | Ga0068867_100827992 | 3300005459 | Bacteria | 827 |
| 51 | Ga0070679_100007294 | 3300005530 | Bacteria | 10325 |
| 52 | Ga0070679_100016917 | 3300005530 | Bacteria | 7050 |
| 53 | Ga0070679_100076140 | 3300005530 | Bacteria | 3345 |
| 54 | Ga0070684_100002498 | 3300005535 | Bacteria | 13554 |
| 55 | Ga0070684_100007045 | 3300005535 | Bacteria | 8739 |
| 56 | Ga0070684_100056735 | 3300005535 | Bacteria | 3418 |
| 57 | Ga0070684_100119564 | 3300005535 | Bacteria | 2370 |
| 58 | Ga0070697_100001968 | 3300005536 | Bacteria | 15713 |
| 59 | Ga0068853_100056726 | 3300005539 | Bacteria | 3379 |
| 60 | Ga0068853_100114412 | 3300005539 | Bacteria | 2400 |
| 61 | Ga0070695_100168657 | 3300005545 | Bacteria | 1543 |
| 62 | Ga0070695_100172867 | 3300005545 | Bacteria | 1525 |
| 63 | Ga0070696_100351671 | 3300005546 | Bacteria | 1141 |
| 64 | Ga0070693_100013404 | 3300005547 | Bacteria | 4176 |
| 65 | Ga0070665_100000795 | 3300005548 | Bacteria | 41370 |
| 66 | Ga0070665_100002296 | 3300005548 | Bacteria | 21239 |
| 67 | Ga0070665_100109204 | 3300005548 | Bacteria | 2768 |
| 68 | Ga0068855_100002276 | 3300005563 | Bacteria | 23723 |
| 69 | Ga0068855_100023639 | 3300005563 | Bacteria | 7360 |
| 70 | Ga0068855_100029565 | 3300005563 | Bacteria | 6549 |
| 71 | Ga0068855_100223618 | 3300005563 | Bacteria | 2110 |
| 72 | Ga0070664_100943194 | 3300005564 | Bacteria | 810 |
| 73 | Ga0068857_100000716 | 3300005577 | Bacteria | 24726 |
| 74 | Ga0068857_100007977 | 3300005577 | Bacteria | 9139 |
| 75 | Ga0068857_100275686 | 3300005577 | Bacteria | 1546 |
| 76 | Ga0068854_100206509 | 3300005578 | Bacteria | 1547 |
| 77 | Ga0068854_100227187 | 3300005578 | Bacteria | 1480 |
| 78 | Ga0068856_100000584 | 3300005614 | Bacteria | 39905 |
| 79 | Ga0068856_100043815 | 3300005614 | Bacteria | 4402 |
| 80 | Ga0068856_100084692 | 3300005614 | Bacteria | 3149 |
| 81 | Ga0068856_100227285 | 3300005614 | Bacteria | 1882 |
| 82 | Ga0068856_100510144 | 3300005614 | Bacteria | 1224 |
| 83 | Ga0068852_100006091 | 3300005616 | Bacteria | 8693 |
| 84 | Ga0068852_100051595 | 3300005616 | Bacteria | 3531 |
| 85 | Ga0068852_100388270 | 3300005616 | Bacteria | 1371 |
| 86 | Ga0068864_100351442 | 3300005618 | Bacteria | 1391 |
| 87 | Ga0068864_100983929 | 3300005618 | Bacteria | 836 |
| 88 | Ga0068866_10046767 | 3300005718 | Bacteria | 2178 |
| 89 | Ga0068866_10273778 | 3300005718 | Bacteria | 1043 |
| 90 | Ga0068861_100070646 | 3300005719 | Bacteria | 2704 |
| 91 | Ga0068863_100000591 | 3300005841 | Bacteria | 36891 |
| 92 | Ga0068863_100015005 | 3300005841 | Bacteria | 7441 |
| 93 | Ga0068863_100225095 | 3300005841 | Bacteria | 1808 |
| 94 | Ga0068863_100500124 | 3300005841 | Bacteria | 1197 |
| 95 | Ga0068858_100008753 | 3300005842 | Bacteria | 9712 |
| 96 | Ga0068858_100050136 | 3300005842 | Bacteria | 3864 |
| 97 | Ga0068858_100059432 | 3300005842 | Bacteria | 3533 |
| 98 | Ga0068858_100114451 | 3300005842 | Bacteria | 2520 |
| 99 | Ga0068858_100152337 | 3300005842 | Bacteria | 2174 |
| 100 | Ga0068858_100193074 | 3300005842 | Bacteria | 1924 |
| 101 | Ga0068858_100722015 | 3300005842 | Bacteria | 970 |
| 102 | Ga0068860_100000124 | 3300005843 | Bacteria | 124227 |
| 103 | Ga0068860_100985489 | 3300005843 | Bacteria | 860 |
| 104 | Ga0068862_100015848 | 3300005844 | Bacteria | 6262 |
| 105 | Ga0068862_100137563 | 3300005844 | Bacteria | 2166 |
| 106 | Ga0081540_1002336 | 3300005983 | Bacteria | 15529 |
| 107 | Ga0081539_10004900 | 3300005985 | Bacteria | 14269 |
| 108 | Ga0075368_10027029 | 3300006042 | Bacteria | 2211 |
| 109 | Ga0075364_10001655 | 3300006051 | Bacteria | 12245 |
| 110 | Ga0070715_10028218 | 3300006163 | Bacteria | 2249 |
| 111 | Ga0070715_10139930 | 3300006163 | Bacteria | 1174 |
| 112 | Ga0070716_100000492 | 3300006173 | Bacteria | 16423 |
| 113 | Ga0070716_100017030 | 3300006173 | Bacteria | 3760 |
| 114 | Ga0070712_100024963 | 3300006175 | Bacteria | 3967 |
| 115 | Ga0070712_100047342 | 3300006175 | Bacteria | 2976 |
| 116 | Ga0070712_100048193 | 3300006175 | Bacteria | 2953 |
| 117 | Ga0075367_10003446 | 3300006178 | Bacteria | 7546 |
| 118 | Ga0097621_100002374 | 3300006237 | Bacteria | 12906 |
| 119 | Ga0097621_100116456 | 3300006237 | Bacteria | 2263 |
| 120 | Ga0097621_100201538 | 3300006237 | Bacteria | 1728 |
| 121 | Ga0075370_10000403 | 3300006353 | Bacteria | 15977 |
| 122 | Ga0068871_100317720 | 3300006358 | Bacteria | 1370 |
| 123 | Ga0068871_100405234 | 3300006358 | Bacteria | 1215 |
| 124 | Ga0068871_100522318 | 3300006358 | Bacteria | 1072 |
| 125 | Ga0075428_100011720 | 3300006844 | Bacteria | 9759 |
| 126 | Ga0075430_100292626 | 3300006846 | Unclassified | 1347 |
| 127 | Ga0075431_100045681 | 3300006847 | Bacteria | 4515 |
| 128 | Ga0075431_100073774 | 3300006847 | Bacteria | 3521 |
| 129 | Ga0075433_10000173 | 3300006852 | Bacteria | 35469 |
| 130 | Ga0075434_100055879 | 3300006871 | Bacteria | 3922 |
| 131 | Ga0075434_100514936 | 3300006871 | Bacteria | 1217 |
| 132 | Ga0075434_100726014 | 3300006871 | Bacteria | 1011 |
| 133 | Ga0075429_100027316 | 3300006880 | Bacteria | 4953 |
| 134 | Ga0075429_100040499 | 3300006880 | Bacteria | 4057 |
| 135 | Ga0075429_100042492 | 3300006880 | Bacteria | 3956 |
| 136 | Ga0068865_100088713 | 3300006881 | Bacteria | 2238 |
| 137 | Ga0099794_10248010 | 3300007265 | Bacteria | 918 |
| 138 | Ga0105251_10033177 | 3300009011 | Bacteria | 2566 |
| 139 | Ga0105244_10029566 | 3300009036 | Bacteria | 2926 |
| 140 | Ga0105244_10060400 | 3300009036 | Bacteria | 1910 |
| 141 | Ga0105244_10175224 | 3300009036 | Bacteria | 1019 |
| 142 | Ga0105250_10000710 | 3300009092 | Bacteria | 20530 |
| 143 | Ga0105250_10004303 | 3300009092 | Bacteria | 6573 |
| 144 | Ga0105250_10007605 | 3300009092 | Bacteria | 4645 |
| 145 | Ga0105250_10044738 | 3300009092 | Bacteria | 1775 |
| 146 | Ga0105250_10164818 | 3300009092 | Bacteria | 926 |
| 147 | Ga0105240_10008022 | 3300009093 | Bacteria | 15200 |
| 148 | Ga0105240_10008522 | 3300009093 | Bacteria | 14654 |
| 149 | Ga0105240_10018690 | 3300009093 | Bacteria | 9287 |
| 150 | Ga0105240_10071151 | 3300009093 | Unclassified | 4302 |
| 151 | Ga0105240_10097720 | 3300009093 | Bacteria | 3578 |
| 152 | Ga0105240_10159088 | 3300009093 | Bacteria | 2685 |
| 153 | Ga0105240_10167387 | 3300009093 | Bacteria | 2606 |
| 154 | Ga0105240_11386896 | 3300009093 | Bacteria | 739 |
| 155 | Ga0111539_10004974 | 3300009094 | Bacteria | 17299 |
| 156 | Ga0111539_10023605 | 3300009094 | Bacteria | 7557 |
| 157 | Ga0105245_10005954 | 3300009098 | Bacteria | 10713 |
| 158 | Ga0105245_10013777 | 3300009098 | Bacteria | 7042 |
| 159 | Ga0105245_10071261 | 3300009098 | Bacteria | 3156 |
| 160 | Ga0105245_10219974 | 3300009098 | Bacteria | 1832 |
| 161 | Ga0105247_10420735 | 3300009101 | Bacteria | 956 |
| 162 | Ga0114129_10001310 | 3300009147 | Bacteria | 33247 |
| 163 | Ga0114129_10003757 | 3300009147 | Bacteria | 21399 |
| 164 | Ga0114129_10017346 | 3300009147 | Bacteria | 10250 |
| 165 | Ga0114129_10047535 | 3300009147 | Bacteria | 6029 |
| 166 | Ga0105243_10002974 | 3300009148 | Bacteria | 14002 |
| 167 | Ga0105243_10382311 | 3300009148 | Bacteria | 1302 |
| 168 | Ga0105241_10022091 | 3300009174 | Bacteria | 4711 |
| 169 | Ga0105241_10037389 | 3300009174 | Bacteria | 3657 |
| 170 | Ga0105241_10043990 | 3300009174 | Bacteria | 3383 |
| 171 | Ga0105241_10294231 | 3300009174 | Bacteria | 1391 |
| 172 | Ga0105242_10002299 | 3300009176 | Bacteria | 15093 |
| 173 | Ga0105242_10023253 | 3300009176 | Bacteria | 4886 |
| 174 | Ga0105242_10067385 | 3300009176 | Bacteria | 2959 |
| 175 | Ga0105242_11300227 | 3300009176 | Bacteria | 751 |
| 176 | Ga0105248_10006547 | 3300009177 | Bacteria | 12771 |
| 177 | Ga0105248_10026324 | 3300009177 | Bacteria | 6471 |
| 178 | Ga0105248_10080063 | 3300009177 | Bacteria | 3671 |
| 179 | Ga0105248_10205546 | 3300009177 | Bacteria | 2219 |
| 180 | Ga0105248_10300709 | 3300009177 | Bacteria | 1807 |
| 181 | Ga0105237_10010352 | 3300009545 | Bacteria | 9931 |
| 182 | Ga0105237_10074953 | 3300009545 | Bacteria | 3376 |
| 183 | Ga0105237_10172548 | 3300009545 | Bacteria | 2163 |
| 184 | Ga0105237_10236500 | 3300009545 | Bacteria | 1828 |
| 185 | Ga0105237_10831996 | 3300009545 | Bacteria | 930 |
| 186 | Ga0105238_10000959 | 3300009551 | Bacteria | 29509 |
| 187 | Ga0105238_10048977 | 3300009551 | Bacteria | 4257 |
| 188 | Ga0105238_10088840 | 3300009551 | Bacteria | 3077 |
| 189 | Ga0105238_10092899 | 3300009551 | Bacteria | 3005 |
| 190 | Ga0105238_10206995 | 3300009551 | Bacteria | 1938 |
| 191 | Ga0105238_10284513 | 3300009551 | Bacteria | 1635 |
| 192 | Ga0105238_10626012 | 3300009551 | Bacteria | 1085 |
| 193 | Ga0105238_10677785 | 3300009551 | Bacteria | 1042 |
| 194 | Ga0105249_10038241 | 3300009553 | Bacteria | 4353 |
| 195 | Ga0105249_10075349 | 3300009553 | Bacteria | 3125 |
| 196 | Ga0105249_10095664 | 3300009553 | Bacteria | 2785 |
| 197 | Ga0105249_10106935 | 3300009553 | Bacteria | 2640 |
| 198 | Ga0105239_10003659 | 3300010375 | Bacteria | 18789 |
| 199 | Ga0105239_10006626 | 3300010375 | Bacteria | 13408 |
| 200 | Ga0105239_10215460 | 3300010375 | Bacteria | 2153 |
| 201 | Ga0105239_10294677 | 3300010375 | Bacteria | 1827 |
| 202 | Ga0105239_10754315 | 3300010375 | Bacteria | 1114 |
| 203 | Ga0105246_10003746 | 3300011119 | Bacteria | 9215 |
| 204 | Ga0105246_10028473 | 3300011119 | Bacteria | 3671 |
| 205 | Ga0105246_10114094 | 3300011119 | Bacteria | 1990 |
| 206 | Ga0157370_10013077 | 3300013104 | Bacteria | 8567 |
| 207 | Ga0157370_10024501 | 3300013104 | Bacteria | 5977 |
| 208 | Ga0157370_10097743 | 3300013104 | Bacteria | 2754 |
| 209 | Ga0157369_10001499 | 3300013105 | Bacteria | 28639 |
| 210 | Ga0157369_10001507 | 3300013105 | Bacteria | 28572 |
| 211 | Ga0157369_10018212 | 3300013105 | Bacteria | 7876 |
| 212 | Ga0157369_10252479 | 3300013105 | Bacteria | 1840 |
| 213 | Ga0157369_10272458 | 3300013105 | Bacteria | 1763 |
| 214 | Ga0157369_10572370 | 3300013105 | Bacteria | 1167 |
| 215 | Ga0157369_10578404 | 3300013105 | Bacteria | 1160 |
| 216 | Ga0157374_10005352 | 3300013296 | Bacteria | 10776 |
| 217 | Ga0157374_10014588 | 3300013296 | Bacteria | 6877 |
| 218 | Ga0157374_10017559 | 3300013296 | Bacteria | 6302 |
| 219 | Ga0157374_10073087 | 3300013296 | Bacteria | 3237 |
| 220 | Ga0157374_10848251 | 3300013296 | Bacteria | 930 |
| 221 | Ga0157378_10005189 | 3300013297 | Bacteria | 11435 |
| 222 | Ga0163162_10002954 | 3300013306 | Bacteria | 16227 |
| 223 | Ga0163162_10623743 | 3300013306 | Bacteria | 1203 |
| 224 | Ga0163162_11180641 | 3300013306 | Unclassified | 868 |
| 225 | Ga0157372_10087374 | 3300013307 | Bacteria | 3538 |
| 226 | Ga0157372_10171146 | 3300013307 | Bacteria | 2513 |
| 227 | Ga0157375_10002682 | 3300013308 | Bacteria | 15421 |
| 228 | Ga0163163_10034926 | 3300014325 | Bacteria | 4874 |
| 229 | Ga0163163_10425915 | 3300014325 | Bacteria | 1386 |
| 230 | Ga0163163_10451957 | 3300014325 | Bacteria | 1345 |
| 231 | Ga0163163_10651804 | 3300014325 | Bacteria | 1116 |
| 232 | Ga0157380_10034195 | 3300014326 | Bacteria | 3919 |
| 233 | Ga0157380_10127585 | 3300014326 | Bacteria | 2165 |
| 234 | Ga0157379_10035876 | 3300014968 | Bacteria | 4422 |
| 235 | Ga0157379_10040329 | 3300014968 | Bacteria | 4167 |
| 236 | Ga0157379_10172217 | 3300014968 | Bacteria | 1954 |
| 237 | Ga0157376_10030719 | 3300014969 | Bacteria | 4293 |
| 238 | Ga0157376_10128559 | 3300014969 | Bacteria | 2257 |
| 239 | Ga0157376_10206628 | 3300014969 | Bacteria | 1810 |
