F477331

General Info

Members Datasets Scaffolds Average Seq Length
720 477 1441 221

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0029609|Ga0496121_0029609_3883_4614
Length 243
Sequence MATTIMDTTMIITIPTTDSTLPEGGDLQALLRLMAWLSPAFPVGSFAYSGGLERAVHDGLVGDAAGLGEWISTLLRHGTAWNDAVLAAEAHRAFDDAAQLADVAELAEALAGSRERHQETMLLGEAFLSVAAAWPHPVFSLLSPKTAYPVAVGAVAGGHRIGCEKMLAAFLHALVSQAVSSGIRLGVAGQKDGVAILARLEVDISDIARRASRSSLDDLGSATVQADIASVRHETQATRLFRS

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
112 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
113 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
211 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
218 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
230 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
231 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
232 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
233 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
234 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
235 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
236 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
237 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
238 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
239 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
240 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
241 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
242 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
243 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
244 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
245 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
246 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
247 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
248 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
249 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
250 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
251 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
252 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
253 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
254 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
255 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
256 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
257 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
258 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
259 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
260 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
261 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
262 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
263 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
264 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
265 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
266 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
267 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
268 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
269 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
270 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
271 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
272 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
273 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
274 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
275 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
276 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
277 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
278 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
279 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
280 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
281 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
282 2643221568 Rhizobium sp. Root564 Isolate Unclassified
283 2643221582 Rhizobium sp. Root651 Isolate Unclassified
284 2643221599 Rhizobium sp. Root708 Isolate Unclassified
285 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
286 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
287 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
288 2718217882 Rhizobium sp. N741 Isolate Nodule
289 2718217927 Rhizobium sp. N324 Isolate Nodule
290 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
291 2718218009 Rhizobium sp. N561 Isolate Nodule
292 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
293 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
294 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
295 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
296 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
297 2718218363 Rhizobium sp. N113 Isolate Nodule
298 2718218365 Rhizobium sp. N731 Isolate Nodule
299 2718218366 Rhizobium sp. N621 Isolate Nodule
300 2718218423 Rhizobium sp. N941 Isolate Nodule
301 2721755514 Rhizobium sp. N6212 Isolate Nodule
302 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
303 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
304 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
305 2721755809 Rhizobium sp. N541 Isolate Nodule
306 2721755810 Rhizobium sp. N871 Isolate Nodule
307 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
308 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
309 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
310 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
311 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
312 2728369365 Rhizobium sp. N1341 Isolate Nodule
313 2728369397 Rhizobium sp. N1314 Isolate Nodule
314 2738541293 Rhizobium sp. GV031 Isolate Unclassified
315 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
316 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
317 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
318 2791355256 Rhizobium sp. M10 Isolate Nodule
319 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
320 2791355260 Rhizobium sp. L9 Isolate Nodule
321 2791355261 Rhizobium sp. J15 Isolate Nodule
322 2791355262 Rhizobium sp. M1 Isolate Nodule
323 2791355263 Rhizobium chutanense C5 Isolate Nodule
324 2791355264 Rhizobium sp. S9 Isolate Nodule
325 2791355265 Rhizobium sp. H4 Isolate Nodule
326 2791355266 Rhizobium sp. L43 Isolate Nodule
327 2791355267 Rhizobium sp. L18 Isolate Nodule
328 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
329 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
330 2802429633 Rhizobium anhuiense J3 Isolate Nodule
331 2802429634 Rhizobium anhuiense S10 Isolate Nodule
332 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
333 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
334 2802429637 Rhizobium anhuiense C15 Isolate Nodule
335 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
336 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
337 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
338 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
339 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
340 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
341 2838048938 Rhizobium pisi 27/80 Isolate Nodule
342 2838061910 Rhizobium phaseoli L15 Isolate Nodule
343 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
344 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
345 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
346 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
347 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
348 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
349 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
350 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
351 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
352 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
353 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
354 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
355 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
356 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
357 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
358 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
359 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
360 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
361 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
362 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
363 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
364 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
365 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
366 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
367 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
368 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
369 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
370 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
371 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
372 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
373 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
374 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
375 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
376 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
377 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
378 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
379 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
380 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
381 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
382 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
383 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
384 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
385 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
386 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
387 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
388 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
389 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
390 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
391 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
392 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
393 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
394 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
395 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
396 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
397 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
398 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
399 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
400 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
401 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
402 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
403 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
404 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
405 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
406 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
407 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
408 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
409 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
410 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
411 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
412 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
413 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
414 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
415 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
416 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
417 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
418 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
419 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
420 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
421 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
422 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
423 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
424 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
425 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
426 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
427 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
428 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
429 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
430 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
431 2933599457 Rhizobium phaseoli M3 Isolate Nodule
432 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
433 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
434 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
435 2936381700 Rhizobium chutanense C16 Isolate Unclassified
436 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
437 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
438 2996887358 Rhizobium sp. R711 Isolate Nodule
439 2996893221 Rhizobium sp. R635 Isolate Nodule
440 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
441 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
442 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
443 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
444 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
445 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
446 8005258706 Rhizobium sp. R693 Isolate Nodule
447 8005275841 Rhizobium sp. N4311 Isolate Nodule
448 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
449 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
450 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
451 8005321885 Rhizobium sp. R72 Isolate Nodule
452 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
453 8005382845 Rhizobium sp. R634 Isolate Nodule
454 8005395548 Rhizobium sp. R339 Isolate Nodule
455 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
456 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
457 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
458 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
459 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
460 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
461 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
462 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
463 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
464 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
465 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
466 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
467 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
468 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
469 8018176218 Rhizobium sp. N122 Isolate Nodule
470 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
471 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
472 8024501048 Rhizobium sp. H4 Isolate Nodule
473 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
474 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
475 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
476 8056382006 Rhizobium croatiense 13T Isolate Nodule
477 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.28
Metatranscriptomes 0.28
Isolates 34.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 24.44
Nodule 25.97
Rhizoplane 2.36
Rhizosphere 25.56
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0029609 3300048924 Bacteria 5056
2 JGI24740J21852_10000220 3300001979 Bacteria 24157
3 JGI25155J39150_1000066 3300002704 Bacteria 69429
4 JGI25156J39149_1000075 3300002705 Bacteria 76505
5 JGI25162J39368_1000149 3300002737 Bacteria 76227
6 JGI25154J39366_1000075 3300002738 Bacteria 91249
7 JGI25158J39367_1000924 3300002739 Bacteria 5478
8 JGI25157J39369_1000051 3300002741 Bacteria 111770
9 JGI25157J39369_1000077 3300002741 Bacteria 86251
10 JGI25152J39213_1003477 3300002773 Bacteria 5357
11 JGI25152J39213_1004457 3300002773 Bacteria 4408
12 JGI25152J39213_1005057 3300002773 Bacteria 3969
13 JGI25152J39213_1010756 3300002773 Bacteria 2069
14 JGI25152J39213_1012615 3300002773 Bacteria 1800
15 JGI25152J39213_1019713 3300002773 Bacteria 1220
16 JGI25150J39212_1000091 3300002774 Bacteria 52487
17 JGI25159J45721_1000108 3300002987 Bacteria 39183
18 JGI25159J45721_1009532 3300002987 Bacteria 2554
19 JGI25151J46595_10000027 3300003187 Bacteria 208739
20 JGI25151J46595_10000737 3300003187 Bacteria 26948
21 JGI25151J46595_10002713 3300003187 Bacteria 10338