| 240 | Ga0163161_10501316 | 3300017792 | Bacteria | 989 |
| 241 | Ga0206356_10960057 | 3300020070 | Bacteria | 880 |
| 242 | Ga0206355_1406151 | 3300020076 | Bacteria | 2889 |
| 243 | Ga0206352_10796245 | 3300020078 | Bacteria | 884 |
| 244 | Ga0206350_10164359 | 3300020080 | Bacteria | 1398 |
| 245 | Ga0206354_10243924 | 3300020081 | Bacteria | 1434 |
| 246 | Ga0224712_10010938 | 3300022467 | Bacteria | 2794 |
| 247 | Ga0224712_10014748 | 3300022467 | Bacteria | 2525 |
| 248 | Ga0209566_100054 | 3300025225 | Bacteria | 221422 |
| 249 | Ga0209147_100147 | 3300025229 | Bacteria | 103478 |
| 250 | Ga0209147_101339 | 3300025229 | Bacteria | 9360 |
| 251 | Ga0209233_1003995 | 3300025261 | Bacteria | 5111 |
| 252 | Ga0209673_1008114 | 3300025273 | Bacteria | 4721 |
| 253 | Ga0209130_1002308 | 3300025284 | Bacteria | 9757 |
| 254 | Ga0209130_1024027 | 3300025284 | Bacteria | 1336 |
| 255 | Ga0209675_1048704 | 3300025291 | Bacteria | 885 |
| 256 | Ga0209676_1000671 | 3300025292 | Bacteria | 48631 |
| 257 | Ga0209025_1001474 | 3300025294 | Bacteria | 30636 |
| 258 | Ga0209025_1001829 | 3300025294 | Bacteria | 25005 |
| 259 | Ga0209025_1005920 | 3300025294 | Bacteria | 9748 |
| 260 | Ga0209025_1011722 | 3300025294 | Bacteria | 5727 |
| 261 | Ga0209025_1016024 | 3300025294 | Bacteria | 4461 |
| 262 | Ga0209025_1039336 | 3300025294 | Bacteria | 2064 |
| 263 | Ga0209025_1050244 | 3300025294 | Bacteria | 1669 |
| 264 | Ga0207696_1000943 | 3300025711 | Bacteria | 17794 |
| 265 | Ga0207696_1001826 | 3300025711 | Bacteria | 10960 |
| 266 | Ga0207696_1002435 | 3300025711 | Bacteria | 9133 |
| 267 | Ga0207696_1021931 | 3300025711 | Bacteria | 2038 |
| 268 | Ga0207655_1003259 | 3300025728 | Bacteria | 12183 |
| 269 | Ga0207655_1006507 | 3300025728 | Bacteria | 7728 |
| 270 | Ga0207713_1000974 | 3300025735 | Bacteria | 25301 |
| 271 | Ga0207713_1036567 | 3300025735 | Bacteria | 2104 |
| 272 | Ga0207642_10020980 | 3300025899 | Bacteria | 2563 |
| 273 | Ga0207642_10110248 | 3300025899 | Bacteria | 1400 |
| 274 | Ga0207710_10248944 | 3300025900 | Bacteria | 888 |
| 275 | Ga0207685_10099717 | 3300025905 | Bacteria | 1239 |
| 276 | Ga0207685_10195231 | 3300025905 | Bacteria | 947 |
| 277 | Ga0207699_10011912 | 3300025906 | Bacteria | 4408 |
| 278 | Ga0207699_10014021 | 3300025906 | Bacteria | 4120 |
| 279 | Ga0207699_10186218 | 3300025906 | Bacteria | 1398 |
| 280 | Ga0207705_10153379 | 3300025909 | Bacteria | 1727 |
| 281 | Ga0207654_10009007 | 3300025911 | Bacteria | 5065 |
| 282 | Ga0207654_10026740 | 3300025911 | Bacteria | 3128 |
| 283 | Ga0207654_10030605 | 3300025911 | Bacteria | 2956 |
| 284 | Ga0207654_10048711 | 3300025911 | Bacteria | 2426 |
| 285 | Ga0207654_10411921 | 3300025911 | Bacteria | 942 |
| 286 | Ga0207707_10000224 | 3300025912 | Bacteria | 60855 |
| 287 | Ga0207707_10003625 | 3300025912 | Bacteria | 13691 |
| 288 | Ga0207707_10126777 | 3300025912 | Bacteria | 2232 |
| 289 | Ga0207707_10401577 | 3300025912 | Bacteria | 1176 |
| 290 | Ga0207695_10000533 | 3300025913 | Bacteria | 79615 |
| 291 | Ga0207695_10013787 | 3300025913 | Bacteria | 9617 |
| 292 | Ga0207695_10052088 | 3300025913 | Bacteria | 4291 |
| 293 | Ga0207695_10110840 | 3300025913 | Bacteria | 2724 |
| 294 | Ga0207695_10172671 | 3300025913 | Bacteria | 2086 |
| 295 | Ga0207695_10181126 | 3300025913 | Unclassified | 2028 |
| 296 | Ga0207671_10042259 | 3300025914 | Bacteria | 3374 |
| 297 | Ga0207671_10060807 | 3300025914 | Bacteria | 2803 |
| 298 | Ga0207693_10000187 | 3300025915 | Bacteria | 56636 |
| 299 | Ga0207693_10012450 | 3300025915 | Bacteria | 6874 |
| 300 | Ga0207693_10020483 | 3300025915 | Bacteria | 5259 |
| 301 | Ga0207663_10039723 | 3300025916 | Bacteria | 2853 |
| 302 | Ga0207663_10180119 | 3300025916 | Bacteria | 1508 |
| 303 | Ga0207660_10015178 | 3300025917 | Bacteria | 5081 |
| 304 | Ga0207660_10280497 | 3300025917 | Bacteria | 1322 |
| 305 | Ga0207657_10047663 | 3300025919 | Bacteria | 3745 |
| 306 | Ga0207657_10540860 | 3300025919 | Bacteria | 911 |
| 307 | Ga0207649_10428252 | 3300025920 | Bacteria | 995 |
| 308 | Ga0207652_10005967 | 3300025921 | Bacteria | 9856 |
| 309 | Ga0207652_10009933 | 3300025921 | Bacteria | 7660 |
| 310 | Ga0207694_10000545 | 3300025924 | Bacteria | 34152 |
| 311 | Ga0207694_10006193 | 3300025924 | Bacteria | 9136 |
| 312 | Ga0207694_10018377 | 3300025924 | Bacteria | 5284 |
| 313 | Ga0207694_10024007 | 3300025924 | Bacteria | 4631 |
| 314 | Ga0207694_10053086 | 3300025924 | Bacteria | 3142 |
| 315 | Ga0207659_10069659 | 3300025926 | Bacteria | 2562 |
| 316 | Ga0207687_10004677 | 3300025927 | Bacteria | 9108 |
| 317 | Ga0207687_10096701 | 3300025927 | Bacteria | 2165 |
| 318 | Ga0207687_10114119 | 3300025927 | Bacteria | 2010 |
| 319 | Ga0207687_10147137 | 3300025927 | Bacteria | 1793 |
| 320 | Ga0207700_10421456 | 3300025928 | Bacteria | 1173 |
| 321 | Ga0207664_10000063 | 3300025929 | Bacteria | 113763 |
| 322 | Ga0207664_10696174 | 3300025929 | Bacteria | 914 |
| 323 | Ga0207644_10024273 | 3300025931 | Bacteria | 4161 |
| 324 | Ga0207644_10045343 | 3300025931 | Bacteria | 3128 |
| 325 | Ga0207706_10092503 | 3300025933 | Bacteria | 2659 |
| 326 | Ga0207686_10006947 | 3300025934 | Bacteria | 6093 |
| 327 | Ga0207686_10020281 | 3300025934 | Bacteria | 3795 |
| 328 | Ga0207686_10057549 | 3300025934 | Bacteria | 2448 |
| 329 | Ga0207686_10533698 | 3300025934 | Bacteria | 915 |
| 330 | Ga0207709_10004912 | 3300025935 | Bacteria | 7655 |
| 331 | Ga0207709_10109909 | 3300025935 | Bacteria | 1841 |
| 332 | Ga0207670_10356275 | 3300025936 | Bacteria | 1160 |
| 333 | Ga0207669_10288569 | 3300025937 | Bacteria | 1241 |
| 334 | Ga0207665_10001360 | 3300025939 | Bacteria | 16473 |
| 335 | Ga0207711_10001263 | 3300025941 | Bacteria | 23968 |
| 336 | Ga0207711_10018860 | 3300025941 | Bacteria | 5735 |
| 337 | Ga0207711_10063146 | 3300025941 | Bacteria | 3196 |
| 338 | Ga0207711_10162091 | 3300025941 | Bacteria | 2025 |
| 339 | Ga0207689_10145563 | 3300025942 | Bacteria | 1952 |
| 340 | Ga0207689_10179387 | 3300025942 | Bacteria | 1747 |
| 341 | Ga0207689_10303167 | 3300025942 | Bacteria | 1324 |
| 342 | Ga0207689_10618072 | 3300025942 | Bacteria | 912 |
| 343 | Ga0207661_10012672 | 3300025944 | Bacteria | 6137 |
| 344 | Ga0207661_10026842 | 3300025944 | Bacteria | 4393 |
| 345 | Ga0207661_10101200 | 3300025944 | Bacteria | 2420 |
| 346 | Ga0207661_10128582 | 3300025944 | Bacteria | 2166 |
| 347 | Ga0207661_10195276 | 3300025944 | Bacteria | 1777 |
| 348 | Ga0207661_10744324 | 3300025944 | Bacteria | 902 |
| 349 | Ga0207679_10617753 | 3300025945 | Bacteria | 978 |
| 350 | Ga0207667_10000322 | 3300025949 | Bacteria | 66404 |
| 351 | Ga0207667_10030375 | 3300025949 | Bacteria | 5846 |
| 352 | Ga0207667_10176447 | 3300025949 | Bacteria | 2195 |
| 353 | Ga0207667_10666148 | 3300025949 | Bacteria | 1045 |
| 354 | Ga0207651_10054764 | 3300025960 | Bacteria | 2735 |
| 355 | Ga0207651_10410067 | 3300025960 | Bacteria | 1154 |
| 356 | Ga0207712_10060408 | 3300025961 | Bacteria | 2687 |
| 357 | Ga0207712_10500148 | 3300025961 | Bacteria | 1039 |
| 358 | Ga0207712_10616138 | 3300025961 | Bacteria | 940 |
| 359 | Ga0207668_10006517 | 3300025972 | Bacteria | 6897 |
| 360 | Ga0207640_10262427 | 3300025981 | Bacteria | 1347 |
| 361 | Ga0207658_10002789 | 3300025986 | Bacteria | 12579 |
| 362 | Ga0207658_10234417 | 3300025986 | Bacteria | 1551 |
| 363 | Ga0207677_10456619 | 3300026023 | Bacteria | 1096 |
| 364 | Ga0207703_10023134 | 3300026035 | Bacteria | 4880 |
| 365 | Ga0207703_10046850 | 3300026035 | Bacteria | 3484 |
| 366 | Ga0207703_10055839 | 3300026035 | Bacteria | 3214 |
| 367 | Ga0207703_10077462 | 3300026035 | Bacteria | 2760 |
| 368 | Ga0207703_10093470 | 3300026035 | Bacteria | 2533 |
| 369 | Ga0207703_10116212 | 3300026035 | Bacteria | 2290 |
| 370 | Ga0207639_10055457 | 3300026041 | Bacteria | 3034 |
| 371 | Ga0207639_10061393 | 3300026041 | Bacteria | 2903 |
| 372 | Ga0207639_10644942 | 3300026041 | Bacteria | 979 |
| 373 | Ga0207702_10001895 | 3300026078 | Bacteria | 20447 |
| 374 | Ga0207702_10061034 | 3300026078 | Bacteria | 3215 |
| 375 | Ga0207702_10355599 | 3300026078 | Bacteria | 1403 |
| 376 | Ga0207641_10002289 | 3300026088 | Bacteria | 17837 |
| 377 | Ga0207641_10144934 | 3300026088 | Bacteria | 2147 |
| 378 | Ga0207641_10295845 | 3300026088 | Bacteria | 1527 |
| 379 | Ga0207648_10016334 | 3300026089 | Bacteria | 6787 |
| 380 | Ga0207676_10211464 | 3300026095 | Bacteria | 1721 |
| 381 | Ga0207676_10341431 | 3300026095 | Bacteria | 1382 |
| 382 | Ga0207676_10951875 | 3300026095 | Bacteria | 844 |
| 383 | Ga0207674_10000350 | 3300026116 | Bacteria | 59446 |
| 384 | Ga0207674_10008397 | 3300026116 | Bacteria | 11938 |
| 385 | Ga0207674_10215474 | 3300026116 | Bacteria | 1869 |
| 386 | Ga0207675_100041628 | 3300026118 | Bacteria | 4290 |
| 387 | Ga0207675_100766752 | 3300026118 | Bacteria | 976 |
| 388 | Ga0207683_10221335 | 3300026121 | Bacteria | 1725 |
| 389 | Ga0207698_10002809 | 3300026142 | Bacteria | 10409 |
| 390 | Ga0207698_10135643 | 3300026142 | Bacteria | 2111 |
| 391 | Ga0207428_10011746 | 3300027907 | Bacteria | 7724 |
| 392 | Ga0207428_10019602 | 3300027907 | Bacteria | 5764 |
| 393 | Ga0268266_10002662 | 3300028379 | Bacteria | 18798 |
| 394 | Ga0268266_10028502 | 3300028379 | Bacteria | 4745 |
| 395 | Ga0268266_10627155 | 3300028379 | Bacteria | 1034 |
| 396 | Ga0268265_10031658 | 3300028380 | Bacteria | 3822 |
| 397 | Ga0268265_10110565 | 3300028380 | Bacteria | 2242 |
| 398 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 399 | Ga0268264_10461161 | 3300028381 | Bacteria | 1233 |
| 400 | Ga0265338_10066134 | 3300028800 | Bacteria | 3130 |
| 401 | Ga0237817_10064 | 3300030083 | Bacteria | 35967 |
| 402 | Ga0268256_1005862 | 3300030500 | Bacteria | 4708 |
| 403 | Ga0265320_10012925 | 3300031240 | Bacteria | 4826 |
| 404 | Ga0265327_10070510 | 3300031251 | Bacteria | 1751 |
| 405 | Ga0307408_100035921 | 3300031548 | Bacteria | 3480 |
| 406 | Ga0307408_100281684 | 3300031548 | Bacteria | 1385 |
| 407 | Ga0265313_10011168 | 3300031595 | Bacteria | 5600 |
| 408 | Ga0316575_10003764 | 3300031665 | Bacteria | 5274 |
| 409 | Ga0316575_10024198 | 3300031665 | Bacteria | 2349 |
| 410 | Ga0316579_10045790 | 3300031691 | Bacteria | 2040 |
| 411 | Ga0265314_10011222 | 3300031711 | Bacteria | 7414 |
| 412 | Ga0316576_10039421 | 3300031727 | Bacteria | 3391 |
| 413 | Ga0316576_10100611 | 3300031727 | Bacteria | 2160 |
| 414 | Ga0316578_10049089 | 3300031728 | Unclassified | 2466 |
| 415 | Ga0316578_10274690 | 3300031728 | Bacteria | 1009 |
| 416 | Ga0316577_10004002 | 3300031733 | Bacteria | 7544 |
| 417 | Ga0316577_10038292 | 3300031733 | Bacteria | 2682 |
| 418 | Ga0307410_10054611 | 3300031852 | Bacteria | 2709 |
| 419 | Ga0307410_10355537 | 3300031852 | Bacteria | 1172 |
| 420 | Ga0307406_10107466 | 3300031901 | Bacteria | 1913 |
| 421 | Ga0307407_10643107 | 3300031903 | Bacteria | 794 |
| 422 | Ga0307416_100490958 | 3300032002 | Bacteria | 1290 |
| 423 | Ga0307416_100493374 | 3300032002 | Bacteria | 1287 |
| 424 | Ga0307416_100898158 | 3300032002 | Bacteria | 986 |
| 425 | Ga0307411_10303630 | 3300032005 | Bacteria | 1281 |
| 426 | Ga0307415_100108285 | 3300032126 | Bacteria | 2055 |
| 427 | Ga0316583_10000274 | 3300032133 | Bacteria | 14265 |
| 428 | Ga0316583_10000560 | 3300032133 | Bacteria | 11244 |
| 429 | Ga0316583_10024747 | 3300032133 | Bacteria | 2144 |
| 430 | Ga0316583_10033001 | 3300032133 | Bacteria | 1840 |
| 431 | Ga0316583_10084614 | 3300032133 | Bacteria | 1108 |
| 432 | Ga0316580_10026637 | 3300032139 | Bacteria | 1788 |
| 433 | Ga0373928_0002459 | 3300035084 | Bacteria | 3589 |
| 434 | Ga0373934_0004823 | 3300035086 | Bacteria | 4988 |
| 435 | Ga0373934_0028363 | 3300035086 | Bacteria | 2181 |
| 436 | Ga0373923_0039399 | 3300035111 | Bacteria | 1940 |
| 437 | Ga0373932_0013385 | 3300035112 | Bacteria | 2039 |
| 438 | Ga0373953_0017659 | 3300035117 | Bacteria | 2627 |
| 439 | Ga0373953_0168681 | 3300035117 | Bacteria | 942 |
| 440 | Ga0373954_0033937 | 3300035118 | Bacteria | 2361 |
| 441 | Ga0373956_0075611 | 3300035119 | Bacteria | 1541 |
| 442 | Ga0373957_0055352 | 3300035120 | Bacteria | 1525 |
| 443 | Ga0373955_0172783 | 3300035172 | Bacteria | 1280 |
| 444 | Ga0373955_0189369 | 3300035172 | Bacteria | 1223 |
| 445 | Ga0373955_0397501 | 3300035172 | Bacteria | 837 |
| 446 | Ga0316574_0001779 | 3300035398 | Bacteria | 10466 |
| 447 | Ga0373935_0212804 | 3300035692 | Bacteria | 1340 |
| 448 | Ga0373935_0387181 | 3300035692 | Bacteria | 1002 |
| 449 | Ga0373933_0020180 | 3300035724 | Bacteria | 3776 |
| 450 | Ga0373933_0195727 | 3300035724 | Bacteria | 1292 |
| 451 | Ga0373947_0074466 | 3300035725 | Bacteria | 2089 |
| 452 | Ga0373937_0028222 | 3300036401 | Bacteria | 5077 |
| 453 | Ga0373937_0100194 | 3300036401 | Bacteria | 2688 |
| 454 | Ga0373937_0110421 | 3300036401 | Bacteria | 2557 |
| 455 | Ga0373937_0116026 | 3300036401 | Bacteria | 2494 |
| 456 | Ga0373937_0308972 | 3300036401 | Bacteria | 1495 |
| 457 | Ga0316582_0009984 | 3300036647 | Bacteria | 5181 |
| 458 | Ga0316582_0026331 | 3300036647 | Bacteria | 3500 |
| 459 | Ga0316584_0031977 | 3300036712 | Bacteria | 3892 |
| 460 | Ga0316584_0111966 | 3300036712 | Bacteria | 2042 |
| 461 | Ga0316584_0155297 | 3300036712 | Bacteria | 1702 |
| 462 | Ga0316584_0217793 | 3300036712 | Bacteria | 1404 |
| 463 | Ga0373925_0524231 | 3300037068 | Bacteria | 974 |
| 464 | Ga0373925_0650746 | 3300037068 | Bacteria | 868 |
| 465 | Ga0395905_0046662 | 3300037471 | Bacteria | 4063 |
| 466 | Ga0316581_0006044 | 3300037588 | Bacteria | 3187 |
| 467 | Ga0237819_00110 | 3300038705 | Bacteria | 30255 |
| 468 | Ga0451577_0000241 | 3300042876 | Bacteria | 108191 |
| 469 | Ga0451577_0039495 | 3300042876 | Bacteria | 4241 |
| 470 | Ga0451577_0043115 | 3300042876 | Bacteria | 4042 |
| 471 | Ga0451577_0132601 | 3300042876 | Bacteria | 2236 |
| 472 | Ga0451577_0152727 | 3300042876 | Bacteria | 2078 |
| 473 | Ga0453683_0010518 | 3300044673 | Bacteria | 6128 |
| 474 | Ga0453683_0030579 | 3300044673 | Bacteria | 3404 |
| 475 | Ga0453683_0196294 | 3300044673 | Bacteria | 1281 |
| 476 | Ga0466963_0572464 | 3300044694 | Bacteria | 798 |
| 477 | Ga0453684_0000366 | 3300044712 | Bacteria | 186117 |
| 478 | Ga0453684_0013557 | 3300044712 | Bacteria | 13222 |
| 479 | Ga0453684_0219653 | 3300044712 | Bacteria | 2202 |
| 480 | Ga0453684_0272620 | 3300044712 | Bacteria | 1933 |
| 481 | Ga0453684_0309482 | 3300044712 | Bacteria | 1793 |
| 482 | Ga0453684_0635008 | 3300044712 | Bacteria | 1167 |
| 483 | Ga0451576_0000138 | 3300045051 | Bacteria | 185167 |
| 484 | Ga0451576_0005856 | 3300045051 | Bacteria | 15266 |
| 485 | Ga0451576_0098529 | 3300045051 | Bacteria | 3041 |
| 486 | Ga0451576_0346470 | 3300045051 | Bacteria | 1555 |
| 487 | Ga0451576_0400010 | 3300045051 | Bacteria | 1440 |
| 488 | Ga0451576_0576249 | 3300045051 | Bacteria | 1183 |
| 489 | Ga0466967_0000014 | 3300045976 | Bacteria | 99206 |
| 490 | Ga0466967_0005146 | 3300045976 | Bacteria | 8996 |
| 491 | Ga0466967_0113279 | 3300045976 | Bacteria | 2495 |
| 492 | Ga0466967_0158880 | 3300045976 | Bacteria | 2120 |
| 493 | Ga0466967_0781440 | 3300045976 | Bacteria | 948 |
| 494 | Ga0466967_0948172 | 3300045976 | Bacteria | 856 |
| 495 | Ga0495603_0095625 | 3300046455 | Bacteria | 1736 |
| 496 | Ga0495603_0245693 | 3300046455 | Bacteria | 1030 |
| 497 | Ga0495641_0003534 | 3300046461 | Bacteria | 11613 |
| 498 | Ga0495651_0047803 | 3300046462 | Bacteria | 3306 |
| 499 | Ga0495651_0077715 | 3300046462 | Bacteria | 2512 |
| 500 | Ga0495580_0127040 | 3300046472 | Bacteria | 1770 |
| 501 | Ga0495582_0004318 | 3300046473 | Bacteria | 7992 |
| 502 | Ga0495582_0014794 | 3300046473 | Bacteria | 4287 |
| 503 | Ga0495605_0077786 | 3300046474 | Bacteria | 1556 |
| 504 | Ga0495605_0080546 | 3300046474 | Bacteria | 1524 |
| 505 | Ga0495664_0076901 | 3300046477 | Bacteria | 1998 |
| 506 | Ga0495584_0014741 | 3300046491 | Bacteria | 3982 |
| 507 | Ga0495585_0036363 | 3300046492 | Bacteria | 2778 |
| 508 | Ga0495594_0053576 | 3300046499 | Bacteria | 2222 |
| 509 | Ga0495596_0035078 | 3300046500 | Unclassified | 1990 |
| 510 | Ga0495628_0416205 | 3300046516 | Bacteria | 980 |
| 511 | Ga0495644_0001174 | 3300046523 | Bacteria | 10747 |
| 512 | Ga0495652_0014290 | 3300046529 | Bacteria | 7130 |
| 513 | Ga0495665_0026826 | 3300046531 | Bacteria | 3093 |
| 514 | Ga0495586_0044955 | 3300046535 | Bacteria | 2379 |
| 515 | Ga0495587_0005456 | 3300046536 | Bacteria | 8296 |
| 516 | Ga0495587_0109951 | 3300046536 | Bacteria | 1584 |
| 517 | Ga0495587_0157970 | 3300046536 | Bacteria | 1291 |
| 518 | Ga0495621_0111627 | 3300046539 | Bacteria | 1049 |
| 519 | Ga0495645_0009695 | 3300046543 | Bacteria | 6735 |
| 520 | Ga0495667_0035399 | 3300046559 | Bacteria | 3337 |
| 521 | Ga0495656_0041097 | 3300046615 | Bacteria | 1930 |
| 522 | Ga0495656_0052955 | 3300046615 | Unclassified | 1742 |
| 523 | Ga0495635_0029998 | 3300046663 | Bacteria | 3781 |
| 524 | Ga0495588_0117258 | 3300046674 | Bacteria | 1403 |
| 525 | Ga0495599_0000343 | 3300046678 | Bacteria | 27587 |
| 526 | Ga0495623_0066892 | 3300046679 | Bacteria | 2244 |
| 527 | Ga0495623_0074015 | 3300046679 | Bacteria | 2117 |
| 528 | Ga0495647_0090080 | 3300046681 | Bacteria | 1257 |
| 529 | Ga0495669_0009653 | 3300046684 | Bacteria | 4072 |
| 530 | Ga0495669_0029100 | 3300046684 | Bacteria | 2421 |
| 531 | Ga0495669_0061916 | 3300046684 | Unclassified | 1695 |
| 532 | Ga0495669_0107071 | 3300046684 | Bacteria | 1303 |
| 533 | Ga0495613_0134083 | 3300046689 | Bacteria | 1773 |
| 534 | Ga0495613_0420195 | 3300046689 | Bacteria | 910 |
| 535 | Ga0495589_0171192 | 3300046794 | Bacteria | 1032 |
| 536 | Ga0495600_0176426 | 3300046809 | Bacteria | 1378 |
| 537 | Ga0495600_0265862 | 3300046809 | Bacteria | 1089 |
| 538 | Ga0495604_0066714 | 3300047317 | Bacteria | 2736 |
| 539 | Ga0495676_0058211 | 3300047321 | Bacteria | 3042 |
| 540 | Ga0495680_0062275 | 3300047322 | Bacteria | 2869 |
| 541 | Ga0495683_0180603 | 3300047323 | Bacteria | 964 |
| 542 | Ga0495675_0012462 | 3300047444 | Bacteria | 5352 |
| 543 | Ga0495675_0025880 | 3300047444 | Bacteria | 3739 |
| 544 | Ga0495675_0297709 | 3300047444 | Bacteria | 959 |
| 545 | Ga0495677_0021330 | 3300047445 | Bacteria | 2348 |
| 546 | Ga0495685_124043 | 3300047447 | Bacteria | 847 |
| 547 | Ga0495684_0002760 | 3300047471 | Bacteria | 13871 |
| 548 | Ga0495686_0372459 | 3300047472 | Bacteria | 772 |
| 549 | Ga0495602_0211814 | 3300048088 | Bacteria | 1470 |
| 550 | Ga0496100_0000498 | 3300048903 | Bacteria | 18867 |
| 551 | Ga0496101_0000571 | 3300048904 | Bacteria | 22550 |
| 552 | Ga0496102_0002229 | 3300048905 | Bacteria | 16619 |
| 553 | Ga0496102_0543397 | 3300048905 | Bacteria | 1085 |
| 554 | Ga0496103_0000697 | 3300048906 | Bacteria | 24934 |
| 555 | Ga0496104_0030123 | 3300048907 | Bacteria | 5040 |
| 556 | Ga0496104_0353665 | 3300048907 | Bacteria | 1382 |
| 557 | Ga0496105_0001675 | 3300048908 | Bacteria | 15800 |
| 558 | Ga0496106_0000192 | 3300048909 | Bacteria | 43140 |
| 559 | Ga0496107_0000406 | 3300048910 | Bacteria | 23295 |
| 560 | Ga0496108_0000290 | 3300048911 | Bacteria | 43303 |
| 561 | Ga0496109_0001566 | 3300048912 | Bacteria | 19050 |
| 562 | Ga0496110_0000108 | 3300048913 | Bacteria | 45034 |
| 563 | Ga0496110_0001866 | 3300048913 | Bacteria | 15570 |
| 564 | Ga0496110_0257991 | 3300048913 | Bacteria | 1587 |
| 565 | Ga0496111_0000587 | 3300048914 | Bacteria | 19083 |
| 566 | Ga0496112_0001734 | 3300048915 | Bacteria | 17071 |
| 567 | Ga0496112_0255072 | 3300048915 | Bacteria | 1704 |
| 568 | Ga0496113_0065573 | 3300048916 | Bacteria | 2749 |
| 569 | Ga0496113_0072136 | 3300048916 | Bacteria | 2627 |
| 570 | Ga0496115_0082454 | 3300048918 | Bacteria | 2620 |
| 571 | Ga0496115_0136994 | 3300048918 | Bacteria | 2018 |
| 572 | Ga0496116_0002109 | 3300048919 | Bacteria | 21219 |
| 573 | Ga0496116_0006026 | 3300048919 | Bacteria | 11104 |
| 574 | Ga0496116_0057934 | 3300048919 | Bacteria | 2529 |
| 575 | Ga0496117_0065254 | 3300048920 | Bacteria | 2476 |
| 576 | Ga0496117_0081889 | 3300048920 | Bacteria | 2116 |
| 577 | Ga0496117_0238440 | 3300048920 | Bacteria | 1000 |
| 578 | Ga0496119_0000166 | 3300048922 | Bacteria | 92117 |
| 579 | Ga0496119_0002606 | 3300048922 | Bacteria | 19566 |
| 580 | Ga0496120_0000406 | 3300048923 | Bacteria | 69216 |
| 581 | Ga0496120_0169544 | 3300048923 | Bacteria | 1081 |
| 582 | Ga0496122_0008068 | 3300048925 | Bacteria | 11482 |
| 583 | Ga0496122_0029071 | 3300048925 | Bacteria | 4673 |
| 584 | Ga0496122_0073114 | 3300048925 | Bacteria | 2433 |
| 585 | Ga0496122_0142246 | 3300048925 | Bacteria | 1498 |
| 586 | Ga0496123_0200478 | 3300048926 | Bacteria | 1023 |
| 587 | Ga0496124_0000748 | 3300048927 | Bacteria | 53309 |
| 588 | Ga0496124_0200152 | 3300048927 | Bacteria | 1520 |
| 589 | Ga0496125_0018356 | 3300048928 | Bacteria | 6647 |
| 590 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 591 | Ga0496126_0002339 | 3300048929 | Bacteria | 25958 |
| 592 | Ga0496126_0020601 | 3300048929 | Bacteria | 6458 |
| 593 | Ga0496126_0024562 | 3300048929 | Bacteria | 5815 |
| 594 | Ga0496126_0111183 | 3300048929 | Bacteria | 2386 |
| 595 | Ga0501031_0027664 | 3300049568 | Bacteria | 3696 |
| 596 | Ga0501032_0025975 | 3300049569 | Bacteria | 4033 |
| 597 | Ga0501033_0002225 | 3300049570 | Bacteria | 16675 |
| 598 | Ga0501033_0002400 | 3300049570 | Bacteria | 15945 |
| 599 | Ga0501034_0139736 | 3300049571 | Bacteria | 2402 |
| 600 | Ga0501034_0343343 | 3300049571 | Bacteria | 1422 |
| 601 | Ga0501036_0008381 | 3300049572 | Bacteria | 8473 |
| 602 | Ga0501036_0025068 | 3300049572 | Bacteria | 5029 |
| 603 | Ga0501037_0008257 | 3300049573 | Bacteria | 7633 |
| 604 | Ga0501037_0029373 | 3300049573 | Bacteria | 4061 |
| 605 | Ga0501038_0021989 | 3300049574 | Bacteria | 5720 |
| 606 | Ga0501038_0404691 | 3300049574 | Bacteria | 1055 |
| 607 | Ga0501041_0054308 | 3300049577 | Bacteria | 2444 |
| 608 | Ga0501041_0103824 | 3300049577 | Bacteria | 1761 |
| 609 | Ga0501042_0023694 | 3300049578 | Bacteria | 4298 |
| 610 | Ga0501046_0007059 | 3300049580 | Bacteria | 9890 |
| 611 | Ga0501046_0124708 | 3300049580 | Bacteria | 1957 |
| 612 | Ga0501047_0147928 | 3300049581 | Bacteria | 2225 |
| 613 | Ga0501047_0196946 | 3300049581 | Bacteria | 1876 |
| 614 | Ga0501048_0004626 | 3300049582 | Bacteria | 10470 |
| 615 | Ga0501048_0061649 | 3300049582 | Bacteria | 2655 |
| 616 | Ga0501048_0195348 | 3300049582 | Bacteria | 1434 |
| 617 | Ga0501067_0015673 | 3300049583 | Bacteria | 4195 |
| 618 | Ga0501067_0060736 | 3300049583 | Bacteria | 2092 |
| 619 | Ga0501067_0200595 | 3300049583 | Bacteria | 1111 |
| 620 | Ga0501068_0240801 | 3300049584 | Bacteria | 1151 |
| 621 | Ga0501069_0051305 | 3300049585 | Bacteria | 2295 |
| 622 | Ga0501069_0062438 | 3300049585 | Bacteria | 2080 |