22 JGI25151J46595_10003152 3300003187 Bacteria 9266
23 JGI25151J46595_10008201 3300003187 Bacteria 5045
24 JGI25165J46597_1000781 3300003214 Bacteria 24238
25 JGI25165J46597_1001844 3300003214 Bacteria 8789
26 JGI25153J46596_10006055 3300003215 Bacteria 6214
27 JGI25153J46596_10025633 3300003215 Bacteria 2103
28 JGI25153J46596_10026205 3300003215 Bacteria 2069
29 JGI25153J46596_10032025 3300003215 Bacteria 1760
30 rootH1_10000491 3300003316 Bacteria 1982
31 rootH1_10000491 3300003323 Bacteria 18631
32 rootH1_10000492 3300003316 Bacteria 2697
33 rootH2_10065851 3300003320 Bacteria 1438
34 rootL2_10069708 3300003322 Bacteria 6238
35 rootH1_10089023 3300003323 Bacteria 1182
36 rootH1_10147282 3300003323 Bacteria 3621
37 JGI25160J50197_1000001 3300003354 Bacteria 782301
38 JGI25160J50197_1000766 3300003354 Bacteria 17317
39 JGI25160J50197_1005979 3300003354 Bacteria 4994
40 JGI25160J50197_1042491 3300003354 Bacteria 1033
41 JGI25160J50197_1042520 3300003354 Bacteria 1033
42 JGI25161J50226_1000001 3300003374 Bacteria 655036
43 JGI25161J50226_1000163 3300003374 Bacteria 46470
44 JGI25161J50226_1001467 3300003374 Bacteria 7059
45 Ga0006562J51391_1161272 3300003578 Bacteria 810
46 Ga0055526_1001847 3300003771 Bacteria 14659
47 Ga0055526_1003775 3300003771 Bacteria 9445
48 Ga0055524_1001962 3300003775 Bacteria 11047
49 Ga0055524_1002479 3300003775 Bacteria 9480
50 Ga0055524_1006370 3300003775 Bacteria 5121
51 Ga0055524_1016289 3300003775 Bacteria 2673
52 Ga0055528_1001291 3300003790 Bacteria 15733
53 Ga0055528_1001315 3300003790 Bacteria 15543
54 Ga0055528_1004820 3300003790 Bacteria 6416
55 Ga0055540_1000483 3300003792 Bacteria 30602
56 Ga0055540_1007277 3300003792 Bacteria 4216
57 Ga0055540_1009779 3300003792 Bacteria 3268
58 Ga0055540_1012556 3300003792 Bacteria 2649
59 Ga0055543_1000007 3300004625 Bacteria 204042
60 Ga0055543_1000108 3300004625 Bacteria 71519
61 Ga0055543_1000220 3300004625 Bacteria 45860
62 Ga0065165_1000008 3300005262 Bacteria 334429
63 Ga0065165_1010003 3300005262 Bacteria 4169
64 Ga0065165_1045051 3300005262 Bacteria 1287
65 Ga0070670_100006743 3300005331 Bacteria 9734
66 Ga0070663_100095516 3300005455 Bacteria 2210
67 Ga0070665_100071341 3300005548 Bacteria 3480
68 Ga0070665_100363096 3300005548 Bacteria 1454
69 Ga0070665_101046759 3300005548 Bacteria 828
70 Ga0068855_100223595 3300005563 Bacteria 2110
71 Ga0068856_100018348 3300005614 Bacteria 6782
72 Ga0068852_100050243 3300005616 Bacteria 3572
73 Ga0068851_10215264 3300005834 Bacteria 1077
74 Ga0075365_10002545 3300006038 Bacteria 8990
75 Ga0075368_10016715 3300006042 Bacteria 2737
76 Ga0075363_100024716 3300006048 Bacteria 3056
77 Ga0075363_100286327 3300006048 Bacteria 954
78 Ga0075363_100311845 3300006048 Bacteria 914
79 Ga0075362_10001438 3300006177 Bacteria 7606
80 Ga0075367_10019538 3300006178 Bacteria 3758
81 Ga0075369_10013658 3300006186 Bacteria 3230
82 Ga0075369_10105239 3300006186 Bacteria 1268
83 Ga0075369_10132833 3300006186 Bacteria 1132
84 Ga0075366_10008481 3300006195 Bacteria 5716
85 Ga0075370_10000296 3300006353 Bacteria 17852
86 Ga0099826_10000404 3300006948 Bacteria 20366
87 Ga0099826_10010403 3300006948 Bacteria 6968
88 Ga0105244_10225682 3300009036 Bacteria 878
89 Ga0105240_10000014 3300009093 Bacteria 482033
90 Ga0105248_10235320 3300009177 Bacteria 2062
91 Ga0105237_10000685 3300009545 Bacteria 46922
92 Ga0105249_10821368 3300009553 Bacteria 994
93 Ga0123341_1000018 3300009765 Bacteria 81421
94 Ga0123342_1030001 3300009766 Bacteria 2771
95 Ga0105239_10001960 3300010375 Bacteria 26777
96 Ga0157371_10009685 3300013102 Bacteria 7565
97 Ga0157370_10000015 3300013104 Bacteria 185771
98 Ga0157369_10253917 3300013105 Bacteria 1835
99 Ga0157369_10960494 3300013105 Bacteria 876
100 Ga0182007_10001042 3300015262 Bacteria 15186
101 Ga0209435_100005 3300025206 Bacteria 573745
102 Ga0209436_100272 3300025208 Bacteria 23718
103 Ga0209563_108717 3300025230 Bacteria 1581
104 Ga0209437_100058 3300025233 Bacteria 357279
105 Ga0209437_100060 3300025233 Bacteria 355034
106 Ga0207425_1000043 3300025245 Bacteria 208791
107 Ga0207425_1000495 3300025245 Bacteria 24691
108 Ga0207425_1010927 3300025245 Bacteria 2190
109 Ga0207425_1015964 3300025245 Bacteria 1675
110 Ga0207425_1018478 3300025245 Bacteria 1512
111 Ga0209646_1000011 3300025246 Bacteria 573745
112 Ga0209646_1006128 3300025246 Bacteria 2037
113 Ga0209026_1000008 3300025250 Bacteria 573745
114 Ga0209677_100493 3300025253 Bacteria 22233
115 Ga0209148_1005477 3300025254 Bacteria 2905
116 Ga0209759_1000004 3300025256 Bacteria 573745
117 Ga0209759_1026858 3300025256 Bacteria 1199
118 Ga0209129_1000072 3300025258 Bacteria 208805
119 Ga0209129_1000128 3300025258 Bacteria 130420
120 Ga0209129_1000702 3300025258 Bacteria 21824
121 Ga0209129_1000810 3300025258 Bacteria 19737
122 Ga0209129_1001196 3300025258 Bacteria 14949
123 Ga0209129_1001400 3300025258 Bacteria 13490
124 Ga0209233_1000137 3300025261 Bacteria 200314
125 Ga0209233_1000149 3300025261 Bacteria 181183
126 Ga0209233_1000160 3300025261 Bacteria 159035
127 Ga0209673_1000125 3300025273 Bacteria 168465
128 Ga0209673_1000256 3300025273 Bacteria 100514
129 Ga0209673_1001106 3300025273 Bacteria 30133
130 Ga0209673_1001124 3300025273 Bacteria 29604
131 Ga0209673_1003529 3300025273 Bacteria 9154
132 Ga0209673_1003945 3300025273 Bacteria 8289
133 Ga0209130_1000003 3300025284 Bacteria 677988
134 Ga0209130_1000023 3300025284 Bacteria 359355
135 Ga0209130_1018831 3300025284 Bacteria 1613
136 Ga0209130_1026880 3300025284 Bacteria 1229
137 Ga0209675_1037288 3300025291 Bacteria 1094
138 Ga0209676_1017938 3300025292 Bacteria 2484
139 Ga0209676_1023533 3300025292 Bacteria 2014
140 Ga0209025_1000120 3300025294 Bacteria 208791
141 Ga0209025_1000154 3300025294 Bacteria 170288
142 Ga0209025_1000451 3300025294 Bacteria 80470
143 Ga0209025_1000537 3300025294 Bacteria 71838
144 Ga0209025_1001251 3300025294 Bacteria 35202
145 Ga0209025_1004713 3300025294 Bacteria 11638
146 Ga0209025_1009663 3300025294 Bacteria 6675
147 Ga0209025_1010434 3300025294 Bacteria 6292
148 Ga0209025_1107509 3300025294 Unclassified 865
149 Ga0209564_1000259 3300025295 Bacteria 112570
150 Ga0209564_1000778 3300025295 Bacteria 44316
151 Ga0209564_1002794 3300025295 Bacteria 13027
152 Ga0209564_1012596 3300025295 Bacteria 3673
153 Ga0209564_1013716 3300025295 Bacteria 3418
154 Ga0209564_1017225 3300025295 Bacteria 2828
155 Ga0209758_1000111 3300025297 Bacteria 208790
156 Ga0209758_1000666 3300025297 Bacteria 51353
157 Ga0209758_1001689 3300025297 Bacteria 24856
158 Ga0209758_1001847 3300025297 Bacteria 23247
159 Ga0209758_1001921 3300025297 Bacteria 22607
160 Ga0209758_1013196 3300025297 Bacteria 4536
161 Ga0209758_1053509 3300025297 Bacteria 1386
162 Ga0209758_1105598 3300025297 Bacteria 790
163 Ga0209256_1000283 3300025299 Bacteria 89387
164 Ga0209256_1000669 3300025299 Bacteria 46351
165 Ga0209256_1001412 3300025299 Bacteria 24978
166 Ga0209256_1004538 3300025299 Bacteria 8646
167 Ga0209256_1007919 3300025299 Bacteria 5076
168 Ga0209256_1010497 3300025299 Bacteria 3865
169 Ga0207426_1000011 3300025302 Bacteria 791203
170 Ga0207426_1000087 3300025302 Bacteria 288870
171 Ga0207426_1000208 3300025302 Bacteria 140385
172 Ga0207426_1001853 3300025302 Bacteria 15526
173 Ga0209051_1000434 3300025303 Bacteria 56673
174 Ga0209051_1002537 3300025303 Bacteria 12902
175 Ga0209051_1011437 3300025303 Bacteria 4380
176 Ga0209051_1011745 3300025303 Bacteria 4298
177 Ga0209051_1018130 3300025303 Bacteria 3123
178 Ga0209051_1046682 3300025303 Bacteria 1487
179 Ga0209051_1076025 3300025303 Bacteria 989
180 Ga0209257_1008463 3300025304 Bacteria 5837
181 Ga0207680_10299891 3300025903 Bacteria 1120
182 Ga0207695_10000037 3300025913 Bacteria 476303
183 Ga0207671_10000080 3300025914 Bacteria 148567
184 Ga0207650_10001249 3300025925 Bacteria 18464
185 Ga0207709_10873955 3300025935 Bacteria 729
186 Ga0207678_10793202 3300026067 Bacteria 836
187 Ga0207698_10151060 3300026142 Bacteria 2016
188 Ga0209371_1001488 3300027312 Bacteria 15631
189 Ga0209371_1002322 3300027312 Bacteria 10818