| 623 | Ga0501070_0007501 | 3300049586 | Bacteria | 9265 |
| 624 | Ga0501070_0016879 | 3300049586 | Bacteria | 6126 |
| 625 | Ga0501072_0445484 | 3300049588 | Bacteria | 1026 |
| 626 | Ga0501073_0004269 | 3300049589 | Bacteria | 10713 |
| 627 | Ga0501073_0012733 | 3300049589 | Bacteria | 6136 |
| 628 | Ga0501073_0036396 | 3300049589 | Bacteria | 3497 |
| 629 | Ga0501073_0067110 | 3300049589 | Bacteria | 2501 |
| 630 | Ga0501074_0016785 | 3300049590 | Bacteria | 5312 |
| 631 | Ga0501074_0054576 | 3300049590 | Bacteria | 2881 |
| 632 | Ga0501074_0059424 | 3300049590 | Bacteria | 2754 |
| 633 | Ga0501075_0033309 | 3300049591 | Bacteria | 3833 |
| 634 | Ga0501075_0629376 | 3300049591 | Bacteria | 818 |
| 635 | Ga0501076_0064479 | 3300049592 | Bacteria | 2920 |
| 636 | Ga0501076_0167765 | 3300049592 | Bacteria | 1789 |
| 637 | Ga0501076_0337170 | 3300049592 | Bacteria | 1237 |
| 638 | Ga0501077_0189360 | 3300049593 | Bacteria | 1307 |
| 639 | Ga0501079_0026084 | 3300049741 | Bacteria | 4481 |
| 640 | Ga0501080_0039188 | 3300049742 | Bacteria | 4422 |
| 641 | Ga0501080_0111404 | 3300049742 | Bacteria | 2537 |
| 642 | Ga0501080_0245188 | 3300049742 | Bacteria | 1634 |
| 643 | Ga0501080_0265592 | 3300049742 | Bacteria | 1563 |
| 644 | Ga0501081_0142666 | 3300049743 | Bacteria | 1717 |
| 645 | Ga0501083_0083175 | 3300049744 | Bacteria | 2120 |
| 646 | Ga0501035_0003044 | 3300049822 | Bacteria | 16081 |
| 647 | Ga0501035_0042588 | 3300049822 | Bacteria | 4094 |
| 648 | Ga0501044_0084139 | 3300049823 | Bacteria | 3215 |
| 649 | Ga0501045_0012697 | 3300049824 | Bacteria | 5931 |
| 650 | Ga0501045_0133929 | 3300049824 | Bacteria | 1842 |
| 651 | nmdc:mga00v17_49926_c1 | 3300050491 | Bacteria | 2540 |
| 652 | nmdc:mga05p37_2171_c1 | 3300050507 | Bacteria | 22880 |
| 653 | nmdc:mga05p37_24128_c1 | 3300050507 | Bacteria | 7388 |
| 654 | nmdc:mga05p37_253602_c1 | 3300050507 | Bacteria | 2109 |
| 655 | nmdc:mga05p37_560471_c1 | 3300050507 | Bacteria | 1298 |
| 656 | nmdc:mga05p37_65410_c1 | 3300050507 | Bacteria | 4473 |
| 657 | nmdc:mga09592_141350_c1 | 3300050508 | Bacteria | 2075 |
| 658 | nmdc:mga09592_32991_c1 | 3300050508 | Bacteria | 4319 |
| 659 | nmdc:mga06r32_117824_c1 | 3300050510 | Unclassified | 2617 |
| 660 | nmdc:mga06r32_1186919_c1 | 3300050510 | Bacteria | 710 |
| 661 | nmdc:mga06r32_31344_c1 | 3300050510 | Bacteria | 4992 |
| 662 | nmdc:mga08y16_173730_c1 | 3300050511 | Bacteria | 2237 |
| 663 | nmdc:mga08y16_18169_c1 | 3300050511 | Bacteria | 7409 |
| 664 | nmdc:mga08y16_8741_c1 | 3300050511 | Bacteria | 10623 |
| 665 | nmdc:mga0n895_187168_c1 | 3300050512 | Bacteria | 2101 |
| 666 | nmdc:mga0rr50_293762_c1 | 3300050513 | Bacteria | 1358 |
| 667 | nmdc:mga0a205_155444_c1 | 3300050515 | Bacteria | 2186 |
| 668 | nmdc:mga0a205_328794_c1 | 3300050515 | Bacteria | 1398 |
| 669 | nmdc:mga0a205_470_c1 | 3300050515 | Bacteria | 31351 |
| 670 | Ga0495601_0276036 | 3300053077 | Bacteria | 1096 |
| 671 | Ga0495619_0025784 | 3300053085 | Bacteria | 3778 |
| 672 | Ga0495619_0065570 | 3300053085 | Bacteria | 2423 |
| 673 | Ga0500616_0005077 | 3300053153 | Bacteria | 9085 |
| 674 | Ga0501084_0000888 | 3300054114 | Bacteria | 23116 |
| 675 | Ga0501084_0075701 | 3300054114 | Bacteria | 2820 |
| 676 | Ga0501084_0083136 | 3300054114 | Bacteria | 2687 |
| 677 | Ga0587073_0006030 | 3300059492 | Bacteria | 1842 |
| 678 | Ga0587092_022268 | 3300059512 | Bacteria | 990 |
| 679 | Ga0501082_0013571 | 3300060353 | Bacteria | 7000 |
| 680 | Ga0501082_0059687 | 3300060353 | Bacteria | 3287 |
| 681 | Ga0501082_0090722 | 3300060353 | Bacteria | 2639 |
| 682 | Ga0501082_0098401 | 3300060353 | Bacteria | 2530 |
| 683 | Ga0501082_0211932 | 3300060353 | Bacteria | 1685 |
| 684 | Ga0530510_0292969 | 3300061734 | Bacteria | 1217 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046461 | Ga0495641_0003534 | Ga0495641_0003534_913_1596 | 186 |
| 2 | 3300047472 | Ga0495686_0372459 | Ga0495686_0372459_135_719 | 186 |
| 3 | 3300026121 | Ga0207683_10221335 | Ga0207683_102213352 | 187 |
| 4 | 3300005335 | Ga0070666_10004404 | Ga0070666_100044046 | 190 |
| 5 | 3300006847 | Ga0075431_100073774 | Ga0075431_1000737743 | 198 |
| 6 | 3300006880 | Ga0075429_100027316 | Ga0075429_1000273162 | 198 |
| 7 | 3300009147 | Ga0114129_10001310 | Ga0114129_1000131019 | 198 |
| 8 | 3300050507 | nmdc:mga05p37_2171_c1 | nmdc:mga05p37_2171_c1_7927_8619 | 198 |
| 9 | 3300050508 | nmdc:mga09592_141350_c1 | nmdc:mga09592_141350_c1_221_913 | 198 |
| 10 | 3300050510 | nmdc:mga06r32_31344_c1 | nmdc:mga06r32_31344_c1_270_962 | 198 |
| 11 | 3300050515 | nmdc:mga0a205_155444_c1 | nmdc:mga0a205_155444_c1_189_881 | 198 |
| 12 | 3300035692 | Ga0373935_0387181 | Ga0373935_0387181_188_838 | 199 |
| 13 | 3300049568 | Ga0501031_0027664 | Ga0501031_0027664_785_1459 | 202 |
| 14 | 3300049569 | Ga0501032_0025975 | Ga0501032_0025975_2667_3341 | 202 |
| 15 | 3300049570 | Ga0501033_0002225 | Ga0501033_0002225_15547_16221 | 202 |
| 16 | 3300049571 | Ga0501034_0139736 | Ga0501034_0139736_555_1229 | 202 |
| 17 | 3300049572 | Ga0501036_0025068 | Ga0501036_0025068_2799_3473 | 202 |
| 18 | 3300049573 | Ga0501037_0029373 | Ga0501037_0029373_441_1115 | 202 |
| 19 | 3300049574 | Ga0501038_0021989 | Ga0501038_0021989_3260_3934 | 202 |
| 20 | 3300049580 | Ga0501046_0124708 | Ga0501046_0124708_758_1432 | 202 |
| 21 | 3300049581 | Ga0501047_0147928 | Ga0501047_0147928_700_1374 | 202 |
| 22 | 3300049582 | Ga0501048_0004626 | Ga0501048_0004626_7390_8064 | 202 |
| 23 | 3300049583 | Ga0501067_0015673 | Ga0501067_0015673_370_1044 | 202 |
| 24 | 3300049584 | Ga0501068_0240801 | Ga0501068_0240801_58_732 | 202 |
| 25 | 3300049585 | Ga0501069_0062438 | Ga0501069_0062438_87_761 | 202 |
| 26 | 3300049586 | Ga0501070_0007501 | Ga0501070_0007501_4120_4794 | 202 |
| 27 | 3300049588 | Ga0501072_0445484 | Ga0501072_0445484_46_720 | 202 |
| 28 | 3300049589 | Ga0501073_0012733 | Ga0501073_0012733_4289_4963 | 202 |
| 29 | 3300049590 | Ga0501074_0054576 | Ga0501074_0054576_623_1297 | 202 |
| 30 | 3300049742 | Ga0501080_0039188 | Ga0501080_0039188_3302_3976 | 202 |
| 31 | 3300049744 | Ga0501083_0083175 | Ga0501083_0083175_182_856 | 202 |
| 32 | 3300049822 | Ga0501035_0042588 | Ga0501035_0042588_848_1522 | 202 |
| 33 | 3300049823 | Ga0501044_0084139 | Ga0501044_0084139_1558_2232 | 202 |
| 34 | 3300049824 | Ga0501045_0133929 | Ga0501045_0133929_1147_1821 | 202 |
| 35 | 3300050507 | nmdc:mga05p37_65410_c1 | nmdc:mga05p37_65410_c1_3312_4043 | 202 |
| 36 | 3300049570 | Ga0501033_0002400 | Ga0501033_0002400_4662_5336 | 203 |
| 37 | 3300049571 | Ga0501034_0343343 | Ga0501034_0343343_710_1384 | 203 |
| 38 | 3300049572 | Ga0501036_0008381 | Ga0501036_0008381_7670_8344 | 203 |
| 39 | 3300049573 | Ga0501037_0008257 | Ga0501037_0008257_2517_3191 | 203 |
| 40 | 3300049580 | Ga0501046_0007059 | Ga0501046_0007059_4554_5228 | 203 |
| 41 | 3300049581 | Ga0501047_0196946 | Ga0501047_0196946_402_1076 | 203 |
| 42 | 3300049582 | Ga0501048_0061649 | Ga0501048_0061649_1827_2501 | 203 |
| 43 | 3300049583 | Ga0501067_0200595 | Ga0501067_0200595_391_1065 | 203 |
| 44 | 3300049585 | Ga0501069_0051305 | Ga0501069_0051305_186_860 | 203 |
| 45 | 3300049586 | Ga0501070_0016879 | Ga0501070_0016879_1867_2541 | 203 |
| 46 | 3300049590 | Ga0501074_0016785 | Ga0501074_0016785_1053_1727 | 203 |
| 47 | 3300049741 | Ga0501079_0026084 | Ga0501079_0026084_3769_4443 | 203 |
| 48 | 3300049742 | Ga0501080_0245188 | Ga0501080_0245188_47_721 | 203 |
| 49 | 3300049822 | Ga0501035_0003044 | Ga0501035_0003044_10181_10855 | 203 |
| 50 | 3300054114 | Ga0501084_0000888 | Ga0501084_0000888_1746_2420 | 203 |
| 51 | 3300060353 | Ga0501082_0013571 | Ga0501082_0013571_3838_4512 | 203 |
| 52 | 3300013297 | Ga0157378_10005189 | Ga0157378_100051893 | 205 |
| 53 | 3300025294 | Ga0209025_1039336 | Ga0209025_10393363 | 206 |
| 54 | 3300031548 | Ga0307408_100281684 | Ga0307408_1002816842 | 206 |
| 55 | 3300036712 | Ga0316584_0111966 | Ga0316584_0111966_1047_1703 | 206 |
| 56 | 3300005618 | Ga0068864_100983929 | Ga0068864_1009839292 | 208 |
| 57 | 3300014969 | Ga0157376_10030719 | Ga0157376_100307196 | 208 |
| 58 | 3300026095 | Ga0207676_10951875 | Ga0207676_109518752 | 208 |
| 59 | 3300035172 | Ga0373955_0189369 | Ga0373955_0189369_307_987 | 208 |
| 60 | 3300046663 | Ga0495635_0029998 | Ga0495635_0029998_2178_2858 | 208 |
| 61 | 3300046681 | Ga0495647_0090080 | Ga0495647_0090080_47_727 | 208 |
| 62 | 3300047322 | Ga0495680_0062275 | Ga0495680_0062275_30_710 | 208 |
| 63 | 3300053077 | Ga0495601_0276036 | Ga0495601_0276036_259_939 | 208 |
| 64 | 3300053085 | Ga0495619_0065570 | Ga0495619_0065570_183_863 | 208 |
| 65 | 3300061734 | Ga0530510_0292969 | Ga0530510_0292969_379_1029 | 208 |
| 66 | 3300006880 | Ga0075429_100042492 | Ga0075429_1000424922 | 209 |
| 67 | 3300045051 | Ga0451576_0400010 | Ga0451576_0400010_182_838 | 209 |
| 68 | 3300046500 | Ga0495596_0035078 | Ga0495596_0035078_839_1528 | 209 |
| 69 | 3300046523 | Ga0495644_0001174 | Ga0495644_0001174_36_725 | 209 |
| 70 | 3300046615 | Ga0495656_0041097 | Ga0495656_0041097_876_1565 | 209 |
| 71 | 3300050508 | nmdc:mga09592_32991_c1 | nmdc:mga09592_32991_c1_902_1558 | 209 |
| 72 | 3300050510 | nmdc:mga06r32_1186919_c1 | nmdc:mga06r32_1186919_c1_32_688 | 209 |
| 73 | iso_pu_bacteria | 8022948649 | 8022949529 | 209 |
| 74 | 3300005347 | Ga0070668_100020184 | Ga0070668_1000201846 | 210 |
| 75 | 3300005355 | Ga0070671_100025544 | Ga0070671_1000255444 | 210 |
| 76 | 3300005367 | Ga0070667_100002113 | Ga0070667_10000211313 | 210 |
| 77 | 3300005435 | Ga0070714_100000045 | Ga0070714_10000004550 | 210 |
| 78 | 3300005842 | Ga0068858_100114451 | Ga0068858_1001144512 | 210 |
| 79 | 3300009553 | Ga0105249_10095664 | Ga0105249_100956642 | 210 |
| 80 | 3300014968 | Ga0157379_10035876 | Ga0157379_100358762 | 210 |
| 81 | 3300025929 | Ga0207664_10000063 | Ga0207664_1000006363 | 210 |
| 82 | 3300025961 | Ga0207712_10616138 | Ga0207712_106161381 | 210 |
| 83 | 3300026035 | Ga0207703_10093470 | Ga0207703_100934703 | 210 |
| 84 | 3300028379 | Ga0268266_10028502 | Ga0268266_100285023 | 210 |
| 85 | 3300031901 | Ga0307406_10107466 | Ga0307406_101074662 | 210 |
| 86 | 3300032126 | Ga0307415_100108285 | Ga0307415_1001082851 | 210 |
| 87 | 3300048916 | Ga0496113_0072136 | Ga0496113_0072136_47_718 | 210 |
| 88 | iso_pu_bacteria | 2551306519 | 2553391037 | 210 |
| 89 | iso_pu_bacteria | 2643221729 | 2644705245 | 210 |
| 90 | iso_pu_bacteria | 2643221730 | 2644709938 | 210 |
| 91 | iso_pu_bacteria | 2643221731 | 2644716082 | 210 |
| 92 | iso_pu_bacteria | 2684622632 | 2685151825 | 210 |
| 93 | iso_pu_bacteria | 2695420987 | 2698321339 | 210 |
| 94 | iso_pu_bacteria | 2703719227 | 2705995771 | 210 |
| 95 | iso_pu_bacteria | 2718218445 | 2721506991 | 210 |
| 96 | iso_pu_bacteria | 2738541358 | 2739154973 | 210 |
| 97 | iso_pu_bacteria | 2738543006 | 2739207655 | 210 |
| 98 | iso_pu_bacteria | 2738543017 | 2739268617 | 210 |
| 99 | iso_pu_bacteria | 2818991443 | 2819581048 | 210 |
| 100 | iso_pu_bacteria | 2818991465 | 2819709554 | 210 |
| 101 | iso_pu_bacteria | 2857465823 | 2857467074 | 210 |
| 102 | iso_pu_bacteria | 2857586860 | 2857588646 | 210 |
| 103 | iso_pu_bacteria | 2857591370 | 2857592990 | 210 |
| 104 | iso_pu_bacteria | 2929233124 | 2929237517 | 210 |
| 105 | iso_pu_bacteria | 2938917290 | 2938921711 | 210 |
| 106 | iso_pu_bacteria | 2947426588 | 2947430602 | 210 |
| 107 | iso_pu_bacteria | 2960319331 | 2960320538 | 210 |
| 108 | iso_pu_bacteria | 2965761152 | 2965765216 | 210 |
| 109 | iso_pu_bacteria | 2979083700 | 2979087480 | 210 |
| 110 | iso_pu_bacteria | 3001267043 | 3001267570 | 210 |
| 111 | iso_pu_bacteria | 3006973921 | 3006974786 | 210 |
| 112 | iso_pu_bacteria | 3006988479 | 3006989660 | 210 |
| 113 | iso_pu_bacteria | 8002317523 | 8002322322 | 210 |
| 114 | iso_pu_bacteria | 8022621104 | 8022623729 | 210 |
| 115 | iso_pu_bacteria | 8022792930 | 8022793895 | 210 |
| 116 | iso_pu_bacteria | 8023438354 | 8023440606 | 210 |
| 117 | iso_pu_bacteria | 8023444577 | 8023444709 | 210 |
| 118 | iso_pu_bacteria | 8046991243 | 8046997782 | 210 |
| 119 | iso_pu_bacteria | 8057582654 | 8057586287 | 210 |
| 120 | iso_pu_bacteria | 8057632132 | 8057634149 | 210 |
| 121 | 3300044712 | Ga0453684_0219653 | Ga0453684_0219653_907_1563 | 211 |
| 122 | iso_pu_bacteria | 2929297113 | 2929297739 | 211 |
| 123 | 3300005458 | Ga0070681_10202467 | Ga0070681_102024672 | 212 |
| 124 | 3300005548 | Ga0070665_100000795 | Ga0070665_10000079536 | 212 |
| 125 | 3300005841 | Ga0068863_100000591 | Ga0068863_10000059121 | 212 |
| 126 | 3300005843 | Ga0068860_100000124 | Ga0068860_10000012462 | 212 |
| 127 | 3300009551 | Ga0105238_10677785 | Ga0105238_106777851 | 212 |
| 128 | 3300025931 | Ga0207644_10024273 | Ga0207644_100242732 | 212 |
| 129 | 3300025972 | Ga0207668_10006517 | Ga0207668_100065174 | 212 |
| 130 | 3300025986 | Ga0207658_10002789 | Ga0207658_100027897 | 212 |
| 131 | 3300026088 | Ga0207641_10002289 | Ga0207641_1000228912 | 212 |
| 132 | 3300028381 | Ga0268264_10000027 | Ga0268264_1000002761 | 212 |
| 133 | 3300032002 | Ga0307416_100898158 | Ga0307416_1008981582 | 212 |
| 134 | 3300045976 | Ga0466967_0781440 | Ga0466967_0781440_99_743 | 212 |
| 135 | 3300048929 | Ga0496126_0111183 | Ga0496126_0111183_425_1099 | 212 |
| 136 | 3300053085 | Ga0495619_0025784 | Ga0495619_0025784_2411_3079 | 212 |
| 137 | 3300005983 | Ga0081540_1002336 | Ga0081540_10023364 | 213 |
| 138 | 3300005985 | Ga0081539_10004900 | Ga0081539_1000490016 | 213 |
| 139 | 3300010375 | Ga0105239_10294677 | Ga0105239_102946772 | 213 |
| 140 | 3300031691 | Ga0316579_10045790 | Ga0316579_100457902 | 213 |
| 141 | 3300031903 | Ga0307407_10643107 | Ga0307407_106431071 | 213 |
| 142 | 3300032133 | Ga0316583_10024747 | Ga0316583_100247472 | 213 |
| 143 | 3300036647 | Ga0316582_0009984 | Ga0316582_0009984_3219_3878 | 213 |
| 144 | 3300049577 | Ga0501041_0103824 | Ga0501041_0103824_568_1242 | 213 |
| 145 | 3300049593 | Ga0501077_0189360 | Ga0501077_0189360_228_902 | 213 |
| 146 | 3300050507 | nmdc:mga05p37_560471_c1 | nmdc:mga05p37_560471_c1_607_1287 | 213 |
| 147 | 3300053153 | Ga0500616_0005077 | Ga0500616_0005077_3162_3824 | 213 |
| 148 | 3300002987 | JGI25159J45721_1003344 | JGI25159J45721_10033442 | 214 |
| 149 | 3300002987 | JGI25159J45721_1009643 | JGI25159J45721_10096431 | 214 |
| 150 | 3300003187 | JGI25151J46595_10007057 | JGI25151J46595_100070572 | 214 |
| 151 | 3300003187 | JGI25151J46595_10011988 | JGI25151J46595_100119882 | 214 |
| 152 | 3300003316 | rootH1_10001147 | rootH1_1000114747 | 214 |
| 153 | 3300003322 | rootL2_10074625 | rootL2_1007462517 | 214 |
| 154 | 3300003578 | Ga0006562J51391_1001252 | Ga0006562J51391_100125214 | 214 |
| 155 | 3300003790 | Ga0055528_1002612 | Ga0055528_10026126 | 214 |
| 156 | 3300004803 | Ga0058862_10154010 | Ga0058862_101540101 | 214 |
| 157 | 3300004803 | Ga0058862_11897790 | Ga0058862_118977902 | 214 |
| 158 | 3300005329 | Ga0070683_100818071 | Ga0070683_1008180712 | 214 |
| 159 | 3300005330 | Ga0070690_100098394 | Ga0070690_1000983942 | 214 |
| 160 | 3300005334 | Ga0068869_100217399 | Ga0068869_1002173992 | 214 |
| 161 | 3300005336 | Ga0070680_100003696 | Ga0070680_1000036965 | 214 |
| 162 | 3300005336 | Ga0070680_100067788 | Ga0070680_1000677882 | 214 |
| 163 | 3300005336 | Ga0070680_100277938 | Ga0070680_1002779381 | 214 |
| 164 | 3300005337 | Ga0070682_100080613 | Ga0070682_1000806132 | 214 |
| 165 | 3300005338 | Ga0068868_100390657 | Ga0068868_1003906571 | 214 |
| 166 | 3300005339 | Ga0070660_100035330 | Ga0070660_1000353304 | 214 |
| 167 | 3300005340 | Ga0070689_100765956 | Ga0070689_1007659561 | 214 |
| 168 | 3300005341 | Ga0070691_10004289 | Ga0070691_100042896 | 214 |
| 169 | 3300005344 | Ga0070661_100034522 | Ga0070661_1000345225 | 214 |
| 170 | 3300005353 | Ga0070669_100131906 | Ga0070669_1001319062 | 214 |
| 171 | 3300005354 | Ga0070675_100046170 | Ga0070675_1000461702 | 214 |
| 172 | 3300005355 | Ga0070671_100202723 | Ga0070671_1002027232 | 214 |
| 173 | 3300005356 | Ga0070674_100288097 | Ga0070674_1002880971 | 214 |
| 174 | 3300005364 | Ga0070673_100144172 | Ga0070673_1001441722 | 214 |
| 175 | 3300005365 | Ga0070688_100532674 | Ga0070688_1005326741 | 214 |
| 176 | 3300005366 | Ga0070659_100021466 | Ga0070659_1000214663 | 214 |
| 177 | 3300005367 | Ga0070667_100076545 | Ga0070667_1000765454 | 214 |
| 178 | 3300005367 | Ga0070667_100128619 | Ga0070667_1001286192 | 214 |
| 179 | 3300005434 | Ga0070709_10029758 | Ga0070709_100297582 | 214 |
| 180 | 3300005436 | Ga0070713_100028460 | Ga0070713_1000284603 | 214 |
| 181 | 3300005436 | Ga0070713_100369270 | Ga0070713_1003692702 | 214 |
| 182 | 3300005439 | Ga0070711_100319627 | Ga0070711_1003196272 | 214 |
| 183 | 3300005439 | Ga0070711_100430166 | Ga0070711_1004301662 | 214 |
| 184 | 3300005441 | Ga0070700_100488353 | Ga0070700_1004883531 | 214 |
| 185 | 3300005444 | Ga0070694_100495454 | Ga0070694_1004954541 | 214 |
| 186 | 3300005458 | Ga0070681_10001506 | Ga0070681_1000150612 | 214 |
| 187 | 3300005458 | Ga0070681_10010687 | Ga0070681_100106873 | 214 |
| 188 | 3300005458 | Ga0070681_10104818 | Ga0070681_101048182 | 214 |
| 189 | 3300005458 | Ga0070681_10195653 | Ga0070681_101956532 | 214 |
| 190 | 3300005458 | Ga0070681_11071672 | Ga0070681_110716721 | 214 |
| 191 | 3300005459 | Ga0068867_100827992 | Ga0068867_1008279921 | 214 |
| 192 | 3300005530 | Ga0070679_100007294 | Ga0070679_10000729410 | 214 |
| 193 | 3300005530 | Ga0070679_100016917 | Ga0070679_1000169173 | 214 |
| 194 | 3300005530 | Ga0070679_100076140 | Ga0070679_1000761403 | 214 |
| 195 | 3300005535 | Ga0070684_100002498 | Ga0070684_1000024989 | 214 |
| 196 | 3300005535 | Ga0070684_100007045 | Ga0070684_1000070451 | 214 |
| 197 | 3300005535 | Ga0070684_100056735 | Ga0070684_1000567353 | 214 |
| 198 | 3300005535 | Ga0070684_100119564 | Ga0070684_1001195642 | 214 |
| 199 | 3300005536 | Ga0070697_100001968 | Ga0070697_1000019683 | 214 |
| 200 | 3300005539 | Ga0068853_100056726 | Ga0068853_1000567264 | 214 |
| 201 | 3300005539 | Ga0068853_100114412 | Ga0068853_1001144122 | 214 |
| 202 | 3300005545 | Ga0070695_100168657 | Ga0070695_1001686573 | 214 |
| 203 | 3300005545 | Ga0070695_100172867 | Ga0070695_1001728672 | 214 |
| 204 | 3300005546 | Ga0070696_100351671 | Ga0070696_1003516711 | 214 |
| 205 | 3300005547 | Ga0070693_100013404 | Ga0070693_1000134042 | 214 |
| 206 | 3300005548 | Ga0070665_100002296 | Ga0070665_1000022968 | 214 |
| 207 | 3300005548 | Ga0070665_100109204 | Ga0070665_1001092042 | 214 |
| 208 | 3300005563 | Ga0068855_100002276 | Ga0068855_10000227620 | 214 |
| 209 | 3300005563 | Ga0068855_100023639 | Ga0068855_1000236393 | 214 |
| 210 | 3300005563 | Ga0068855_100029565 | Ga0068855_1000295657 | 214 |
| 211 | 3300005563 | Ga0068855_100223618 | Ga0068855_1002236182 | 214 |
| 212 | 3300005564 | Ga0070664_100943194 | Ga0070664_1009431941 | 214 |
| 213 | 3300005577 | Ga0068857_100000716 | Ga0068857_10000071622 | 214 |
| 214 | 3300005577 | Ga0068857_100007977 | Ga0068857_10000797710 | 214 |
| 215 | 3300005577 | Ga0068857_100275686 | Ga0068857_1002756862 | 214 |
| 216 | 3300005578 | Ga0068854_100206509 | Ga0068854_1002065092 | 214 |
| 217 | 3300005578 | Ga0068854_100227187 | Ga0068854_1002271872 | 214 |
| 218 | 3300005614 | Ga0068856_100000584 | Ga0068856_10000058415 | 214 |
| 219 | 3300005614 | Ga0068856_100043815 | Ga0068856_1000438155 | 214 |
| 220 | 3300005614 | Ga0068856_100084692 | Ga0068856_1000846924 | 214 |
| 221 | 3300005614 | Ga0068856_100227285 | Ga0068856_1002272852 | 214 |
| 222 | 3300005614 | Ga0068856_100510144 | Ga0068856_1005101442 | 214 |
| 223 | 3300005616 | Ga0068852_100006091 | Ga0068852_10000609110 | 214 |
| 224 | 3300005616 | Ga0068852_100051595 | Ga0068852_1000515953 | 214 |
| 225 | 3300005616 | Ga0068852_100388270 | Ga0068852_1003882702 | 214 |
| 226 | 3300005618 | Ga0068864_100351442 | Ga0068864_1003514422 | 214 |
| 227 | 3300005718 | Ga0068866_10046767 | Ga0068866_100467673 | 214 |
| 228 | 3300005718 | Ga0068866_10273778 | Ga0068866_102737782 | 214 |
| 229 | 3300005719 | Ga0068861_100070646 | Ga0068861_1000706463 | 214 |
| 230 | 3300005841 | Ga0068863_100015005 | Ga0068863_10001500510 | 214 |
| 231 | 3300005841 | Ga0068863_100225095 | Ga0068863_1002250952 | 214 |
| 232 | 3300005841 | Ga0068863_100500124 | Ga0068863_1005001243 | 214 |
| 233 | 3300005842 | Ga0068858_100008753 | Ga0068858_1000087532 | 214 |
| 234 | 3300005842 | Ga0068858_100050136 | Ga0068858_1000501363 | 214 |
| 235 | 3300005842 | Ga0068858_100059432 | Ga0068858_1000594324 | 214 |
| 236 | 3300005842 | Ga0068858_100152337 | Ga0068858_1001523371 | 214 |
| 237 | 3300005842 | Ga0068858_100193074 | Ga0068858_1001930742 | 214 |
| 238 | 3300005842 | Ga0068858_100722015 | Ga0068858_1007220152 | 214 |
| 239 | 3300005843 | Ga0068860_100985489 | Ga0068860_1009854891 | 214 |
| 240 | 3300005844 | Ga0068862_100015848 | Ga0068862_1000158483 | 214 |
| 241 | 3300005844 | Ga0068862_100137563 | Ga0068862_1001375632 | 214 |
| 242 | 3300006042 | Ga0075368_10027029 | Ga0075368_100270292 | 214 |
| 243 | 3300006051 | Ga0075364_10001655 | Ga0075364_1000165513 | 214 |
| 244 | 3300006163 | Ga0070715_10028218 | Ga0070715_100282182 | 214 |
| 245 | 3300006163 | Ga0070715_10139930 | Ga0070715_101399302 | 214 |
| 246 | 3300006173 | Ga0070716_100000492 | Ga0070716_10000049212 | 214 |
| 247 | 3300006173 | Ga0070716_100017030 | Ga0070716_1000170303 | 214 |
| 248 | 3300006175 | Ga0070712_100024963 | Ga0070712_1000249635 | 214 |
| 249 | 3300006175 | Ga0070712_100047342 | Ga0070712_1000473425 | 214 |
| 250 | 3300006175 | Ga0070712_100048193 | Ga0070712_1000481933 | 214 |
| 251 | 3300006178 | Ga0075367_10003446 | Ga0075367_100034468 | 214 |
| 252 | 3300006237 | Ga0097621_100002374 | Ga0097621_1000023746 | 214 |
| 253 | 3300006237 | Ga0097621_100116456 | Ga0097621_1001164563 | 214 |
| 254 | 3300006237 | Ga0097621_100201538 | Ga0097621_1002015382 | 214 |
| 255 | 3300006353 | Ga0075370_10000403 | Ga0075370_100004032 | 214 |
| 256 | 3300006358 | Ga0068871_100317720 | Ga0068871_1003177202 | 214 |
| 257 | 3300006358 | Ga0068871_100405234 | Ga0068871_1004052342 | 214 |
| 258 | 3300006358 | Ga0068871_100522318 | Ga0068871_1005223181 | 214 |
| 259 | 3300006844 | Ga0075428_100011720 | Ga0075428_1000117207 | 214 |
| 260 | 3300006846 | Ga0075430_100292626 | Ga0075430_1002926262 | 214 |
| 261 | 3300006847 | Ga0075431_100045681 | Ga0075431_1000456812 | 214 |
| 262 | 3300006852 | Ga0075433_10000173 | Ga0075433_1000017323 | 214 |
| 263 | 3300006871 | Ga0075434_100055879 | Ga0075434_1000558793 | 214 |
| 264 | 3300006871 | Ga0075434_100514936 | Ga0075434_1005149362 | 214 |
| 265 | 3300006871 | Ga0075434_100726014 | Ga0075434_1007260142 | 214 |
| 266 | 3300006880 | Ga0075429_100040499 | Ga0075429_1000404994 | 214 |
| 267 | 3300006881 | Ga0068865_100088713 | Ga0068865_1000887133 | 214 |
| 268 | 3300007265 | Ga0099794_10248010 | Ga0099794_102480102 | 214 |
| 269 | 3300009011 | Ga0105251_10033177 | Ga0105251_100331773 | 214 |