190 Ga0209371_1031306 3300027312 Bacteria 1156
191 Ga0209282_1005835 3300027666 Bacteria 7604
192 Ga0209282_1008576 3300027666 Bacteria 6455
193 Ga0209813_10028992 3300027866 Bacteria 1618
194 Ga0268266_10115318 3300028379 Bacteria 2385
195 Ga0268266_10220485 3300028379 Bacteria 1743
196 Ga0307515_10016158 3300028794 Bacteria 13688
197 Ga0268256_1002674 3300030500 Bacteria 8788
198 Ga0268256_1035540 3300030500 Bacteria 1157
199 Ga0316181_1077312 3300030744 Bacteria 3042
200 Ga0307513_10017820 3300031456 Bacteria 8507
201 Ga0307405_10006331 3300031731 Bacteria 5814
202 Ga0307410_10422158 3300031852 Bacteria 1082
203 Ga0307406_10012688 3300031901 Bacteria 4806
204 Ga0307412_10011713 3300031911 Bacteria 5087
205 Ga0439439_0005679 3300041406 Bacteria 2859
206 Ga0439465_0006683 3300041413 Bacteria 3663
207 Ga0451787_506157 3300041441 Bacteria 797
208 Ga0451791_1385197 3300041451 Bacteria 913
209 Ga0451795_1336264 3300041456 Bacteria 1225
210 Ga0451807_0807317 3300041486 Bacteria 1358
211 Ga0451833_1409442 3300041491 Bacteria 2415
212 Ga0451837_0356305 3300041494 Bacteria 2045
213 Ga0451837_1426596 3300041494 Bacteria 1991
214 Ga0451839_0519812 3300041496 Bacteria 2332
215 Ga0451841_0067188 3300041498 Bacteria 4263
216 Ga0451841_0886176 3300041498 Bacteria 858
217 Ga0451845_0941672 3300041501 Bacteria 810
218 Ga0451847_0391898 3300041503 Bacteria 1452
219 Ga0451849_0478376 3300041505 Bacteria 1069
220 Ga0451849_0644493 3300041505 Bacteria 1082
221 Ga0451851_0359614 3300041507 Bacteria 1394
222 Ga0451851_0362762 3300041507 Bacteria 2644
223 Ga0451851_0997622 3300041507 Bacteria 1165
224 Ga0451854_31556 3300041510 Bacteria 942
225 Ga0451855_0123925 3300041511 Bacteria 1032
226 Ga0451853_2441200 3300041512 Bacteria 3266
227 Ga0439432_122620 3300042006 Bacteria 769
228 Ga0439449_0014977 3300042007 Bacteria 2914
229 Ga0439449_0091240 3300042007 Bacteria 1125
230 Ga0466963_0067613 3300044694 Bacteria 2398
231 Ga0466970_0038631 3300044765 Bacteria 2532
232 Ga0466957_0036296 3300044842 Bacteria 2962
233 Ga0466959_0256697 3300045049 Bacteria 1204
234 Ga0466958_0103078 3300045836 Bacteria 1776
235 Ga0466967_0376794 3300045976 Bacteria 1377
236 Ga0495617_156741 3300046452 Bacteria 723
237 Ga0495627_076257 3300046453 Bacteria 975
238 Ga0495592_0185871 3300046454 Bacteria 1412
239 Ga0495629_0011633 3300046459 Bacteria 6389
240 Ga0495638_0002684 3300046460 Bacteria 14329
241 Ga0495651_0426252 3300046462 Bacteria 861
242 Ga0495650_0041528 3300046471 Bacteria 1966
243 Ga0495650_0076648 3300046471 Bacteria 1299
244 Ga0495650_0093763 3300046471 Bacteria 1138
245 Ga0495582_0350850 3300046473 Bacteria 850
246 Ga0495605_0024293 3300046474 Bacteria 3173
247 Ga0495605_0065354 3300046474 Bacteria 1730
248 Ga0495605_0142592 3300046474 Bacteria 1074
249 Ga0495605_0171700 3300046474 Bacteria 957
250 Ga0495585_0010500 3300046492 Bacteria 5508
251 Ga0495585_0016828 3300046492 Bacteria 4236
252 Ga0495585_0042594 3300046492 Bacteria 2542
253 Ga0495596_0025969 3300046500 Bacteria 2363
254 Ga0495607_0036345 3300046501 Bacteria 2968
255 Ga0495607_0090988 3300046501 Bacteria 1653
256 Ga0495583_0008644 3300046506 Bacteria 6196
257 Ga0495583_0017563 3300046506 Bacteria 3794
258 Ga0495583_0076224 3300046506 Bacteria 1465
259 Ga0495606_0005913 3300046507 Bacteria 11499
260 Ga0495606_0014480 3300046507 Bacteria 6150
261 Ga0495606_0090605 3300046507 Bacteria 1882
262 Ga0495606_0177706 3300046507 Bacteria 1230
263 Ga0495606_0200008 3300046507 Bacteria 1139
264 Ga0495606_0219110 3300046507 Bacteria 1073
265 Ga0495610_0011881 3300046512 Bacteria 5287
266 Ga0495610_0133978 3300046512 Bacteria 1073
267 Ga0495616_0076540 3300046513 Bacteria 1608
268 Ga0495618_0337425 3300046514 Bacteria 931
269 Ga0495620_0019701 3300046515 Bacteria 3311
270 Ga0495620_0109817 3300046515 Bacteria 1094
271 Ga0495631_0002418 3300046518 Bacteria 10535
272 Ga0495631_0026930 3300046518 Bacteria 2635
273 Ga0495632_0011295 3300046519 Bacteria 5220
274 Ga0495632_0011535 3300046519 Bacteria 5151
275 Ga0495632_0106936 3300046519 Bacteria 1315
276 Ga0495643_0042539 3300046522 Bacteria 2475
277 Ga0495643_0047962 3300046522 Bacteria 2311
278 Ga0495648_0028085 3300046524 Bacteria 3752
279 Ga0495648_0029443 3300046524 Bacteria 3645
280 Ga0495648_0177648 3300046524 Bacteria 1085
281 Ga0495652_0500993 3300046529 Unclassified 842
282 Ga0495609_0013402 3300046538 Bacteria 3872
283 Ga0495609_0044374 3300046538 Bacteria 1994
284 Ga0495609_0230008 3300046538 Bacteria 768
285 Ga0495597_0021425 3300046542 Bacteria 3005
286 Ga0495633_0033410 3300046558 Bacteria 2481
287 Ga0495668_0011366 3300046616 Bacteria 5335
288 Ga0495668_0126107 3300046616 Bacteria 1401
289 Ga0495611_0015171 3300046648 Bacteria 3293
290 Ga0495611_0150621 3300046648 Bacteria 1086
291 Ga0495625_0014370 3300046660 Bacteria 6323
292 Ga0495625_0093902 3300046660 Bacteria 2070
293 Ga0495625_0223977 3300046660 Bacteria 1231
294 Ga0495625_0295102 3300046660 Bacteria 1039
295 Ga0495635_0095787 3300046663 Bacteria 2029
296 Ga0495661_0052942 3300046665 Bacteria 2443
297 Ga0495661_0230471 3300046665 Bacteria 955
298 Ga0495657_0130399 3300046675 Bacteria 1575
299 Ga0495670_0007974 3300046691 Bacteria 5207
300 Ga0495670_0044321 3300046691 Bacteria 2221
301 Ga0495670_0081383 3300046691 Bacteria 1650
302 Ga0495671_0078571 3300046692 Bacteria 1618
303 Ga0495671_0088405 3300046692 Bacteria 1517
304 Ga0495649_0030912 3300046694 Bacteria 2955
305 Ga0495660_0011239 3300046810 Bacteria 5197
306 Ga0495660_0075985 3300046810 Bacteria 1771
307 Ga0495604_0009351 3300047317 Bacteria 7757
308 Ga0495636_0020118 3300047318 Bacteria 2688
309 Ga0495672_0029103 3300047320 Bacteria 3484
310 Ga0495687_089111 3300047443 Bacteria 1186
311 Ga0495673_0057849 3300047469 Bacteria 1673
312 Ga0495673_0179321 3300047469 Bacteria 803
313 Ga0495681_0014458 3300047470 Bacteria 4522
314 Ga0495681_0172625 3300047470 Bacteria 893
315 Ga0495686_0007362 3300047472 Bacteria 8257
316 Ga0495686_0019073 3300047472 Bacteria 4587
317 Ga0495686_0041073 3300047472 Bacteria 2947
318 Ga0495686_0041530 3300047472 Bacteria 2928
319 Ga0495686_0050670 3300047472 Bacteria 2608
320 Ga0495615_0022829 3300048090 Bacteria 1427
321 Ga0495626_0034213 3300048091 Bacteria 2432
322 Ga0496100_0258121 3300048903 Bacteria 1291
323 Ga0496101_0041771 3300048904 Bacteria 3272
324 Ga0496102_0010148 3300048905 Bacteria 8098
325 Ga0496102_0394871 3300048905 Bacteria 1301
326 Ga0496103_0039134 3300048906 Bacteria 2913
327 Ga0496104_0465704 3300048907 Bacteria 1175
328 Ga0496106_0002856 3300048909 Bacteria 12826
329 Ga0496107_0082556 3300048910 Bacteria 2344
330 Ga0496110_0427473 3300048913 Bacteria 1207
331 Ga0496111_0016074 3300048914 Bacteria 5152
332 Ga0496113_0422117 3300048916 Bacteria 1071
333 Ga0496116_0000105 3300048919 Bacteria 192704
334 Ga0496116_0006284 3300048919 Bacteria 10823
335 Ga0496116_0006925 3300048919 Bacteria 10165
336 Ga0496116_0007875 3300048919 Bacteria 9349
337 Ga0496116_0040555 3300048919 Bacteria 3205
338 Ga0496116_0067855 3300048919 Bacteria 2276
339 Ga0496116_0068104 3300048919 Bacteria 2269
340 Ga0496116_0202769 3300048919 Bacteria 1036
341 Ga0496116_0227398 3300048919 Bacteria 949
342 Ga0496117_0006083 3300048920 Bacteria 12375
343 Ga0496117_0016743 3300048920 Bacteria 6162
344 Ga0496117_0039280 3300048920 Bacteria 3495
345 Ga0496117_0095099 3300048920 Bacteria 1905
346 Ga0496117_0123208 3300048920 Bacteria 1588
347 Ga0496117_0227723 3300048920 Bacteria 1032
348 Ga0496117_0251453 3300048920 Bacteria 964
349 Ga0496118_0006836 3300048921 Bacteria 12375
350 Ga0496118_0014507 3300048921 Bacteria 7372
351 Ga0496118_0021462 3300048921 Bacteria 5681
352 Ga0496118_0022693 3300048921 Bacteria 5476
353 Ga0496118_0047537 3300048921 Bacteria 3324
354 Ga0496118_0154264 3300048921 Bacteria 1432
355 Ga0496118_0187056 3300048921 Bacteria 1243
356 Ga0496119_0009897 3300048922 Bacteria 8096
357 Ga0496119_0010784 3300048922 Bacteria 7652
358 Ga0496119_0033843 3300048922 Bacteria 3379
359 Ga0496119_0041128 3300048922 Bacteria 2948
360 Ga0496119_0071226 3300048922 Bacteria 2036