| 270 | 3300009036 | Ga0105244_10029566 | Ga0105244_100295663 | 214 |
| 271 | 3300009036 | Ga0105244_10060400 | Ga0105244_100604002 | 214 |
| 272 | 3300009036 | Ga0105244_10175224 | Ga0105244_101752242 | 214 |
| 273 | 3300009092 | Ga0105250_10000710 | Ga0105250_100007103 | 214 |
| 274 | 3300009092 | Ga0105250_10004303 | Ga0105250_100043033 | 214 |
| 275 | 3300009092 | Ga0105250_10007605 | Ga0105250_100076053 | 214 |
| 276 | 3300009092 | Ga0105250_10044738 | Ga0105250_100447381 | 214 |
| 277 | 3300009092 | Ga0105250_10164818 | Ga0105250_101648181 | 214 |
| 278 | 3300009093 | Ga0105240_10008022 | Ga0105240_100080227 | 214 |
| 279 | 3300009093 | Ga0105240_10008522 | Ga0105240_100085224 | 214 |
| 280 | 3300009093 | Ga0105240_10018690 | Ga0105240_100186906 | 214 |
| 281 | 3300009093 | Ga0105240_10071151 | Ga0105240_100711515 | 214 |
| 282 | 3300009093 | Ga0105240_10097720 | Ga0105240_100977202 | 214 |
| 283 | 3300009093 | Ga0105240_10159088 | Ga0105240_101590882 | 214 |
| 284 | 3300009093 | Ga0105240_10167387 | Ga0105240_101673872 | 214 |
| 285 | 3300009093 | Ga0105240_11386896 | Ga0105240_113868961 | 214 |
| 286 | 3300009094 | Ga0111539_10004974 | Ga0111539_1000497410 | 214 |
| 287 | 3300009094 | Ga0111539_10023605 | Ga0111539_100236053 | 214 |
| 288 | 3300009098 | Ga0105245_10005954 | Ga0105245_100059544 | 214 |
| 289 | 3300009098 | Ga0105245_10013777 | Ga0105245_100137773 | 214 |
| 290 | 3300009098 | Ga0105245_10071261 | Ga0105245_100712612 | 214 |
| 291 | 3300009098 | Ga0105245_10219974 | Ga0105245_102199742 | 214 |
| 292 | 3300009101 | Ga0105247_10420735 | Ga0105247_104207351 | 214 |
| 293 | 3300009147 | Ga0114129_10003757 | Ga0114129_1000375714 | 214 |
| 294 | 3300009147 | Ga0114129_10017346 | Ga0114129_100173465 | 214 |
| 295 | 3300009147 | Ga0114129_10047535 | Ga0114129_100475354 | 214 |
| 296 | 3300009148 | Ga0105243_10002974 | Ga0105243_100029749 | 214 |
| 297 | 3300009148 | Ga0105243_10382311 | Ga0105243_103823112 | 214 |
| 298 | 3300009174 | Ga0105241_10022091 | Ga0105241_100220916 | 214 |
| 299 | 3300009174 | Ga0105241_10037389 | Ga0105241_100373894 | 214 |
| 300 | 3300009174 | Ga0105241_10043990 | Ga0105241_100439903 | 214 |
| 301 | 3300009174 | Ga0105241_10294231 | Ga0105241_102942312 | 214 |
| 302 | 3300009176 | Ga0105242_10002299 | Ga0105242_100022998 | 214 |
| 303 | 3300009176 | Ga0105242_10023253 | Ga0105242_100232533 | 214 |
| 304 | 3300009176 | Ga0105242_10067385 | Ga0105242_100673852 | 214 |
| 305 | 3300009176 | Ga0105242_11300227 | Ga0105242_113002271 | 214 |
| 306 | 3300009177 | Ga0105248_10006547 | Ga0105248_1000654711 | 214 |
| 307 | 3300009177 | Ga0105248_10026324 | Ga0105248_100263244 | 214 |
| 308 | 3300009177 | Ga0105248_10080063 | Ga0105248_100800635 | 214 |
| 309 | 3300009177 | Ga0105248_10205546 | Ga0105248_102055463 | 214 |
| 310 | 3300009177 | Ga0105248_10300709 | Ga0105248_103007092 | 214 |
| 311 | 3300009545 | Ga0105237_10010352 | Ga0105237_100103522 | 214 |
| 312 | 3300009545 | Ga0105237_10074953 | Ga0105237_100749532 | 214 |
| 313 | 3300009545 | Ga0105237_10172548 | Ga0105237_101725482 | 214 |
| 314 | 3300009545 | Ga0105237_10236500 | Ga0105237_102365002 | 214 |
| 315 | 3300009545 | Ga0105237_10831996 | Ga0105237_108319961 | 214 |
| 316 | 3300009551 | Ga0105238_10000959 | Ga0105238_100009592 | 214 |
| 317 | 3300009551 | Ga0105238_10048977 | Ga0105238_100489772 | 214 |
| 318 | 3300009551 | Ga0105238_10088840 | Ga0105238_100888402 | 214 |
| 319 | 3300009551 | Ga0105238_10092899 | Ga0105238_100928992 | 214 |
| 320 | 3300009551 | Ga0105238_10206995 | Ga0105238_102069951 | 214 |
| 321 | 3300009551 | Ga0105238_10284513 | Ga0105238_102845131 | 214 |
| 322 | 3300009551 | Ga0105238_10626012 | Ga0105238_106260122 | 214 |
| 323 | 3300009553 | Ga0105249_10038241 | Ga0105249_100382412 | 214 |
| 324 | 3300009553 | Ga0105249_10075349 | Ga0105249_100753492 | 214 |
| 325 | 3300009553 | Ga0105249_10106935 | Ga0105249_101069354 | 214 |
| 326 | 3300010375 | Ga0105239_10003659 | Ga0105239_1000365910 | 214 |
| 327 | 3300010375 | Ga0105239_10006626 | Ga0105239_100066267 | 214 |
| 328 | 3300010375 | Ga0105239_10215460 | Ga0105239_102154601 | 214 |
| 329 | 3300010375 | Ga0105239_10754315 | Ga0105239_107543152 | 214 |
| 330 | 3300011119 | Ga0105246_10003746 | Ga0105246_100037465 | 214 |
| 331 | 3300011119 | Ga0105246_10028473 | Ga0105246_100284735 | 214 |
| 332 | 3300011119 | Ga0105246_10114094 | Ga0105246_101140942 | 214 |
| 333 | 3300013104 | Ga0157370_10013077 | Ga0157370_100130779 | 214 |
| 334 | 3300013104 | Ga0157370_10024501 | Ga0157370_100245012 | 214 |
| 335 | 3300013104 | Ga0157370_10097743 | Ga0157370_100977432 | 214 |
| 336 | 3300013105 | Ga0157369_10001499 | Ga0157369_100014992 | 214 |
| 337 | 3300013105 | Ga0157369_10001507 | Ga0157369_1000150722 | 214 |
| 338 | 3300013105 | Ga0157369_10018212 | Ga0157369_100182122 | 214 |
| 339 | 3300013105 | Ga0157369_10252479 | Ga0157369_102524791 | 214 |
| 340 | 3300013105 | Ga0157369_10272458 | Ga0157369_102724582 | 214 |
| 341 | 3300013105 | Ga0157369_10572370 | Ga0157369_105723701 | 214 |
| 342 | 3300013105 | Ga0157369_10578404 | Ga0157369_105784041 | 214 |
| 343 | 3300013296 | Ga0157374_10005352 | Ga0157374_100053524 | 214 |
| 344 | 3300013296 | Ga0157374_10014588 | Ga0157374_100145885 | 214 |
| 345 | 3300013296 | Ga0157374_10017559 | Ga0157374_100175596 | 214 |
| 346 | 3300013296 | Ga0157374_10073087 | Ga0157374_100730872 | 214 |
| 347 | 3300013296 | Ga0157374_10848251 | Ga0157374_108482512 | 214 |
| 348 | 3300013306 | Ga0163162_10002954 | Ga0163162_100029542 | 214 |
| 349 | 3300013306 | Ga0163162_10623743 | Ga0163162_106237432 | 214 |
| 350 | 3300013306 | Ga0163162_11180641 | Ga0163162_111806412 | 214 |
| 351 | 3300013307 | Ga0157372_10087374 | Ga0157372_100873742 | 214 |
| 352 | 3300013307 | Ga0157372_10171146 | Ga0157372_101711463 | 214 |
| 353 | 3300013308 | Ga0157375_10002682 | Ga0157375_100026828 | 214 |
| 354 | 3300014325 | Ga0163163_10034926 | Ga0163163_100349263 | 214 |
| 355 | 3300014325 | Ga0163163_10425915 | Ga0163163_104259151 | 214 |
| 356 | 3300014325 | Ga0163163_10451957 | Ga0163163_104519572 | 214 |
| 357 | 3300014325 | Ga0163163_10651804 | Ga0163163_106518041 | 214 |
| 358 | 3300014326 | Ga0157380_10034195 | Ga0157380_100341953 | 214 |
| 359 | 3300014326 | Ga0157380_10127585 | Ga0157380_101275852 | 214 |
| 360 | 3300014968 | Ga0157379_10040329 | Ga0157379_100403294 | 214 |
| 361 | 3300014968 | Ga0157379_10172217 | Ga0157379_101722172 | 214 |
| 362 | 3300014969 | Ga0157376_10128559 | Ga0157376_101285592 | 214 |
| 363 | 3300014969 | Ga0157376_10206628 | Ga0157376_102066282 | 214 |
| 364 | 3300017792 | Ga0163161_10501316 | Ga0163161_105013162 | 214 |
| 365 | 3300020070 | Ga0206356_10960057 | Ga0206356_109600571 | 214 |
| 366 | 3300020076 | Ga0206355_1406151 | Ga0206355_14061513 | 214 |
| 367 | 3300020078 | Ga0206352_10796245 | Ga0206352_107962452 | 214 |
| 368 | 3300020080 | Ga0206350_10164359 | Ga0206350_101643591 | 214 |
| 369 | 3300020081 | Ga0206354_10243924 | Ga0206354_102439241 | 214 |
| 370 | 3300022467 | Ga0224712_10010938 | Ga0224712_100109382 | 214 |
| 371 | 3300022467 | Ga0224712_10014748 | Ga0224712_100147481 | 214 |
| 372 | 3300025225 | Ga0209566_100054 | Ga0209566_100054137 | 214 |
| 373 | 3300025229 | Ga0209147_100147 | Ga0209147_10014726 | 214 |
| 374 | 3300025229 | Ga0209147_101339 | Ga0209147_1013393 | 214 |
| 375 | 3300025261 | Ga0209233_1003995 | Ga0209233_10039952 | 214 |
| 376 | 3300025273 | Ga0209673_1008114 | Ga0209673_10081143 | 214 |
| 377 | 3300025284 | Ga0209130_1002308 | Ga0209130_10023083 | 214 |
| 378 | 3300025284 | Ga0209130_1024027 | Ga0209130_10240272 | 214 |
| 379 | 3300025291 | Ga0209675_1048704 | Ga0209675_10487042 | 214 |
| 380 | 3300025292 | Ga0209676_1000671 | Ga0209676_100067114 | 214 |
| 381 | 3300025294 | Ga0209025_1001474 | Ga0209025_10014743 | 214 |
| 382 | 3300025294 | Ga0209025_1001829 | Ga0209025_100182923 | 214 |
| 383 | 3300025294 | Ga0209025_1005920 | Ga0209025_10059209 | 214 |
| 384 | 3300025294 | Ga0209025_1011722 | Ga0209025_10117223 | 214 |
| 385 | 3300025294 | Ga0209025_1016024 | Ga0209025_10160243 | 214 |
| 386 | 3300025294 | Ga0209025_1050244 | Ga0209025_10502442 | 214 |
| 387 | 3300025711 | Ga0207696_1000943 | Ga0207696_10009436 | 214 |
| 388 | 3300025711 | Ga0207696_1001826 | Ga0207696_10018265 | 214 |
| 389 | 3300025711 | Ga0207696_1002435 | Ga0207696_10024353 | 214 |
| 390 | 3300025711 | Ga0207696_1021931 | Ga0207696_10219312 | 214 |
| 391 | 3300025728 | Ga0207655_1003259 | Ga0207655_10032597 | 214 |
| 392 | 3300025728 | Ga0207655_1006507 | Ga0207655_10065076 | 214 |
| 393 | 3300025735 | Ga0207713_1000974 | Ga0207713_100097416 | 214 |
| 394 | 3300025735 | Ga0207713_1036567 | Ga0207713_10365672 | 214 |
| 395 | 3300025899 | Ga0207642_10020980 | Ga0207642_100209804 | 214 |
| 396 | 3300025899 | Ga0207642_10110248 | Ga0207642_101102482 | 214 |
| 397 | 3300025900 | Ga0207710_10248944 | Ga0207710_102489441 | 214 |
| 398 | 3300025905 | Ga0207685_10099717 | Ga0207685_100997171 | 214 |
| 399 | 3300025905 | Ga0207685_10195231 | Ga0207685_101952312 | 214 |
| 400 | 3300025906 | Ga0207699_10011912 | Ga0207699_100119123 | 214 |
| 401 | 3300025906 | Ga0207699_10014021 | Ga0207699_100140213 | 214 |
| 402 | 3300025906 | Ga0207699_10186218 | Ga0207699_101862181 | 214 |
| 403 | 3300025909 | Ga0207705_10153379 | Ga0207705_101533792 | 214 |
| 404 | 3300025911 | Ga0207654_10009007 | Ga0207654_100090072 | 214 |
| 405 | 3300025911 | Ga0207654_10026740 | Ga0207654_100267403 | 214 |
| 406 | 3300025911 | Ga0207654_10030605 | Ga0207654_100306053 | 214 |
| 407 | 3300025911 | Ga0207654_10048711 | Ga0207654_100487112 | 214 |
| 408 | 3300025911 | Ga0207654_10411921 | Ga0207654_104119211 | 214 |
| 409 | 3300025912 | Ga0207707_10000224 | Ga0207707_1000022424 | 214 |
| 410 | 3300025912 | Ga0207707_10003625 | Ga0207707_1000362510 | 214 |
| 411 | 3300025912 | Ga0207707_10126777 | Ga0207707_101267772 | 214 |
| 412 | 3300025912 | Ga0207707_10401577 | Ga0207707_104015771 | 214 |
| 413 | 3300025913 | Ga0207695_10000533 | Ga0207695_1000053340 | 214 |
| 414 | 3300025913 | Ga0207695_10013787 | Ga0207695_100137874 | 214 |
| 415 | 3300025913 | Ga0207695_10052088 | Ga0207695_100520882 | 214 |
| 416 | 3300025913 | Ga0207695_10110840 | Ga0207695_101108402 | 214 |
| 417 | 3300025913 | Ga0207695_10172671 | Ga0207695_101726712 | 214 |
| 418 | 3300025913 | Ga0207695_10181126 | Ga0207695_101811262 | 214 |
| 419 | 3300025914 | Ga0207671_10042259 | Ga0207671_100422592 | 214 |
| 420 | 3300025914 | Ga0207671_10060807 | Ga0207671_100608072 | 214 |
| 421 | 3300025915 | Ga0207693_10000187 | Ga0207693_1000018723 | 214 |
| 422 | 3300025915 | Ga0207693_10012450 | Ga0207693_100124504 | 214 |
| 423 | 3300025915 | Ga0207693_10020483 | Ga0207693_100204834 | 214 |
| 424 | 3300025916 | Ga0207663_10039723 | Ga0207663_100397232 | 214 |
| 425 | 3300025916 | Ga0207663_10180119 | Ga0207663_101801192 | 214 |
| 426 | 3300025917 | Ga0207660_10015178 | Ga0207660_100151783 | 214 |
| 427 | 3300025917 | Ga0207660_10280497 | Ga0207660_102804972 | 214 |
| 428 | 3300025919 | Ga0207657_10047663 | Ga0207657_100476634 | 214 |
| 429 | 3300025919 | Ga0207657_10540860 | Ga0207657_105408601 | 214 |
| 430 | 3300025920 | Ga0207649_10428252 | Ga0207649_104282521 | 214 |
| 431 | 3300025921 | Ga0207652_10005967 | Ga0207652_100059672 | 214 |
| 432 | 3300025921 | Ga0207652_10009933 | Ga0207652_100099333 | 214 |
| 433 | 3300025924 | Ga0207694_10000545 | Ga0207694_1000054528 | 214 |
| 434 | 3300025924 | Ga0207694_10006193 | Ga0207694_100061932 | 214 |
| 435 | 3300025924 | Ga0207694_10018377 | Ga0207694_100183773 | 214 |
| 436 | 3300025924 | Ga0207694_10024007 | Ga0207694_100240075 | 214 |
| 437 | 3300025924 | Ga0207694_10053086 | Ga0207694_100530862 | 214 |
| 438 | 3300025926 | Ga0207659_10069659 | Ga0207659_100696593 | 214 |
| 439 | 3300025927 | Ga0207687_10004677 | Ga0207687_100046772 | 214 |
| 440 | 3300025927 | Ga0207687_10096701 | Ga0207687_100967013 | 214 |
| 441 | 3300025927 | Ga0207687_10114119 | Ga0207687_101141193 | 214 |
| 442 | 3300025927 | Ga0207687_10147137 | Ga0207687_101471372 | 214 |
| 443 | 3300025928 | Ga0207700_10421456 | Ga0207700_104214562 | 214 |
| 444 | 3300025929 | Ga0207664_10696174 | Ga0207664_106961741 | 214 |
| 445 | 3300025931 | Ga0207644_10045343 | Ga0207644_100453431 | 214 |
| 446 | 3300025933 | Ga0207706_10092503 | Ga0207706_100925032 | 214 |
| 447 | 3300025934 | Ga0207686_10006947 | Ga0207686_100069473 | 214 |
| 448 | 3300025934 | Ga0207686_10020281 | Ga0207686_100202813 | 214 |
| 449 | 3300025934 | Ga0207686_10057549 | Ga0207686_100575494 | 214 |
| 450 | 3300025934 | Ga0207686_10533698 | Ga0207686_105336982 | 214 |
| 451 | 3300025935 | Ga0207709_10004912 | Ga0207709_100049125 | 214 |
| 452 | 3300025935 | Ga0207709_10109909 | Ga0207709_101099092 | 214 |
| 453 | 3300025936 | Ga0207670_10356275 | Ga0207670_103562752 | 214 |
| 454 | 3300025937 | Ga0207669_10288569 | Ga0207669_102885692 | 214 |
| 455 | 3300025939 | Ga0207665_10001360 | Ga0207665_100013607 | 214 |
| 456 | 3300025941 | Ga0207711_10001263 | Ga0207711_1000126310 | 214 |
| 457 | 3300025941 | Ga0207711_10018860 | Ga0207711_100188605 | 214 |
| 458 | 3300025941 | Ga0207711_10063146 | Ga0207711_100631462 | 214 |
| 459 | 3300025941 | Ga0207711_10162091 | Ga0207711_101620912 | 214 |
| 460 | 3300025942 | Ga0207689_10145563 | Ga0207689_101455632 | 214 |
| 461 | 3300025942 | Ga0207689_10179387 | Ga0207689_101793872 | 214 |
| 462 | 3300025942 | Ga0207689_10303167 | Ga0207689_103031672 | 214 |
| 463 | 3300025942 | Ga0207689_10618072 | Ga0207689_106180721 | 214 |
| 464 | 3300025944 | Ga0207661_10012672 | Ga0207661_100126727 | 214 |
| 465 | 3300025944 | Ga0207661_10026842 | Ga0207661_100268423 | 214 |
| 466 | 3300025944 | Ga0207661_10101200 | Ga0207661_101012002 | 214 |
| 467 | 3300025944 | Ga0207661_10128582 | Ga0207661_101285822 | 214 |
| 468 | 3300025944 | Ga0207661_10195276 | Ga0207661_101952761 | 214 |
| 469 | 3300025944 | Ga0207661_10744324 | Ga0207661_107443242 | 214 |
| 470 | 3300025945 | Ga0207679_10617753 | Ga0207679_106177532 | 214 |
| 471 | 3300025949 | Ga0207667_10000322 | Ga0207667_1000032237 | 214 |
| 472 | 3300025949 | Ga0207667_10030375 | Ga0207667_100303758 | 214 |
| 473 | 3300025949 | Ga0207667_10176447 | Ga0207667_101764472 | 214 |
| 474 | 3300025949 | Ga0207667_10666148 | Ga0207667_106661481 | 214 |
| 475 | 3300025960 | Ga0207651_10054764 | Ga0207651_100547642 | 214 |
| 476 | 3300025960 | Ga0207651_10410067 | Ga0207651_104100671 | 214 |
| 477 | 3300025961 | Ga0207712_10060408 | Ga0207712_100604082 | 214 |
| 478 | 3300025961 | Ga0207712_10500148 | Ga0207712_105001482 | 214 |
| 479 | 3300025981 | Ga0207640_10262427 | Ga0207640_102624272 | 214 |
| 480 | 3300025986 | Ga0207658_10234417 | Ga0207658_102344172 | 214 |
| 481 | 3300026023 | Ga0207677_10456619 | Ga0207677_104566192 | 214 |
| 482 | 3300026035 | Ga0207703_10023134 | Ga0207703_100231342 | 214 |
| 483 | 3300026035 | Ga0207703_10046850 | Ga0207703_100468505 | 214 |
| 484 | 3300026035 | Ga0207703_10055839 | Ga0207703_100558392 | 214 |
| 485 | 3300026035 | Ga0207703_10077462 | Ga0207703_100774623 | 214 |
| 486 | 3300026035 | Ga0207703_10116212 | Ga0207703_101162121 | 214 |
| 487 | 3300026041 | Ga0207639_10055457 | Ga0207639_100554573 | 214 |
| 488 | 3300026041 | Ga0207639_10061393 | Ga0207639_100613932 | 214 |
| 489 | 3300026041 | Ga0207639_10644942 | Ga0207639_106449421 | 214 |
| 490 | 3300026078 | Ga0207702_10001895 | Ga0207702_100018957 | 214 |
| 491 | 3300026078 | Ga0207702_10061034 | Ga0207702_100610342 | 214 |
| 492 | 3300026078 | Ga0207702_10355599 | Ga0207702_103555992 | 214 |
| 493 | 3300026088 | Ga0207641_10144934 | Ga0207641_101449343 | 214 |
| 494 | 3300026088 | Ga0207641_10295845 | Ga0207641_102958452 | 214 |
| 495 | 3300026089 | Ga0207648_10016334 | Ga0207648_100163346 | 214 |
| 496 | 3300026095 | Ga0207676_10211464 | Ga0207676_102114642 | 214 |
| 497 | 3300026095 | Ga0207676_10341431 | Ga0207676_103414312 | 214 |
| 498 | 3300026116 | Ga0207674_10000350 | Ga0207674_1000035025 | 214 |
| 499 | 3300026116 | Ga0207674_10008397 | Ga0207674_1000839712 | 214 |
| 500 | 3300026116 | Ga0207674_10215474 | Ga0207674_102154743 | 214 |
| 501 | 3300026118 | Ga0207675_100041628 | Ga0207675_1000416283 | 214 |
| 502 | 3300026118 | Ga0207675_100766752 | Ga0207675_1007667522 | 214 |
| 503 | 3300026142 | Ga0207698_10002809 | Ga0207698_100028097 | 214 |
| 504 | 3300026142 | Ga0207698_10135643 | Ga0207698_101356432 | 214 |
| 505 | 3300027907 | Ga0207428_10011746 | Ga0207428_100117463 | 214 |
| 506 | 3300027907 | Ga0207428_10019602 | Ga0207428_100196025 | 214 |
| 507 | 3300028379 | Ga0268266_10002662 | Ga0268266_100026625 | 214 |
| 508 | 3300028379 | Ga0268266_10627155 | Ga0268266_106271552 | 214 |
| 509 | 3300028380 | Ga0268265_10031658 | Ga0268265_100316582 | 214 |
| 510 | 3300028380 | Ga0268265_10110565 | Ga0268265_101105652 | 214 |
| 511 | 3300028381 | Ga0268264_10461161 | Ga0268264_104611612 | 214 |
| 512 | 3300028800 | Ga0265338_10066134 | Ga0265338_100661342 | 214 |
| 513 | 3300030083 | Ga0237817_10064 | Ga0237817_1006418 | 214 |
| 514 | 3300030500 | Ga0268256_1005862 | Ga0268256_10058624 | 214 |
| 515 | 3300031240 | Ga0265320_10012925 | Ga0265320_100129254 | 214 |
| 516 | 3300031251 | Ga0265327_10070510 | Ga0265327_100705101 | 214 |
| 517 | 3300031548 | Ga0307408_100035921 | Ga0307408_1000359213 | 214 |
| 518 | 3300031595 | Ga0265313_10011168 | Ga0265313_100111688 | 214 |
| 519 | 3300031665 | Ga0316575_10003764 | Ga0316575_100037645 | 214 |
| 520 | 3300031665 | Ga0316575_10024198 | Ga0316575_100241983 | 214 |
| 521 | 3300031711 | Ga0265314_10011222 | Ga0265314_100112225 | 214 |
| 522 | 3300031727 | Ga0316576_10039421 | Ga0316576_100394214 | 214 |
| 523 | 3300031727 | Ga0316576_10100611 | Ga0316576_101006112 | 214 |
| 524 | 3300031728 | Ga0316578_10049089 | Ga0316578_100490892 | 214 |
| 525 | 3300031728 | Ga0316578_10274690 | Ga0316578_102746901 | 214 |
| 526 | 3300031733 | Ga0316577_10004002 | Ga0316577_100040026 | 214 |
| 527 | 3300031733 | Ga0316577_10038292 | Ga0316577_100382924 | 214 |
| 528 | 3300031852 | Ga0307410_10054611 | Ga0307410_100546113 | 214 |
| 529 | 3300031852 | Ga0307410_10355537 | Ga0307410_103555372 | 214 |
| 530 | 3300032002 | Ga0307416_100490958 | Ga0307416_1004909581 | 214 |
| 531 | 3300032002 | Ga0307416_100493374 | Ga0307416_1004933742 | 214 |
| 532 | 3300032005 | Ga0307411_10303630 | Ga0307411_103036302 | 214 |
| 533 | 3300032133 | Ga0316583_10000274 | Ga0316583_1000027411 | 214 |
| 534 | 3300032133 | Ga0316583_10000560 | Ga0316583_100005603 | 214 |
| 535 | 3300032133 | Ga0316583_10033001 | Ga0316583_100330011 | 214 |
| 536 | 3300032133 | Ga0316583_10084614 | Ga0316583_100846141 | 214 |
| 537 | 3300032139 | Ga0316580_10026637 | Ga0316580_100266372 | 214 |
| 538 | 3300035084 | Ga0373928_0002459 | Ga0373928_0002459_1688_2353 | 214 |
| 539 | 3300035086 | Ga0373934_0004823 | Ga0373934_0004823_3936_4628 | 214 |
| 540 | 3300035086 | Ga0373934_0028363 | Ga0373934_0028363_1105_1779 | 214 |
| 541 | 3300035111 | Ga0373923_0039399 | Ga0373923_0039399_1140_1832 | 214 |
| 542 | 3300035112 | Ga0373932_0013385 | Ga0373932_0013385_283_948 | 214 |
| 543 | 3300035117 | Ga0373953_0017659 | Ga0373953_0017659_583_1275 | 214 |
| 544 | 3300035117 | Ga0373953_0168681 | Ga0373953_0168681_116_790 | 214 |
| 545 | 3300035118 | Ga0373954_0033937 | Ga0373954_0033937_1427_2119 | 214 |
| 546 | 3300035119 | Ga0373956_0075611 | Ga0373956_0075611_467_1159 | 214 |
| 547 | 3300035120 | Ga0373957_0055352 | Ga0373957_0055352_450_1142 | 214 |
| 548 | 3300035172 | Ga0373955_0172783 | Ga0373955_0172783_20_694 | 214 |
| 549 | 3300035172 | Ga0373955_0397501 | Ga0373955_0397501_47_739 | 214 |
| 550 | 3300035398 | Ga0316574_0001779 | Ga0316574_0001779_2955_3611 | 214 |
| 551 | 3300035692 | Ga0373935_0212804 | Ga0373935_0212804_368_1060 | 214 |
| 552 | 3300035724 | Ga0373933_0020180 | Ga0373933_0020180_187_879 | 214 |
| 553 | 3300035724 | Ga0373933_0195727 | Ga0373933_0195727_225_899 | 214 |
| 554 | 3300035725 | Ga0373947_0074466 | Ga0373947_0074466_912_1586 | 214 |
| 555 | 3300036401 | Ga0373937_0028222 | Ga0373937_0028222_1744_2418 | 214 |
| 556 | 3300036401 | Ga0373937_0100194 | Ga0373937_0100194_1772_2464 | 214 |
| 557 | 3300036401 | Ga0373937_0110421 | Ga0373937_0110421_1252_1944 | 214 |
| 558 | 3300036401 | Ga0373937_0116026 | Ga0373937_0116026_1079_1795 | 214 |
| 559 | 3300036401 | Ga0373937_0308972 | Ga0373937_0308972_259_933 | 214 |
| 560 | 3300036647 | Ga0316582_0026331 | Ga0316582_0026331_392_1048 | 214 |
| 561 | 3300036712 | Ga0316584_0031977 | Ga0316584_0031977_902_1552 | 214 |
| 562 | 3300036712 | Ga0316584_0155297 | Ga0316584_0155297_112_768 | 214 |
| 563 | 3300036712 | Ga0316584_0217793 | Ga0316584_0217793_183_839 | 214 |
| 564 | 3300037068 | Ga0373925_0524231 | Ga0373925_0524231_173_847 | 214 |
| 565 | 3300037068 | Ga0373925_0650746 | Ga0373925_0650746_154_828 | 214 |
| 566 | 3300037471 | Ga0395905_0046662 | Ga0395905_0046662_38_796 | 214 |
| 567 | 3300037588 | Ga0316581_0006044 | Ga0316581_0006044_2375_3046 | 214 |
| 568 | 3300038705 | Ga0237819_00110 | Ga0237819_00110_12107_12751 | 214 |
| 569 | 3300042876 | Ga0451577_0000241 | Ga0451577_0000241_15445_16119 | 214 |
| 570 | 3300042876 | Ga0451577_0039495 | Ga0451577_0039495_318_983 | 214 |
| 571 | 3300042876 | Ga0451577_0043115 | Ga0451577_0043115_3005_3679 | 214 |
| 572 | 3300042876 | Ga0451577_0132601 | Ga0451577_0132601_733_1404 | 214 |
| 573 | 3300042876 | Ga0451577_0152727 | Ga0451577_0152727_1258_1932 | 214 |
| 574 | 3300044673 | Ga0453683_0010518 | Ga0453683_0010518_2881_3567 | 214 |
| 575 | 3300044673 | Ga0453683_0030579 | Ga0453683_0030579_95_769 | 214 |
| 576 | 3300044673 | Ga0453683_0196294 | Ga0453683_0196294_548_1222 | 214 |
| 577 | 3300044694 | Ga0466963_0572464 | Ga0466963_0572464_59_748 | 214 |
| 578 | 3300044712 | Ga0453684_0000366 | Ga0453684_0000366_165246_165920 | 214 |
| 579 | 3300044712 | Ga0453684_0013557 | Ga0453684_0013557_657_1307 | 214 |
| 580 | 3300044712 | Ga0453684_0272620 | Ga0453684_0272620_1109_1795 | 214 |
| 581 | 3300044712 | Ga0453684_0309482 | Ga0453684_0309482_985_1656 | 214 |
| 582 | 3300044712 | Ga0453684_0635008 | Ga0453684_0635008_282_956 | 214 |
| 583 | 3300045051 | Ga0451576_0000138 | Ga0451576_0000138_73497_74162 | 214 |
| 584 | 3300045051 | Ga0451576_0005856 | Ga0451576_0005856_8946_9620 | 214 |
| 585 | 3300045051 | Ga0451576_0098529 | Ga0451576_0098529_589_1263 | 214 |
| 586 | 3300045051 | Ga0451576_0346470 | Ga0451576_0346470_490_1164 | 214 |
| 587 | 3300045051 | Ga0451576_0576249 | Ga0451576_0576249_168_842 | 214 |
| 588 | 3300045976 | Ga0466967_0000014 | Ga0466967_0000014_37087_37731 | 214 |
| 589 | 3300045976 | Ga0466967_0005146 | Ga0466967_0005146_1297_1971 | 214 |
| 590 | 3300045976 | Ga0466967_0113279 | Ga0466967_0113279_1341_2015 | 214 |
| 591 | 3300045976 | Ga0466967_0158880 | Ga0466967_0158880_288_1070 | 214 |