361 Ga0496119_0121878 3300048922 Bacteria 1432
362 Ga0496119_0248144 3300048922 Bacteria 899
363 Ga0496120_0014163 3300048923 Bacteria 5323
364 Ga0496120_0141752 3300048923 Bacteria 1219
365 Ga0496121_0007360 3300048924 Bacteria 13307
366 Ga0496121_0011993 3300048924 Bacteria 9528
367 Ga0496121_0032437 3300048924 Bacteria 4746
368 Ga0496121_0035631 3300048924 Bacteria 4454
369 Ga0496121_0043024 3300048924 Bacteria 3917
370 Ga0496121_0044299 3300048924 Bacteria 3840
371 Ga0496121_0071182 3300048924 Bacteria 2798
372 Ga0496121_0105311 3300048924 Bacteria 2165
373 Ga0496121_0210834 3300048924 Bacteria 1376
374 Ga0496121_0295766 3300048924 Bacteria 1101
375 Ga0496121_0449160 3300048924 Bacteria 831
376 Ga0496122_0008642 3300048925 Bacteria 10929
377 Ga0496122_0015649 3300048925 Bacteria 7236
378 Ga0496122_0023906 3300048925 Bacteria 5365
379 Ga0496122_0027756 3300048925 Bacteria 4828
380 Ga0496122_0042701 3300048925 Bacteria 3563
381 Ga0496122_0059616 3300048925 Bacteria 2816
382 Ga0496122_0077289 3300048925 Bacteria 2338
383 Ga0496122_0090298 3300048925 Bacteria 2091
384 Ga0496122_0203860 3300048925 Bacteria 1153
385 Ga0496123_0004716 3300048926 Bacteria 14106
386 Ga0496123_0011311 3300048926 Bacteria 7753
387 Ga0496123_0012772 3300048926 Bacteria 7122
388 Ga0496123_0019400 3300048926 Bacteria 5361
389 Ga0496123_0054424 3300048926 Bacteria 2634
390 Ga0496123_0062112 3300048926 Bacteria 2396
391 Ga0496123_0137730 3300048926 Bacteria 1340
392 Ga0496123_0154024 3300048926 Bacteria 1235
393 Ga0496124_0000067 3300048927 Bacteria 222576
394 Ga0496124_0006891 3300048927 Bacteria 12213
395 Ga0496124_0019469 3300048927 Bacteria 6315
396 Ga0496124_0029118 3300048927 Bacteria 4926
397 Ga0496124_0032066 3300048927 Bacteria 4646
398 Ga0496124_0034333 3300048927 Bacteria 4453
399 Ga0496124_0047233 3300048927 Bacteria 3684
400 Ga0496124_0103540 3300048927 Bacteria 2302
401 Ga0496124_0120303 3300048927 Bacteria 2099
402 Ga0496124_0209505 3300048927 Bacteria 1476
403 Ga0496124_0228705 3300048927 Bacteria 1392
404 Ga0496124_0336646 3300048927 Bacteria 1074
405 Ga0496125_0005400 3300048928 Bacteria 14237
406 Ga0496125_0021764 3300048928 Bacteria 5966
407 Ga0496125_0048793 3300048928 Bacteria 3526
408 Ga0496125_0055340 3300048928 Bacteria 3233
409 Ga0496125_0056696 3300048928 Bacteria 3179
410 Ga0496125_0149009 3300048928 Bacteria 1611
411 Ga0496125_0192010 3300048928 Bacteria 1347
412 Ga0496125_0222756 3300048928 Bacteria 1214
413 Ga0496125_0239791 3300048928 Bacteria 1152
414 Ga0496125_0258921 3300048928 Bacteria 1092
415 Ga0496126_0000780 3300048929 Bacteria 57510
416 Ga0496126_0074643 3300048929 Bacteria 3011
417 Ga0496126_0198482 3300048929 Bacteria 1695
418 Ga0496126_0366645 3300048929 Bacteria 1175
419 Ga0495678_019113 3300049459 Bacteria 3066
420 Ga0495678_046186 3300049459 Bacteria 1713
421 Ga0495678_051013 3300049459 Bacteria 1601
422 Ga0495682_0058279 3300049460 Bacteria 1397
423 Ga0501032_0020538 3300049569 Bacteria 4597
424 Ga0501033_0010894 3300049570 Bacteria 6971
425 Ga0501043_0147614 3300049579 Bacteria 1841
426 Ga0501048_0212229 3300049582 Bacteria 1373
427 Ga0501068_0065208 3300049584 Bacteria 2217
428 Ga0501073_0263175 3300049589 Bacteria 1190
429 Ga0501074_0465720 3300049590 Bacteria 896
430 Ga0501083_0154344 3300049744 Bacteria 1503
431 Ga0501035_0004474 3300049822 Bacteria 13266
432 Ga0501035_0246602 3300049822 Bacteria 1518
433 Ga0501035_0367112 3300049822 Bacteria 1202
434 nmdc:mga03683_60837_c1 3300050489 Bacteria 1596
435 nmdc:mga03n38_55256_c1 3300050490 Bacteria 1788
436 nmdc:mga0yw44_42139_c1 3300050492 Bacteria 2721
437 nmdc:mga0k408_15622_c1 3300050493 Bacteria 2640
438 nmdc:mga06z11_63609_c1 3300050494 Bacteria 1931
439 nmdc:mga04h51_39772_c1 3300050495 Bacteria 1529
440 nmdc:mga07m45_31638_c1 3300050496 Bacteria 2933
441 nmdc:mga0sz30_126726_c1 3300050516 Bacteria 1124
442 nmdc:mga0sz30_28639_c1 3300050516 Bacteria 2293
443 nmdc:mga0sz30_7809_c1 3300050516 Bacteria 3093
444 Ga0500644_0141598 3300053088 Bacteria 956
445 Ga0500557_009931 3300053105 Bacteria 2357
446 Ga0500562_028625 3300053108 Bacteria 1465
447 Ga0500569_001416 3300053109 Bacteria 4514
448 Ga0500569_020295 3300053109 Bacteria 1741
449 Ga0500572_009765 3300053111 Bacteria 2276
450 Ga0500594_0002866 3300053118 Bacteria 3760
451 Ga0500607_098475 3300053121 Bacteria 1457
452 Ga0500614_071210 3300053123 Bacteria 955
453 Ga0500618_048414 3300053125 Bacteria 965
454 Ga0500658_0005723 3300053134 Bacteria 4628
455 Ga0500658_0285960 3300053134 Bacteria 758
456 Ga0500659_0113461 3300053135 Bacteria 1391
457 Ga0500561_0093855 3300053137 Bacteria 891
458 Ga0500568_0004394 3300053139 Bacteria 7544
459 Ga0500568_0009417 3300053139 Bacteria 4644
460 Ga0500590_031710 3300053148 Bacteria 2740
461 Ga0500606_084255 3300053152 Bacteria 1076
462 Ga0500616_0020975 3300053153 Bacteria 3667
463 Ga0500622_0001357 3300053156 Bacteria 19789
464 Ga0500622_0231734 3300053156 Bacteria 822
465 Ga0500624_001660 3300053157 Bacteria 3344
466 Ga0500627_0052792 3300053158 Bacteria 1775
467 Ga0500633_0000319 3300053160 Bacteria 7134
468 Ga0500634_0000243 3300053161 Bacteria 17768
469 Ga0500636_0000374 3300053177 Bacteria 24550
470 Ga0500636_0000443 3300053177 Bacteria 22859
471 Ga0500636_0170806 3300053177 Bacteria 1176
472 Ga0500636_0244814 3300053177 Bacteria 918
473 Ga0500596_024697 3300053735 Bacteria 915
474 2509390148 2509276021 Bacteria 7634384
475 2509447565 2509276033 Bacteria 7180565
476 2510134395 2510065019 Bacteria 6903379
477 2510895819 2510461076 Bacteria 8618824
478 2511131950 2510917022 Bacteria 6504556
479 2511182679 2510917028 Bacteria 6185411
480 2511195286 2510917030 Bacteria 7460662
481 2513567493 2513237084 Bacteria 7231967
482 2513632026 2513237093 Bacteria 7545552
483 2513712503 2513237103 Bacteria 7647401
484 2513867891 2513237138 Bacteria 7368160
485 2513910618 2513237144 Bacteria 7530820
486 2513928064 2513237146 Bacteria 7166346
487 2514017874 2513237162 Bacteria 7468464
488 2515113557 2515075009 Bacteria 7288508
489 2515635271 2515154113 Bacteria 7807172
490 2515643823 2515154114 Bacteria 7848616
491 2515654911 2515154116 Bacteria 7552979
492 2517037173 2516653077 Bacteria 7555578
493 2517077511 2516653085 Bacteria 7346596
494 2517096281 2517093000 Bacteria 7412387
495 2517408140 2517287029 Bacteria 6905599
496 2524459034 2524023209 Bacteria 6679728
497 2530646361 2529292951 Bacteria 6916614
498 2535517263 2534681796 Bacteria 7146037
499 2537873897 2537561587 Bacteria 5425293
500 2585205076 2582581294 Bacteria 6626667
501 2585225228 2582581298 Bacteria 7315509
502 2585230705 2582581299 Bacteria 6518058
503 2585259144 2582581304 Bacteria 5831370
504 2585273990 2582581307 Bacteria 6597605
505 2585279451 2582581308 Bacteria 7413247
506 2585322889 2582581315 Bacteria 7318924
507 2585331055 2582581316 Bacteria 7774528
508 2585404577 2582581867 Bacteria 7184437
509 2585524940 2585427526 Bacteria 7258840
510 2585531065 2585427527 Bacteria 7273426
511 2585542757 2585427528 Bacteria 6842387
512 2585547784 2585427529 Bacteria 7395659
513 2585553014 2585427530 Bacteria 7383882
514 2585560441 2585427531 Bacteria 6992870
515 2585824885 2585427590 Bacteria 6824633
516 2585841399 2585427593 Bacteria 7141551
517 2585847730 2585427594 Bacteria 6180594
518 2585898634 2585427608 Bacteria 6544331
519 2585903777 2585427609 Bacteria 6667127
520 2587981104 2585428125 Bacteria 6662905
521 2599421072 2599185170 Bacteria 7295545
522 2599601949 2599185210 Bacteria 5624189
523 2616307024 2615840626 Bacteria 7921970
524 2616554639 2615840698 Bacteria 7319877
525 2617384862 2617270742 Bacteria 6808054
526 2643856461 2643221568 Bacteria 5187270
527 2643920059 2643221582 Bacteria 5804683
528 2644002940 2643221599 Bacteria 6292121
529 2644196690 2643221634 Bacteria 6705461
530 2644237921 2643221643 Bacteria 5749658
531 2671111882 2667528174 Bacteria 6435400
532 2719182273 2718217882 Bacteria 6556348
533 2719386864 2718217927 Bacteria 6972593
534 2719666600 2718217997 Bacteria 6740740
535 2719732989 2718218009 Bacteria 6478651
536 2720493020 2718218199 Bacteria 6740745
537 2720614499 2718218232 Bacteria 6720332
538 2720621273 2718218233 Bacteria 6662049
539 2720632599 2718218235 Bacteria 6630699
540 2720776323 2718218269 Bacteria 6906114
541 2721148386 2718218363 Bacteria 6524337
542 2721159772 2718218365 Bacteria 6274507
543 2721165200 2718218366 Bacteria 6425255
544 2721400587 2718218423 Bacteria 6438183
545 2722841370 2721755514 Bacteria 6424414
546 2723027912 2721755556 Bacteria 6745503
547 2723561542 2721755684 Bacteria 6859907
548 2723568171 2721755685 Bacteria 6704835
549 2724039400 2721755809 Bacteria 6438790
550 2724045745 2721755810 Bacteria 6479005
551 2724090930 2721755819 Bacteria 6906405
552 2724105436 2721755822 Bacteria 6726041
553 2724111261 2721755823 Bacteria 6752556
554 2725949236 2724679232 Bacteria 7646494
555 2730108848 2728369352 Bacteria 6745171
556 2730165508 2728369365 Bacteria 6555560
557 2730299404 2728369397 Bacteria 6274511
558 2738805450 2738541293 Bacteria 7065685
559 2739033262 2738541333 Bacteria 7106503
560 2766066310 2765235942 Bacteria 7445910
561 2778173404 2775507266 Bacteria 7392367
562 2793293989 2791355256 Bacteria 6798008
563 2793314335 2791355259 Bacteria 7254731
564 2793323824 2791355260 Bacteria 6598818
565 2793329728 2791355261 Bacteria 6661293
566 2793335084 2791355262 Bacteria 6774204
567 2793342328 2791355263 Bacteria 6872478
568 2793349696 2791355264 Bacteria 6429314
569 2793355347 2791355265 Bacteria 6539969
570 2793363037 2791355266 Bacteria 7116587
571 2793369906 2791355267 Bacteria 7222458
572 2805929564 2802429605 Bacteria 6875453
573 2805936869 2802429606 Bacteria 6346811
574 2806047496 2802429633 Bacteria 7341974
575 2806055154 2802429634 Bacteria 7083200
576 2806063036 2802429635 Bacteria 7650140
577 2806069771 2802429636 Bacteria 7597525
578 2806075700 2802429637 Bacteria 7067217
579 2819609905 2818991448 Bacteria 6772224
580 2819640016 2818991453 Bacteria 7181617
581 2838019909 2838016132 Bacteria 6577831
582 2838033218 2838029111 Bacteria 6603031
583 2838041436 2838035591 Bacteria 7166484
584 2838045641 2838042994 Bacteria 6046894
585 2838052718 2838048938 Bacteria 6044578
586 2838064975 2838061910 Bacteria 6794874
587 2838069702 2838068647 Bacteria 6208656
588 2838665827 2838661181 Bacteria 7385261
589 2838671796 2838668709 Bacteria 6671819
590 2838675487 2838675328 Bacteria 4909118
591 2838683001 2838680041 Bacteria 6545511
592 2838686611 2838686498 Bacteria 7807632
593 2838698056 2838694306 Bacteria 6853137
594 2838704475 2838701080 Bacteria 6669771
595 2838711170 2838707686 Bacteria 6619912
596 2838714368 2838714209 Bacteria 5525906
597 2838721830 2838719591 Bacteria 5523910
598 2838725129 2838724970 Bacteria 4908691
599 2838734853 2838729681 Bacteria 7400765
600 2838747468 2838742623 Bacteria 7396178
601 2841848813 2841846520 Bacteria 5345850
602 2841854440 2841851746 Bacteria 7532261
603 2841862485 2841859092 Bacteria 5436171
604 2841867413 2841864319 Bacteria 6742987
605 2842079346 2842077413 Bacteria 6508645
606 2842115549 2842110456 Bacteria 7656360
607 2842118144 2842118031 Bacteria 7033875
608 2842125156 2842124991 Bacteria 5346824
609 2842130382 2842130223 Bacteria 4909145
610 2842149693 2842146304 Bacteria 5957337
611 2842154448 2842152218 Bacteria 4908957
612 2842158541 2842156927 Bacteria 6894975
613 2842170611 2842170452 Bacteria 5525737
614 2842178068 2842175837 Bacteria 4908771
615 2842182155 2842180545 Bacteria 6888678
616 2842187477 2842187318 Bacteria 5524014
617 2842195604 2842192696 Bacteria 6147454
618 2842210927 2842205361 Bacteria 6340321
619 2842211788 2842211629 Bacteria 5523832
620 2842218388 2842217011 Bacteria 7497767
621 2842226592 2842224351 Bacteria 5524473
622 2842229845 2842229732 Bacteria 7475766
623 2842240057 2842237096 Bacteria 6620661
624 2842243734 2842243621 Bacteria 7421798
625 2842254140 2842250916 Bacteria 6579627
626 2842258181 2842257432 Bacteria 7401195
627 2842268933 2842264693 Bacteria 6472963
628 2842271851 2842271015 Bacteria 7807131
629 2842284380 2842278818 Bacteria 6340002
630 2842293008 2842291075 Bacteria 7076806
631 2842298386 2842298080 Bacteria 6123127
632 2842305464 2842304105 Bacteria 7023636
633 2842314186 2842311132 Bacteria 6616990
634 2842319991 2842317721 Bacteria 6793725
635 2842347615 2842341865 Bacteria 7003929
636 2842360398 2842357229 Bacteria 6485165
637 2842368735 2842363717 Bacteria 6844742
638 2842373630 2842370503 Bacteria 7038661
639 2842379405 2842377471 Bacteria 7140707
640 2842384654 2842384541 Bacteria 7057858
641 2842400558 2842395702 Bacteria 6780583
642 2842402522 2842402390 Bacteria 6681310
643 2842410107 2842409023 Bacteria 6687331
644 2842416755 2842415677 Bacteria 6596907
645 2842423316 2842422224 Bacteria 6239196
646 2842433145 2842428310 Bacteria 6767288
647 2842439450 2842434925 Bacteria 6502746
648 2842446079 2842441272 Bacteria 6769273
649 2842449106 2842447887 Bacteria 6754142
650 2842467316 2842462802 Bacteria 6588055
651 2842474111 2842469257 Bacteria 6752936
652 2842480117 2842475841 Bacteria 6603183
653 2842483687 2842482326 Bacteria 7212537
654 2842493468 2842489311 Bacteria 6620893
655 2842497619 2842495871 Bacteria 6820686
656 2842505098 2842502639 Bacteria 6604161
657 2842510401 2842509118 Bacteria 6850950
658 2842519269 2842515876 Bacteria 5436280
659 2844457909 2844454524 Bacteria 7952546
660 2852390817 2852387548 Bacteria 8025568
661 2857516981 2857516855 Bacteria 7787325
662 2899795833 2899792073 Bacteria 4926588
663 2899806697 2899803654 Bacteria 5577784
664 2919105619 2919100787 Bacteria 7710546
665 2919114399 2919114240 Bacteria 5700270
666 2919169667 2919166419 Bacteria 4952238
667 2919410383 2919408235 Bacteria 6149349
668 2923562141 2923556063 Bacteria 6793593
669 2926755419 2926754445 Bacteria 5964435
670 2933009093 2933006813 Bacteria 4912075
671 2933014559 2933011516 Bacteria 5439334
672 2933023690 2933016740 Bacteria 6355406
673 2933571271 2933570622 Bacteria 7023390
674 2933591964 2933586486 Bacteria 7667493
675 2933600509 2933599457 Bacteria 5858799
676 2935896561 2935894831 Bacteria 6620579
677 2936371600 2936367885 Bacteria 7324495
678 2936376973 2936375103 Bacteria 6652732
679 2936383440 2936381700 Bacteria 7006523
680 2978972029 2978969890 Bacteria 5400756
681 2984590313 2984587000 Bacteria 5263363
682 2996892557 2996887358 Bacteria 5795980
683 2996898079 2996893221 Bacteria 5823108
684 3005409365 3005409236 Bacteria 7188837
685 3005418793 3005416602 Bacteria 7064308
686 3005448857 3005445848 Bacteria 6906074
687 3005455077 3005452660 Bacteria 5889319
688 639649602 639633055 Bacteria 7751309
689 8003571908 8003570095 Bacteria 5747666
690 8005264816 8005258706 Bacteria 6184835
691 8005281675 8005275841 Bacteria 6929066
692 8005284366 8005282627 Bacteria 6675747
693 8005289618 8005289223 Bacteria 6634003
694 8005318315 8005314921 Bacteria 7072929
695 8005327084 8005321885 Bacteria 5795980
696 8005382659 8005376324 Bacteria 6590079
697 8005384622 8005382845 Bacteria 6732062
698 8005395651 8005395548 Bacteria 6806915
699 8005433888 8005430974 Bacteria 6689030
700 8005464244 8005460587 Bacteria 7157962
701 8005488805 8005484373 Bacteria 6297373
702 8005501348 8005497431 Bacteria 6477605
703 8005546083 8005542996 Bacteria 7077758
704 8005568435 8005563573 Bacteria 7153261
705 8005573028 8005570704 Bacteria 6957481
706 8005622710 8005619151 Bacteria 7030230
707 8005630225 8005626139 Bacteria 6534237
708 8005645819 8005645114 Bacteria 6950293
709 8005672767 8005668836 Bacteria 6953162
710 8005682499 8005682033 Bacteria 6726518
711 8005696770 8005695170 Bacteria 6912330
712 8018163323 8018163183 Bacteria 7277977
713 8018178979 8018176218 Bacteria 6896178
714 8024486088 8024479707 Bacteria 6954785
715 8024488451 8024486573 Bacteria 6540512
716 8024501163 8024501048 Bacteria 6427847
717 8046772620 8046767195 Bacteria 7547379
718 8054463248 8054460903 Bacteria 4872905
719 8056377040 8056375014 Bacteria 7006639
720 8056387363 8056382006 Bacteria 6408074
721 8057881899 8057874678 Bacteria 7494653
722 Ga0496121_0029609
723 JGI24740J21852_10000220
724 JGI25155J39150_1000066
725 JGI25156J39149_1000075
726 JGI25162J39368_1000149
727 JGI25154J39366_1000075
728 JGI25158J39367_1000924
729 JGI25157J39369_1000051
730 JGI25157J39369_1000077
731 JGI25152J39213_1003477
732 JGI25152J39213_1004457
733 JGI25152J39213_1005057
734 JGI25152J39213_1010756
735 JGI25152J39213_1012615
736 JGI25152J39213_1019713
737 JGI25150J39212_1000091
738 JGI25159J45721_1000108
739 JGI25159J45721_1009532
740 JGI25151J46595_10000027
741 JGI25151J46595_10000737
742 JGI25151J46595_10002713
743 JGI25151J46595_10003152
744 JGI25151J46595_10008201
745 JGI25165J46597_1000781
746 JGI25165J46597_1001844
747 JGI25153J46596_10006055
748 JGI25153J46596_10025633
749 JGI25153J46596_10026205
750 JGI25153J46596_10032025
751 rootH1_10000491
752 rootH1_10000492
753 rootH2_10065851
754 rootL2_10069708
755 rootH1_10089023
756 rootH1_10147282
757 JGI25160J50197_1000001
758 JGI25160J50197_1000766
759 JGI25160J50197_1005979
760 JGI25160J50197_1042491
761 JGI25160J50197_1042520
762 JGI25161J50226_1000001
763 JGI25161J50226_1000163
764 JGI25161J50226_1001467
765 Ga0006562J51391_1161272
766 Ga0055526_1001847
767 Ga0055526_1003775
768 Ga0055524_1001962
769 Ga0055524_1002479
770 Ga0055524_1006370
771 Ga0055524_1016289
772 Ga0055528_1001291
773 Ga0055528_1001315
774 Ga0055528_1004820
775 Ga0055540_1000483
776 Ga0055540_1007277
777 Ga0055540_1009779
778 Ga0055540_1012556
779 Ga0055543_1000007
780 Ga0055543_1000108
781 Ga0055543_1000220
782 Ga0065165_1000008
783 Ga0065165_1010003
784 Ga0065165_1045051
785 Ga0070670_100006743
786 Ga0070663_100095516
787 Ga0070665_100071341
788 Ga0070665_100363096
789 Ga0070665_101046759
790 Ga0068855_100223595
791 Ga0068856_100018348
792 Ga0068852_100050243
793 Ga0068851_10215264
794 Ga0075365_10002545
795 Ga0075368_10016715
796 Ga0075363_100024716
797 Ga0075363_100286327
798 Ga0075363_100311845
799 Ga0075362_10001438
800 Ga0075367_10019538
801 Ga0075369_10013658
802 Ga0075369_10105239
803 Ga0075369_10132833
804 Ga0075366_10008481
805 Ga0075370_10000296
806 Ga0099826_10000404
807 Ga0099826_10010403
808 Ga0105244_10225682
809 Ga0105240_10000014
810 Ga0105248_10235320
811 Ga0105237_10000685
812 Ga0105249_10821368
813 Ga0123341_1000018
814 Ga0123342_1030001
815 Ga0105239_10001960
816 Ga0157371_10009685
817 Ga0157370_10000015
818 Ga0157369_10253917
819 Ga0157369_10960494
820 Ga0182007_10001042
821 Ga0209435_100005
822 Ga0209436_100272
823 Ga0209563_108717
824 Ga0209437_100058
825 Ga0209437_100060
826 Ga0207425_1000043
827 Ga0207425_1000495
828 Ga0207425_1010927
829 Ga0207425_1015964
830 Ga0207425_1018478
831 Ga0209646_1000011
832 Ga0209646_1006128
833 Ga0209026_1000008
834 Ga0209677_100493
835 Ga0209148_1005477
836 Ga0209759_1000004
837 Ga0209759_1026858
838 Ga0209129_1000072
839 Ga0209129_1000128
840 Ga0209129_1000702
841 Ga0209129_1000810
842 Ga0209129_1001196
843 Ga0209129_1001400
844 Ga0209233_1000137
845 Ga0209233_1000149
846 Ga0209233_1000160
847 Ga0209673_1000125
848 Ga0209673_1000256
849 Ga0209673_1001106
850 Ga0209673_1001124
851 Ga0209673_1003529
852 Ga0209673_1003945
853 Ga0209130_1000003
854 Ga0209130_1000023
855 Ga0209130_1018831
856 Ga0209130_1026880
857 Ga0209675_1037288
858 Ga0209676_1017938
859 Ga0209676_1023533
860 Ga0209025_1000120
861 Ga0209025_1000154
862 Ga0209025_1000451
863 Ga0209025_1000537
864 Ga0209025_1001251
865 Ga0209025_1004713
866 Ga0209025_1009663
867 Ga0209025_1010434
868 Ga0209025_1107509
869 Ga0209564_1000259
870 Ga0209564_1000778
871 Ga0209564_1002794
872 Ga0209564_1012596
873 Ga0209564_1013716
874 Ga0209564_1017225
875 Ga0209758_1000111
876 Ga0209758_1000666
877 Ga0209758_1001689
878 Ga0209758_1001847
879 Ga0209758_1001921
880 Ga0209758_1013196
881 Ga0209758_1053509
882 Ga0209758_1105598
883 Ga0209256_1000283
884 Ga0209256_1000669
885 Ga0209256_1001412
886 Ga0209256_1004538
887 Ga0209256_1007919
888 Ga0209256_1010497
889 Ga0207426_1000011
890 Ga0207426_1000087
891 Ga0207426_1000208
892 Ga0207426_1001853
893 Ga0209051_1000434
894 Ga0209051_1002537
895 Ga0209051_1011437
896 Ga0209051_1011745
897 Ga0209051_1018130
898 Ga0209051_1046682
899 Ga0209051_1076025
900 Ga0209257_1008463
901 Ga0207680_10299891
902 Ga0207695_10000037
903 Ga0207671_10000080
904 Ga0207650_10001249
905 Ga0207709_10873955
906 Ga0207678_10793202
907 Ga0207698_10151060
908 Ga0209371_1001488
909 Ga0209371_1002322
910 Ga0209371_1031306
911 Ga0209282_1005835
912 Ga0209282_1008576
913 Ga0209813_10028992
914 Ga0268266_10115318
915 Ga0268266_10220485
916 Ga0307515_10016158
917 Ga0268256_1002674
918 Ga0268256_1035540
919 Ga0316181_1077312
920 Ga0307513_10017820
921 Ga0307405_10006331
922 Ga0307410_10422158
923 Ga0307406_10012688
924 Ga0307412_10011713
925 Ga0439439_0005679
926 Ga0439465_0006683
927 Ga0451787_506157
928 Ga0451791_1385197
929 Ga0451795_1336264
930 Ga0451807_0807317
931 Ga0451833_1409442
932 Ga0451837_0356305
933 Ga0451837_1426596
934 Ga0451839_0519812
935 Ga0451841_0067188
936 Ga0451841_0886176
937 Ga0451845_0941672
938 Ga0451847_0391898
939 Ga0451849_0478376
940 Ga0451849_0644493
941 Ga0451851_0359614
942 Ga0451851_0362762
943 Ga0451851_0997622
944 Ga0451854_31556
945 Ga0451855_0123925
946 Ga0451853_2441200
947 Ga0439432_122620
948 Ga0439449_0014977
949 Ga0439449_0091240
950 Ga0466963_0067613
951 Ga0466970_0038631
952 Ga0466957_0036296
953 Ga0466959_0256697
954 Ga0466958_0103078
955 Ga0466967_0376794
956 Ga0495617_156741
957 Ga0495627_076257
958 Ga0495592_0185871
959 Ga0495629_0011633
960 Ga0495638_0002684
961 Ga0495651_0426252
962 Ga0495650_0041528
963 Ga0495650_0076648
964 Ga0495650_0093763
965 Ga0495582_0350850
966 Ga0495605_0024293
967 Ga0495605_0065354
968 Ga0495605_0142592
969 Ga0495605_0171700
970 Ga0495585_0010500
971 Ga0495585_0016828
972 Ga0495585_0042594
973 Ga0495596_0025969
974 Ga0495607_0036345
975 Ga0495607_0090988
976 Ga0495583_0008644
977 Ga0495583_0017563
978 Ga0495583_0076224
979 Ga0495606_0005913
980 Ga0495606_0014480
981 Ga0495606_0090605
982 Ga0495606_0177706
983 Ga0495606_0200008
984 Ga0495606_0219110
985 Ga0495610_0011881
986 Ga0495610_0133978
987 Ga0495616_0076540
988 Ga0495618_0337425
989 Ga0495620_0019701
990 Ga0495620_0109817
991 Ga0495631_0002418
992 Ga0495631_0026930
993 Ga0495632_0011295
994 Ga0495632_0011535
995 Ga0495632_0106936
996 Ga0495643_0042539
997 Ga0495643_0047962
998 Ga0495648_0028085
999 Ga0495648_0029443
1000 Ga0495648_0177648
1001 Ga0495652_0500993
1002 Ga0495609_0013402
1003 Ga0495609_0044374
1004 Ga0495609_0230008
1005 Ga0495597_0021425
1006 Ga0495633_0033410
1007 Ga0495668_0011366
1008 Ga0495668_0126107
1009 Ga0495611_0015171
1010 Ga0495611_0150621
1011 Ga0495625_0014370
1012 Ga0495625_0093902
1013 Ga0495625_0223977
1014 Ga0495625_0295102
1015 Ga0495635_0095787
1016 Ga0495661_0052942
1017 Ga0495661_0230471
1018 Ga0495657_0130399
1019 Ga0495670_0007974
1020 Ga0495670_0044321
1021 Ga0495670_0081383
1022 Ga0495671_0078571
1023 Ga0495671_0088405
1024 Ga0495649_0030912
1025 Ga0495660_0011239
1026 Ga0495660_0075985
1027 Ga0495604_0009351
1028 Ga0495636_0020118
1029 Ga0495672_0029103
1030 Ga0495687_089111
1031 Ga0495673_0057849
1032 Ga0495673_0179321
1033 Ga0495681_0014458
1034 Ga0495681_0172625
1035 Ga0495686_0007362
1036 Ga0495686_0019073
1037 Ga0495686_0041073
1038 Ga0495686_0041530
1039 Ga0495686_0050670
1040 Ga0495615_0022829
1041 Ga0495626_0034213
1042 Ga0496100_0258121
1043 Ga0496101_0041771
1044 Ga0496102_0010148
1045 Ga0496102_0394871
1046 Ga0496103_0039134
1047 Ga0496104_0465704
1048 Ga0496106_0002856
1049 Ga0496107_0082556
1050 Ga0496110_0427473
1051 Ga0496111_0016074
1052 Ga0496113_0422117
1053 Ga0496116_0000105
1054 Ga0496116_0006284
1055 Ga0496116_0006925
1056 Ga0496116_0007875
1057 Ga0496116_0040555
1058 Ga0496116_0067855
1059 Ga0496116_0068104
1060 Ga0496116_0202769
1061 Ga0496116_0227398
1062 Ga0496117_0006083
1063 Ga0496117_0016743
1064 Ga0496117_0039280
1065 Ga0496117_0095099
1066 Ga0496117_0123208
1067 Ga0496117_0227723
1068 Ga0496117_0251453
1069 Ga0496118_0006836
1070 Ga0496118_0014507
1071 Ga0496118_0021462
1072 Ga0496118_0022693
1073 Ga0496118_0047537
1074 Ga0496118_0154264
1075 Ga0496118_0187056
1076 Ga0496119_0009897
1077 Ga0496119_0010784
1078 Ga0496119_0033843
1079 Ga0496119_0041128
1080 Ga0496119_0071226
1081 Ga0496119_0121878
1082 Ga0496119_0248144
1083 Ga0496120_0014163
1084 Ga0496120_0141752
1085 Ga0496121_0007360
1086 Ga0496121_0011993
1087 Ga0496121_0032437
1088 Ga0496121_0035631
1089 Ga0496121_0043024
1090 Ga0496121_0044299
1091 Ga0496121_0071182
1092 Ga0496121_0105311
1093 Ga0496121_0210834
1094 Ga0496121_0295766
1095 Ga0496121_0449160
1096 Ga0496122_0008642
1097 Ga0496122_0015649
1098 Ga0496122_0023906
1099 Ga0496122_0027756
1100 Ga0496122_0042701
1101 Ga0496122_0059616
1102 Ga0496122_0077289
1103 Ga0496122_0090298
1104 Ga0496122_0203860
1105 Ga0496123_0004716
1106 Ga0496123_0011311
1107 Ga0496123_0012772
1108 Ga0496123_0019400
1109 Ga0496123_0054424
1110 Ga0496123_0062112
1111 Ga0496123_0137730
1112 Ga0496123_0154024
1113 Ga0496124_0000067
1114 Ga0496124_0006891
1115 Ga0496124_0019469
1116 Ga0496124_0029118
1117 Ga0496124_0032066
1118 Ga0496124_0034333
1119 Ga0496124_0047233
1120 Ga0496124_0103540
1121 Ga0496124_0120303
1122 Ga0496124_0209505
1123 Ga0496124_0228705
1124 Ga0496124_0336646
1125 Ga0496125_0005400
1126 Ga0496125_0021764
1127 Ga0496125_0048793
1128 Ga0496125_0055340
1129 Ga0496125_0056696
1130 Ga0496125_0149009
1131 Ga0496125_0192010
1132 Ga0496125_0222756
1133 Ga0496125_0239791
1134 Ga0496125_0258921
1135 Ga0496126_0000780
1136 Ga0496126_0074643
1137 Ga0496126_0198482
1138 Ga0496126_0366645
1139 Ga0495678_019113
1140 Ga0495678_046186
1141 Ga0495678_051013
1142 Ga0495682_0058279
1143 Ga0501032_0020538
1144 Ga0501033_0010894
1145 Ga0501043_0147614
1146 Ga0501048_0212229
1147 Ga0501068_0065208
1148 Ga0501073_0263175
1149 Ga0501074_0465720
1150 Ga0501083_0154344
1151 Ga0501035_0004474
1152 Ga0501035_0246602
1153 Ga0501035_0367112
1154 nmdc:mga03683_60837_c1
1155 nmdc:mga03n38_55256_c1
1156 nmdc:mga0yw44_42139_c1
1157 nmdc:mga0k408_15622_c1
1158 nmdc:mga06z11_63609_c1
1159 nmdc:mga04h51_39772_c1
1160 nmdc:mga07m45_31638_c1
1161 nmdc:mga0sz30_126726_c1
1162 nmdc:mga0sz30_28639_c1
1163 nmdc:mga0sz30_7809_c1
1164 Ga0500644_0141598
1165 Ga0500557_009931
1166 Ga0500562_028625
1167 Ga0500569_001416
1168 Ga0500569_020295
1169 Ga0500572_009765
1170 Ga0500594_0002866
1171 Ga0500607_098475
1172 Ga0500614_071210
1173 Ga0500618_048414
1174 Ga0500658_0005723
1175 Ga0500658_0285960
1176 Ga0500659_0113461
1177 Ga0500561_0093855
1178 Ga0500568_0004394
1179 Ga0500568_0009417
1180 Ga0500590_031710
1181 Ga0500606_084255
1182 Ga0500616_0020975
1183 Ga0500622_0001357
1184 Ga0500622_0231734
1185 Ga0500624_001660
1186 Ga0500627_0052792
1187 Ga0500633_0000319
1188 Ga0500634_0000243
1189 Ga0500636_0000374
1190 Ga0500636_0000443
1191 Ga0500636_0170806
1192 Ga0500636_0244814
1193 Ga0500596_024697
1194 2509390148
1195 2509447565
1196 2510134395
1197 2510895819
1198 2511131950
1199 2511182679
1200 2511195286
1201 2513567493
1202 2513632026
1203 2513712503
1204 2513867891
1205 2513910618
1206 2513928064
1207 2514017874
1208 2515113557
1209 2515635271
1210 2515643823
1211 2515654911
1212 2517037173
1213 2517077511
1214 2517096281
1215 2517408140
1216 2524459034
1217 2530646361
1218 2535517263
1219 2537873897
1220 2585205076
1221 2585225228
1222 2585230705
1223 2585259144
1224 2585273990
1225 2585279451
1226 2585322889
1227 2585331055
1228 2585404577
1229 2585524940
1230 2585531065
1231 2585542757
1232 2585547784
1233 2585553014
1234 2585560441
1235 2585824885
1236 2585841399
1237 2585847730
1238 2585898634
1239 2585903777
1240 2587981104
1241 2599421072
1242 2599601949
1243 2616307024
1244 2616554639
1245 2617384862
1246 2643856461
1247 2643920059
1248 2644002940
1249 2644196690
1250 2644237921
1251 2671111882
1252 2719182273
1253 2719386864
1254 2719666600
1255 2719732989
1256 2720493020
1257 2720614499
1258 2720621273
1259 2720632599
1260 2720776323
1261 2721148386
1262 2721159772
1263 2721165200
1264 2721400587
1265 2722841370
1266 2723027912
1267 2723561542
1268 2723568171
1269 2724039400
1270 2724045745
1271 2724090930
1272 2724105436
1273 2724111261
1274 2725949236
1275 2730108848
1276 2730165508
1277 2730299404
1278 2738805450
1279 2739033262
1280 2766066310
1281 2778173404
1282 2793293989
1283 2793314335
1284 2793323824
1285 2793329728
1286 2793335084
1287 2793342328
1288 2793349696
1289 2793355347
1290 2793363037
1291 2793369906
1292 2805929564
1293 2805936869
1294 2806047496
1295 2806055154
1296 2806063036
1297 2806069771
1298 2806075700
1299 2819609905
1300 2819640016
1301 2838019909
1302 2838033218
1303 2838041436
1304 2838045641
1305 2838052718
1306 2838064975
1307 2838069702
1308 2838665827
1309 2838671796
1310 2838675487
1311 2838683001
1312 2838686611
1313 2838698056
1314 2838704475
1315 2838711170
1316 2838714368
1317 2838721830
1318 2838725129
1319 2838734853
1320 2838747468
1321 2841848813
1322 2841854440
1323 2841862485
1324 2841867413
1325 2842079346
1326 2842115549
1327 2842118144
1328 2842125156
1329 2842130382
1330 2842149693
1331 2842154448
1332 2842158541
1333 2842170611
1334 2842178068
1335 2842182155
1336 2842187477
1337 2842195604
1338 2842210927
1339 2842211788
1340 2842218388
1341 2842226592
1342 2842229845
1343 2842240057
1344 2842243734
1345 2842254140
1346 2842258181
1347 2842268933
1348 2842271851
1349 2842284380
1350 2842293008
1351 2842298386
1352 2842305464
1353 2842314186
1354 2842319991
1355 2842347615
1356 2842360398
1357 2842368735
1358 2842373630
1359 2842379405
1360 2842384654
1361 2842400558
1362 2842402522
1363 2842410107
1364 2842416755
1365 2842423316
1366 2842433145
1367 2842439450
1368 2842446079
1369 2842449106
1370 2842467316
1371 2842474111
1372 2842480117
1373 2842483687
1374 2842493468
1375 2842497619
1376 2842505098
1377 2842510401
1378 2842519269
1379 2844457909
1380 2852390817
1381 2857516981
1382 2899795833
1383 2899806697
1384 2919105619
1385 2919114399
1386 2919169667
1387 2919410383
1388 2923562141
1389 2926755419
1390 2933009093
1391 2933014559
1392 2933023690
1393 2933571271
1394 2933591964
1395 2933600509
1396 2935896561
1397 2936371600
1398 2936376973
1399 2936383440
1400 2978972029
1401 2984590313
1402 2996892557
1403 2996898079
1404 3005409365
1405 3005418793
1406 3005448857
1407 3005455077
1408 639649602
1409 8003571908
1410 8005264816
1411 8005281675
1412 8005284366
1413 8005289618
1414 8005318315
1415 8005327084
1416 8005382659
1417 8005384622
1418 8005395651
1419 8005433888
1420 8005464244
1421 8005488805
1422 8005501348
1423 8005546083
1424 8005568435
1425 8005573028
1426 8005622710
1427 8005630225
1428 8005645819
1429 8005672767
1430 8005682499
1431 8005696770
1432 8018163323
1433 8018178979
1434 8024486088
1435 8024488451
1436 8024501163
1437 8046772620
1438 8054463248
1439 8056377040
1440 8056387363
1441 8057881899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

61

201

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8233 12 191
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.7927 3 192
8hc1-assembly1.cif.gz_H cryoem structure of helicobacter pylori urefd/urease complex 0.784 11 216
8hc1-assembly1.cif.gz_H cryoem structure of helicobacter pylori urefd/urease complex 0.7475 11 216
4hi0-assembly1.cif.gz_C crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.7447 1 216
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8377 13 193 1.10.4190.10
af_P9WFE5_1_189_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8082 11 187 1.10.4190.10
af_O14016_3_208_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8014 11 189 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.7704 3 192 1.10.4190.10
af_P9WFE5_1_189_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.7577 11 187 1.10.4190.10
ID Description Score Start End GO Terms
AF-A0A4S0V640-F1-model_v4 Urease accessory protein UreF 0.9258 27 157 GO:0016151
AF-A0A4Q3S398-F1-model_v4 Urease accessory protein UreF 0.8939 12 162 GO:0016151
AF-A0A4S0V640-F1-model_v4 Urease accessory protein UreF 0.8931 27 157 GO:0016151
AF-A0A258LC10-F1-model_v4 Urease accessory protein UreF 0.8871 10 196 GO:0016151
AF-A0A2N3BRD3-F1-model_v4 Urease accessory protein UreF 0.879 11 188 GO:0016151

Map