| 592 | 3300045976 | Ga0466967_0948172 | Ga0466967_0948172_119_793 | 214 |
| 593 | 3300046455 | Ga0495603_0095625 | Ga0495603_0095625_885_1559 | 214 |
| 594 | 3300046455 | Ga0495603_0245693 | Ga0495603_0245693_31_687 | 214 |
| 595 | 3300046462 | Ga0495651_0047803 | Ga0495651_0047803_1493_2167 | 214 |
| 596 | 3300046462 | Ga0495651_0077715 | Ga0495651_0077715_404_1096 | 214 |
| 597 | 3300046472 | Ga0495580_0127040 | Ga0495580_0127040_1065_1739 | 214 |
| 598 | 3300046473 | Ga0495582_0004318 | Ga0495582_0004318_2873_3547 | 214 |
| 599 | 3300046473 | Ga0495582_0014794 | Ga0495582_0014794_2712_3428 | 214 |
| 600 | 3300046474 | Ga0495605_0077786 | Ga0495605_0077786_344_1000 | 214 |
| 601 | 3300046474 | Ga0495605_0080546 | Ga0495605_0080546_399_1073 | 214 |
| 602 | 3300046477 | Ga0495664_0076901 | Ga0495664_0076901_68_742 | 214 |
| 603 | 3300046491 | Ga0495584_0014741 | Ga0495584_0014741_3298_3954 | 214 |
| 604 | 3300046492 | Ga0495585_0036363 | Ga0495585_0036363_1513_2169 | 214 |
| 605 | 3300046499 | Ga0495594_0053576 | Ga0495594_0053576_1287_1961 | 214 |
| 606 | 3300046516 | Ga0495628_0416205 | Ga0495628_0416205_257_931 | 214 |
| 607 | 3300046529 | Ga0495652_0014290 | Ga0495652_0014290_2423_3097 | 214 |
| 608 | 3300046531 | Ga0495665_0026826 | Ga0495665_0026826_2337_3053 | 214 |
| 609 | 3300046535 | Ga0495586_0044955 | Ga0495586_0044955_274_948 | 214 |
| 610 | 3300046536 | Ga0495587_0005456 | Ga0495587_0005456_1545_2219 | 214 |
| 611 | 3300046536 | Ga0495587_0109951 | Ga0495587_0109951_358_1032 | 214 |
| 612 | 3300046536 | Ga0495587_0157970 | Ga0495587_0157970_342_1034 | 214 |
| 613 | 3300046539 | Ga0495621_0111627 | Ga0495621_0111627_288_974 | 214 |
| 614 | 3300046543 | Ga0495645_0009695 | Ga0495645_0009695_3734_4408 | 214 |
| 615 | 3300046559 | Ga0495667_0035399 | Ga0495667_0035399_1536_2210 | 214 |
| 616 | 3300046615 | Ga0495656_0052955 | Ga0495656_0052955_509_1189 | 214 |
| 617 | 3300046674 | Ga0495588_0117258 | Ga0495588_0117258_564_1280 | 214 |
| 618 | 3300046678 | Ga0495599_0000343 | Ga0495599_0000343_25081_25755 | 214 |
| 619 | 3300046679 | Ga0495623_0066892 | Ga0495623_0066892_375_1049 | 214 |
| 620 | 3300046679 | Ga0495623_0074015 | Ga0495623_0074015_420_1094 | 214 |
| 621 | 3300046684 | Ga0495669_0009653 | Ga0495669_0009653_730_1404 | 214 |
| 622 | 3300046684 | Ga0495669_0029100 | Ga0495669_0029100_1143_1823 | 214 |
| 623 | 3300046684 | Ga0495669_0061916 | Ga0495669_0061916_932_1612 | 214 |
| 624 | 3300046684 | Ga0495669_0107071 | Ga0495669_0107071_431_1105 | 214 |
| 625 | 3300046689 | Ga0495613_0134083 | Ga0495613_0134083_355_1047 | 214 |
| 626 | 3300046689 | Ga0495613_0420195 | Ga0495613_0420195_52_726 | 214 |
| 627 | 3300046794 | Ga0495589_0171192 | Ga0495589_0171192_73_729 | 214 |
| 628 | 3300046809 | Ga0495600_0176426 | Ga0495600_0176426_406_1080 | 214 |
| 629 | 3300046809 | Ga0495600_0265862 | Ga0495600_0265862_85_777 | 214 |
| 630 | 3300047317 | Ga0495604_0066714 | Ga0495604_0066714_1309_1983 | 214 |
| 631 | 3300047321 | Ga0495676_0058211 | Ga0495676_0058211_2170_2826 | 214 |
| 632 | 3300047323 | Ga0495683_0180603 | Ga0495683_0180603_53_709 | 214 |
| 633 | 3300047444 | Ga0495675_0012462 | Ga0495675_0012462_1428_2102 | 214 |
| 634 | 3300047444 | Ga0495675_0025880 | Ga0495675_0025880_805_1479 | 214 |
| 635 | 3300047444 | Ga0495675_0297709 | Ga0495675_0297709_39_713 | 214 |
| 636 | 3300047445 | Ga0495677_0021330 | Ga0495677_0021330_800_1474 | 214 |
| 637 | 3300047447 | Ga0495685_124043 | Ga0495685_124043_151_825 | 214 |
| 638 | 3300047471 | Ga0495684_0002760 | Ga0495684_0002760_10615_11307 | 214 |
| 639 | 3300048088 | Ga0495602_0211814 | Ga0495602_0211814_227_919 | 214 |
| 640 | 3300048903 | Ga0496100_0000498 | Ga0496100_0000498_15998_16654 | 214 |
| 641 | 3300048904 | Ga0496101_0000571 | Ga0496101_0000571_6025_6681 | 214 |
| 642 | 3300048905 | Ga0496102_0002229 | Ga0496102_0002229_2887_3543 | 214 |
| 643 | 3300048905 | Ga0496102_0543397 | Ga0496102_0543397_97_771 | 214 |
| 644 | 3300048906 | Ga0496103_0000697 | Ga0496103_0000697_21294_21950 | 214 |
| 645 | 3300048907 | Ga0496104_0030123 | Ga0496104_0030123_2491_3147 | 214 |
| 646 | 3300048907 | Ga0496104_0353665 | Ga0496104_0353665_341_1015 | 214 |
| 647 | 3300048908 | Ga0496105_0001675 | Ga0496105_0001675_9333_9989 | 214 |
| 648 | 3300048909 | Ga0496106_0000192 | Ga0496106_0000192_39628_40284 | 214 |
| 649 | 3300048910 | Ga0496107_0000406 | Ga0496107_0000406_1346_2002 | 214 |
| 650 | 3300048911 | Ga0496108_0000290 | Ga0496108_0000290_5490_6146 | 214 |
| 651 | 3300048912 | Ga0496109_0001566 | Ga0496109_0001566_784_1440 | 214 |
| 652 | 3300048913 | Ga0496110_0000108 | Ga0496110_0000108_19688_20338 | 214 |
| 653 | 3300048913 | Ga0496110_0001866 | Ga0496110_0001866_2887_3543 | 214 |
| 654 | 3300048913 | Ga0496110_0257991 | Ga0496110_0257991_346_990 | 214 |
| 655 | 3300048914 | Ga0496111_0000587 | Ga0496111_0000587_15998_16654 | 214 |
| 656 | 3300048915 | Ga0496112_0001734 | Ga0496112_0001734_2887_3543 | 214 |
| 657 | 3300048915 | Ga0496112_0255072 | Ga0496112_0255072_214_888 | 214 |
| 658 | 3300048916 | Ga0496113_0065573 | Ga0496113_0065573_1204_1878 | 214 |
| 659 | 3300048918 | Ga0496115_0082454 | Ga0496115_0082454_875_1555 | 214 |
| 660 | 3300048918 | Ga0496115_0136994 | Ga0496115_0136994_664_1347 | 214 |
| 661 | 3300048919 | Ga0496116_0002109 | Ga0496116_0002109_14130_14798 | 214 |
| 662 | 3300048919 | Ga0496116_0006026 | Ga0496116_0006026_4474_5130 | 214 |
| 663 | 3300048919 | Ga0496116_0057934 | Ga0496116_0057934_1719_2402 | 214 |
| 664 | 3300048920 | Ga0496117_0065254 | Ga0496117_0065254_1747_2415 | 214 |
| 665 | 3300048920 | Ga0496117_0081889 | Ga0496117_0081889_638_1294 | 214 |
| 666 | 3300048920 | Ga0496117_0238440 | Ga0496117_0238440_31_717 | 214 |
| 667 | 3300048922 | Ga0496119_0000166 | Ga0496119_0000166_27552_28220 | 214 |
| 668 | 3300048922 | Ga0496119_0002606 | Ga0496119_0002606_2857_3513 | 214 |
| 669 | 3300048923 | Ga0496120_0000406 | Ga0496120_0000406_65082_65750 | 214 |
| 670 | 3300048923 | Ga0496120_0169544 | Ga0496120_0169544_240_896 | 214 |
| 671 | 3300048925 | Ga0496122_0008068 | Ga0496122_0008068_9446_10102 | 214 |
| 672 | 3300048925 | Ga0496122_0029071 | Ga0496122_0029071_3954_4622 | 214 |
| 673 | 3300048925 | Ga0496122_0073114 | Ga0496122_0073114_1464_2132 | 214 |
| 674 | 3300048925 | Ga0496122_0142246 | Ga0496122_0142246_391_1074 | 214 |
| 675 | 3300048926 | Ga0496123_0200478 | Ga0496123_0200478_139_807 | 214 |
| 676 | 3300048927 | Ga0496124_0000748 | Ga0496124_0000748_29340_30008 | 214 |
| 677 | 3300048927 | Ga0496124_0200152 | Ga0496124_0200152_396_1052 | 214 |
| 678 | 3300048928 | Ga0496125_0018356 | Ga0496125_0018356_3741_4397 | 214 |
| 679 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_783121_783807 | 214 |
| 680 | 3300048929 | Ga0496126_0002339 | Ga0496126_0002339_86_742 | 214 |
| 681 | 3300048929 | Ga0496126_0020601 | Ga0496126_0020601_971_1639 | 214 |
| 682 | 3300048929 | Ga0496126_0024562 | Ga0496126_0024562_4826_5494 | 214 |
| 683 | 3300049574 | Ga0501038_0404691 | Ga0501038_0404691_176_847 | 214 |
| 684 | 3300049577 | Ga0501041_0054308 | Ga0501041_0054308_713_1384 | 214 |
| 685 | 3300049578 | Ga0501042_0023694 | Ga0501042_0023694_1515_2186 | 214 |
| 686 | 3300049582 | Ga0501048_0195348 | Ga0501048_0195348_46_717 | 214 |
| 687 | 3300049583 | Ga0501067_0060736 | Ga0501067_0060736_547_1221 | 214 |
| 688 | 3300049589 | Ga0501073_0004269 | Ga0501073_0004269_6645_7319 | 214 |
| 689 | 3300049589 | Ga0501073_0036396 | Ga0501073_0036396_1222_1974 | 214 |
| 690 | 3300049589 | Ga0501073_0067110 | Ga0501073_0067110_278_949 | 214 |
| 691 | 3300049590 | Ga0501074_0059424 | Ga0501074_0059424_739_1440 | 214 |
| 692 | 3300049591 | Ga0501075_0033309 | Ga0501075_0033309_2732_3403 | 214 |
| 693 | 3300049591 | Ga0501075_0629376 | Ga0501075_0629376_19_720 | 214 |
| 694 | 3300049592 | Ga0501076_0064479 | Ga0501076_0064479_51_722 | 214 |
| 695 | 3300049592 | Ga0501076_0167765 | Ga0501076_0167765_309_1010 | 214 |
| 696 | 3300049592 | Ga0501076_0337170 | Ga0501076_0337170_204_860 | 214 |
| 697 | 3300049742 | Ga0501080_0111404 | Ga0501080_0111404_457_1128 | 214 |
| 698 | 3300049742 | Ga0501080_0265592 | Ga0501080_0265592_42_743 | 214 |
| 699 | 3300049743 | Ga0501081_0142666 | Ga0501081_0142666_131_802 | 214 |
| 700 | 3300049824 | Ga0501045_0012697 | Ga0501045_0012697_3299_3970 | 214 |
| 701 | 3300050491 | nmdc:mga00v17_49926_c1 | nmdc:mga00v17_49926_c1_376_1056 | 214 |
| 702 | 3300050507 | nmdc:mga05p37_24128_c1 | nmdc:mga05p37_24128_c1_2937_3611 | 214 |
| 703 | 3300050507 | nmdc:mga05p37_253602_c1 | nmdc:mga05p37_253602_c1_1269_1943 | 214 |
| 704 | 3300050510 | nmdc:mga06r32_117824_c1 | nmdc:mga06r32_117824_c1_914_1597 | 214 |
| 705 | 3300050511 | nmdc:mga08y16_173730_c1 | nmdc:mga08y16_173730_c1_101_784 | 214 |
| 706 | 3300050511 | nmdc:mga08y16_18169_c1 | nmdc:mga08y16_18169_c1_4954_5637 | 214 |
| 707 | 3300050511 | nmdc:mga08y16_8741_c1 | nmdc:mga08y16_8741_c1_3147_3833 | 214 |
| 708 | 3300050512 | nmdc:mga0n895_187168_c1 | nmdc:mga0n895_187168_c1_42_722 | 214 |
| 709 | 3300050513 | nmdc:mga0rr50_293762_c1 | nmdc:mga0rr50_293762_c1_102_776 | 214 |
| 710 | 3300050515 | nmdc:mga0a205_328794_c1 | nmdc:mga0a205_328794_c1_286_966 | 214 |
| 711 | 3300050515 | nmdc:mga0a205_470_c1 | nmdc:mga0a205_470_c1_14680_15354 | 214 |
| 712 | 3300054114 | Ga0501084_0075701 | Ga0501084_0075701_549_1223 | 214 |
| 713 | 3300054114 | Ga0501084_0083136 | Ga0501084_0083136_632_1333 | 214 |
| 714 | 3300059492 | Ga0587073_0006030 | Ga0587073_0006030_885_1559 | 214 |
| 715 | 3300059512 | Ga0587092_022268 | Ga0587092_022268_260_934 | 214 |
| 716 | 3300060353 | Ga0501082_0059687 | Ga0501082_0059687_2522_3223 | 214 |
| 717 | 3300060353 | Ga0501082_0090722 | Ga0501082_0090722_686_1357 | 214 |
| 718 | 3300060353 | Ga0501082_0098401 | Ga0501082_0098401_1249_1905 | 214 |
| 719 | 3300060353 | Ga0501082_0211932 | Ga0501082_0211932_24_776 | 214 |
| 720 | iso_pu_bacteria | 2831905167 | 2831906955 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rpx-assembly1.cif.gz_A | d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts | 0.9787 | 2 | 213 |
| 1tqj-assembly1.cif.gz_B | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9782 | 2 | 214 |
| 1tqj-assembly1.cif.gz_F | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9767 | 2 | 213 |
| 1tqj-assembly1.cif.gz_D | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9763 | 2 | 214 |
| 1tqj-assembly1.cif.gz_E | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9762 | 2 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9763 | 2 | 214 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9731 | 1 | 213 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9709 | 1 | 213 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9691 | 1 | 213 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9642 | 1 | 213 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T5V3H4-F1-model_v4 | deleted | 0.9894 | 1 | 214 |
|
| AF-A0A7C7ZVP7-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.984 | 1 | 213 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1G8AT52-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9838 | 1 | 213 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1G6NA90-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9838 | 1 | 213 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A0K0G810-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9836 | 1 | 212 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar