F477333

General Info

Members Datasets Scaffolds Average Seq Length
720 490 1440 415

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000628|Ga0496125_0000628_23598_24863
Length 393
Sequence MTARPDPGSIELMETEEGSVPPPVAHRPKSGLARFLLGLSLMLIAFNLRPLFSSASALLPEIRAVLGLSATGASLLTTLPVVCLGLFSPLAPRLAQRIGTERTLLGVVVLLACIAVGNVLLPGLVKRDFPDKAALMTGLYTMTMCAGAAGAAGLTLPIEHALGGSLAAALAVWALPALVVSLLWLPQVVMSRGQARRAAVRVEGLWRDRLAWHVTLFMGLQSALAYCVFGWLVPILRERGLDGVTAGAVVSVSVMVQAVACLVAPHLAVRGRDQRLINVALCVVAGLLFAPLWSVWFWAALQGIGQGGLIAVALTVIVLRSPEPIVAAHLSGMAQCVGYLLAAIGPLVVGLIRGWTGSFAWSAALFVLLGLGAAVNGWFAGRALYVKARVVEA

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
37 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
42 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
167 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
168 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
169 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
170 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
171 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
172 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
173 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
174 2512875024
175 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
176 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
177 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
178 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
179 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
180 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
181 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
182 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
183 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
184 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
185 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
186 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
187 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
188 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
189 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
190 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
191 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
192 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
193 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
194 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
195 2534681786 Brucella suis 92/29 Isolate Unclassified
196 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
197 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
198 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
199 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
200 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
201 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
202 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
203 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
204 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
205 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
206 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
207 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
208 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
209 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
210 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
211 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
212 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
213 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
214 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
215 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
216 2643221557 Ensifer sp. Root558 Isolate Unclassified
217 2643221599 Rhizobium sp. Root708 Isolate Unclassified
218 2643221610 Ensifer sp. Root74 Isolate Unclassified
219 2643221618 Ensifer sp. Root231 Isolate Unclassified
220 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
221 2643221626 Ensifer sp. Root31 Isolate Unclassified
222 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
223 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
224 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
225 2643221655 Ensifer sp. Root1252 Isolate Unclassified
226 2643221659 Ensifer sp. Root127 Isolate Unclassified
227 2643221668 Ensifer sp. Root423 Isolate Unclassified
228 2643221675 Ensifer sp. Root1298 Isolate Unclassified
229 2643221680 Ensifer sp. Root1312 Isolate Unclassified
230 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
231 2643221698 Ensifer sp. Root142 Isolate Unclassified
232 2643221712 Ensifer sp. Root258 Isolate Unclassified
233 2643221718 Rhizobium sp. Root268 Isolate Unclassified
234 2643221723 Ensifer sp. Root278 Isolate Unclassified
235 2643221726 Ensifer sp. Root954 Isolate Unclassified
236 2718217882 Rhizobium sp. N741 Isolate Nodule
237 2718217927 Rhizobium sp. N324 Isolate Nodule
238 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
239 2718218009 Rhizobium sp. N561 Isolate Nodule
240 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
241 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
242 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
243 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
244 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
245 2718218363 Rhizobium sp. N113 Isolate Nodule
246 2718218365 Rhizobium sp. N731 Isolate Nodule
247 2718218366 Rhizobium sp. N621 Isolate Nodule
248 2718218423 Rhizobium sp. N941 Isolate Nodule
249 2721755514 Rhizobium sp. N6212 Isolate Nodule
250 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
251 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
252 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
253 2721755809 Rhizobium sp. N541 Isolate Nodule
254 2721755810 Rhizobium sp. N871 Isolate Nodule
255 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
256 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
257 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
258 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
259 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
260 2728369365 Rhizobium sp. N1341 Isolate Nodule
261 2728369397 Rhizobium sp. N1314 Isolate Nodule
262 2738541293 Rhizobium sp. GV031 Isolate Unclassified
263 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
264 2738543024 Aminobacter sp. AP02 Isolate Unclassified
265 2751185800 Brucella pituitosa AA2 Isolate Unclassified
266 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
267 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
268 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
269 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
270 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
271 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
272 2791355256 Rhizobium sp. M10 Isolate Nodule
273 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
274 2791355260 Rhizobium sp. L9 Isolate Nodule
275 2791355261 Rhizobium sp. J15 Isolate Nodule
276 2791355262 Rhizobium sp. M1 Isolate Nodule
277 2791355263 Rhizobium chutanense C5 Isolate Nodule
278 2791355264 Rhizobium sp. S9 Isolate Nodule
279 2791355265 Rhizobium sp. H4 Isolate Nodule
280 2791355266 Rhizobium sp. L43 Isolate Nodule
281 2791355267 Rhizobium sp. L18 Isolate Nodule
282 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
283 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
284 2802429633 Rhizobium anhuiense J3 Isolate Nodule
285 2802429634 Rhizobium anhuiense S10 Isolate Nodule
286 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
287 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
288 2802429637 Rhizobium anhuiense C15 Isolate Nodule
289 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
290 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
291 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
292 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
293 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
294 2838048938 Rhizobium pisi 27/80 Isolate Nodule
295 2838061910 Rhizobium phaseoli L15 Isolate Nodule
296 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
297 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
298 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
299 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
300 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
301 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
302 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
303 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
304 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
305 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
306 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
307 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
308 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
309 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
310 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
311 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
312 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
313 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
314 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
315 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
316 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
317 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
318 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
319 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
320 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
321 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
322 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
323 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
324 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
325 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
326 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
327 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
328 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
329 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
330 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
331 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
332 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
333 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
334 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
335 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
336 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
337 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
338 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
339 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
340 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
341 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
342 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
343 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
344 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
345 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
346 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
347 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
348 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
349 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
350 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
351 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
352 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
353 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
354 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
355 2844163670 Ensifer sp. 1H6 Isolate Unclassified
356 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
357 2854911287 Brucella lupini LUP21 Isolate Unclassified
358 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
359 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
360 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
361 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
362 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
363 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
364 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
365 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
366 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
367 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
368 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
369 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
370 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
371 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
372 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
373 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
374 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
375 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
376 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
377 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
378 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
379 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
380 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
381 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
382 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
383 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
384 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
385 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
386 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
387 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
388 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
389 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
390 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
391 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
392 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
393 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
394 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
395 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
396 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
397 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
398 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
399 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
400 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
401 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
402 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
403 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
404 2933599457 Rhizobium phaseoli M3 Isolate Nodule
405 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
406 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
407 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
408 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
409 2936381700 Rhizobium chutanense C16 Isolate Unclassified
410 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
411 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
412 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
413 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
414 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
415 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
416 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
417 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
418 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
419 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
420 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
421 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
422 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
423 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
424 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
425 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
426 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
427 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
428 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
429 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
430 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
431 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
432 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
433 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
434 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
435 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
436 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
437 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
438 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
439 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
440 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
441 2996887358 Rhizobium sp. R711 Isolate Nodule
442 2996893221 Rhizobium sp. R635 Isolate Nodule
443 3004167301 Mesorhizobium loti 582 Isolate Unclassified
444 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
445 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
446 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
447 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
448 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
449 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
450 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
451 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
452 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
453 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
454 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
455 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
456 8005258706 Rhizobium sp. R693 Isolate Nodule
457 8005275841 Rhizobium sp. N4311 Isolate Nodule
458 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
459 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
460 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
461 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
462 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
463 8005321885 Rhizobium sp. R72 Isolate Nodule
464 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
465 8005382845 Rhizobium sp. R634 Isolate Nodule
466 8005395548 Rhizobium sp. R339 Isolate Nodule
467 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
468 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
469 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
470 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
471 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
472 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
473 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
474 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
475 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
476 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
477 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
478 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
479 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
480 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
481 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
482 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
483 8018176218 Rhizobium sp. N122 Isolate Nodule
484 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
485 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
486 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
487 8024501048 Rhizobium sp. H4 Isolate Nodule
488 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
489 8056382006 Rhizobium croatiense 13T Isolate Nodule
490 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.86
Metatranscriptomes 0
Isolates 45.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.31
Nodule 33.61
Rhizoplane 1.39
Rhizosphere 28.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0000628 3300048928 Bacteria 59302
2 JGI25156J39149_1001756 3300002705 Bacteria 8650
3 JGI25162J39368_1000745 3300002737 Bacteria 22268
4 JGI25158J39367_1000011 3300002739 Bacteria 50391
5 JGI25157J39369_1000751 3300002741 Bacteria 17047
6 JGI25152J39213_1000599 3300002773 Bacteria 19380
7 JGI25152J39213_1001826 3300002773 Bacteria 8591
8 JGI25152J39213_1003276 3300002773 Bacteria 5600
9 JGI25152J39213_1011084 3300002773 Bacteria 2015
10 JGI25150J39212_1000133 3300002774 Bacteria 41648
11 JGI25159J45721_1000055 3300002987 Bacteria 56500
12 JGI25151J46595_10000407 3300003187 Bacteria 44348
13 JGI25151J46595_10002037 3300003187 Bacteria 12631
14 JGI25151J46595_10004080 3300003187 Bacteria 7829
15 JGI25151J46595_10009343 3300003187 Bacteria 4650
16 JGI25151J46595_10009345 3300003187 Bacteria 4650
17 JGI25151J46595_10033446 3300003187 Bacteria 1981
18 JGI25165J46597_1000062 3300003214 Bacteria 206459
19 JGI25165J46597_1000565 3300003214 Bacteria 33508
20 JGI25153J46596_10001632 3300003215 Bacteria 13301
21 JGI25153J46596_10005199 3300003215 Bacteria 6850
22 JGI25153J46596_10007022 3300003215 Bacteria 5608
23 JGI25153J46596_10013563 3300003215 Bacteria 3436
24 JGI25153J46596_10014457 3300003215 Bacteria 3279
25 JGI25160J50197_1000073 3300003354 Bacteria 104247
26 JGI25160J50197_1006341 3300003354 Bacteria 4803
27 JGI25160J50197_1006753 3300003354 Bacteria 4600
28 JGI25160J50197_1013477 3300003354 Bacteria 2785
29 JGI25161J50226_1000552 3300003374 Bacteria 15953
30 JGI25161J50226_1004331 3300003374 Bacteria 2997
31 Ga0055526_1002109 3300003771 Bacteria 13649
32 Ga0055526_1011147 3300003771 Bacteria 4090
33 Ga0055524_1000018 3300003775 Bacteria 234806
34 Ga0055524_1001554 3300003775 Bacteria 12930
35 Ga0055524_1002176 3300003775 Bacteria 10308
36 Ga0055524_1002855 3300003775 Bacteria 8663
37 Ga0055524_1022697 3300003775 Bacteria 2042
38 Ga0055524_1028612 3300003775 Bacteria 1666
39 Ga0055536_1001975 3300003781 Bacteria 11757
40 Ga0055528_1000564 3300003790 Bacteria 28157
41 Ga0055528_1000621 3300003790 Bacteria 26381
42 Ga0055528_1001023 3300003790 Bacteria 18517
43 Ga0055528_1002560 3300003790 Bacteria 9638
44 Ga0055540_1000181 3300003792 Bacteria 61906
45 Ga0055531_10001659 3300003794 Bacteria 16069
46 Ga0055543_1000073 3300004625 Bacteria 88583
47 Ga0055543_1000143 3300004625 Bacteria 59615
48 Ga0055543_1000359 3300004625 Bacteria 30667
49 Ga0065165_1000198 3300005262 Bacteria 104285
50 Ga0065165_1007245 3300005262 Bacteria 5517
51 Ga0065165_1035714 3300005262 Bacteria 1523
52 Ga0070670_100016926 3300005331 Bacteria 6258
53 Ga0070668_100077153 3300005347 Bacteria 2604
54 Ga0070663_100051366 3300005455 Bacteria 2936
55 Ga0068852_100035157 3300005616 Bacteria 4176
56 Ga0081455_10092265 3300005937 Bacteria 2450
57 Ga0075365_10000703 3300006038 Bacteria 13456
58 Ga0075363_100009792 3300006048 Bacteria 4516
59 Ga0075367_10009921 3300006178 Bacteria 4990
60 Ga0075367_10013663 3300006178 Bacteria 4373
61 Ga0075366_10026990 3300006195 Bacteria 3367
62 Ga0105251_10003772 3300009011 Bacteria 10831
63 Ga0105240_10000240 3300009093 Bacteria 109195
64 Ga0105240_10038269 3300009093 Bacteria 6154
65 Ga0105248_10133570 3300009177 Bacteria 2800
66 Ga0105237_10001540 3300009545 Bacteria 30112
67 Ga0105237_10004482 3300009545 Bacteria 16141
68 Ga0105238_10003702 3300009551 Bacteria 15217
69 Ga0123341_1000036 3300009765 Bacteria 61619
70 Ga0123342_1010346 3300009766 Bacteria 10744
71 Ga0123342_1027441 3300009766 Bacteria 3184
72 Ga0105239_10004313 3300010375 Bacteria 17054
73 Ga0105239_10006341 3300010375 Bacteria 13752
74 Ga0171463_1002 3300013249 Bacteria 1274851
75 Ga0182008_10092742 3300014497 Bacteria 1490
76 Ga0183363_1016 3300015690 Bacteria 67144
77 Ga0209436_100113 3300025208 Bacteria 39873
78 Ga0209437_100042 3300025233 Bacteria 444095
79 Ga0207425_1001952 3300025245 Bacteria 7748
80 Ga0207425_1004033 3300025245 Bacteria 4505
81 Ga0207425_1011354 3300025245 Bacteria 2130
82 Ga0209026_1000024 3300025250 Bacteria 355839
83 Ga0209677_100261 3300025253 Bacteria 35631
84 Ga0209759_1000057 3300025256 Bacteria 205181
85 Ga0209129_1000066 3300025258 Bacteria 226820
86 Ga0209129_1000308 3300025258 Bacteria 44371
87 Ga0209129_1001184 3300025258 Bacteria 15017
88 Ga0209129_1001258 3300025258 Bacteria 14534
89 Ga0209129_1001686 3300025258 Bacteria 11960
90 Ga0209129_1002211 3300025258 Bacteria 9762
91 Ga0209233_1000054 3300025261 Bacteria 439669
92 Ga0209233_1000129 3300025261 Bacteria 206511
93 Ga0209233_1000203 3300025261 Bacteria 118984
94 Ga0209673_1000024 3300025273 Bacteria 409632
95 Ga0209673_1000135 3300025273 Bacteria 160333
96 Ga0209673_1003504 3300025273 Bacteria 9204
97 Ga0209673_1003707 3300025273 Bacteria 8754
98 Ga0209673_1006070 3300025273 Bacteria 5932
99 Ga0209673_1006097 3300025273 Bacteria 5911
100 Ga0209673_1007708 3300025273 Bacteria 4904
101 Ga0209130_1000002 3300025284 Bacteria 722648
102 Ga0209130_1000153 3300025284 Bacteria 104299
103 Ga0209130_1004254 3300025284 Bacteria 5549
104 Ga0209675_1002129 3300025291 Bacteria 10441
105 Ga0209676_1001074 3300025292 Bacteria 30947
106 Ga0209025_1000235 3300025294 Bacteria 129981
107 Ga0209025_1000333 3300025294 Bacteria 104266
108 Ga0209025_1000377 3300025294 Bacteria 92728
109 Ga0209025_1000557 3300025294 Bacteria 69226
110 Ga0209025_1000919 3300025294 Bacteria 45324
111 Ga0209025_1005917 3300025294 Bacteria 9753
112 Ga0209025_1033921 3300025294 Bacteria 2346
113 Ga0209564_1000059 3300025295 Bacteria 328782
114 Ga0209564_1000138 3300025295 Bacteria 181512
115 Ga0209564_1000280 3300025295 Bacteria 104429
116 Ga0209564_1001614 3300025295 Bacteria 21891
117 Ga0209564_1011683 3300025295 Bacteria 3908
118 Ga0209564_1013640 3300025295 Bacteria 3432
119 Ga0209564_1014925 3300025295 Bacteria 3196
120 Ga0209758_1000788 3300025297 Bacteria 45324
121 Ga0209758_1001309 3300025297 Bacteria 30362
122 Ga0209758_1001640 3300025297 Bacteria 25413
123 Ga0209758_1001755 3300025297 Bacteria 24062
124 Ga0209758_1002788 3300025297 Bacteria 17090
125 Ga0209758_1010658 3300025297 Bacteria 5463
126 Ga0209758_1017141 3300025297 Bacteria 3630
127 Ga0209758_1047095 3300025297 Bacteria 1547
128 Ga0209050_1005821 3300025298 Bacteria 7560
129 Ga0209050_1016034 3300025298 Bacteria 3095
130 Ga0209256_1000032 3300025299 Bacteria 395041
131 Ga0209256_1000064 3300025299 Bacteria 250853
132 Ga0209256_1000667 3300025299 Bacteria 46381
133 Ga0209256_1001423 3300025299 Bacteria 24892
134 Ga0209256_1001823 3300025299 Bacteria 19960
135 Ga0209256_1005914 3300025299 Bacteria 6760
136 Ga0209256_1011177 3300025299 Bacteria 3628
137 Ga0207426_1000013 3300025302 Bacteria 721897
138 Ga0207426_1000280 3300025302 Bacteria 104299
139 Ga0207426_1000639 3300025302 Bacteria 43792
140 Ga0207426_1004269 3300025302 Bacteria 7081
141 Ga0209051_1000228 3300025303 Bacteria 94166
142 Ga0209051_1003586 3300025303 Bacteria 10096
143 Ga0209051_1020819 3300025303 Bacteria 2811
144 Ga0209257_1004075 3300025304 Bacteria 11719
145 Ga0209257_1007079 3300025304 Bacteria 6924
146 Ga0207695_10000118 3300025913 Bacteria 237085
147 Ga0207671_10000954 3300025914 Bacteria 35929
148 Ga0207650_10010837 3300025925 Bacteria 6264
149 Ga0207644_10013131 3300025931 Bacteria 5514
150 Ga0207668_10014150 3300025972 Bacteria 4934
151 Ga0207678_10051549 3300026067 Bacteria 3553
152 Ga0268266_10175533 3300028379 Bacteria 1948
153 Ga0307515_10052903 3300028794 Bacteria 6008
154 Ga0307513_10153874 3300031456 Bacteria 2203
155 Ga0307405_10000550 3300031731 Bacteria 14248
156 Ga0307406_10002809 3300031901 Bacteria 9495
157 Ga0307412_10000589 3300031911 Bacteria 21521
158 Ga0395900_0040567 3300037418 Bacteria 4797
159 Ga0395905_0089142 3300037471 Bacteria 2891
160 Ga0395905_0112739 3300037471 Bacteria 2554
161 Ga0439465_0000813 3300041413 Bacteria 9820
162 Ga0451798_0814783 3300041458 Bacteria 1527
163 Ga0451843_1425715 3300041509 Bacteria 2152
164 Ga0495617_030281 3300046452 Bacteria 1820
165 Ga0495590_0000013 3300046457 Bacteria 271977
166 Ga0495591_000109 3300046458 Bacteria 94877
167 Ga0495591_020613 3300046458 Bacteria 2173
168 Ga0495638_0000715 3300046460 Bacteria 35779
169 Ga0495650_0019909 3300046471 Bacteria 3286
170 Ga0495605_0001269 3300046474 Bacteria 16723
171 Ga0495605_0002031 3300046474 Bacteria 12766
172 Ga0495605_0002220 3300046474 Bacteria 12125
173 Ga0495605_0004941 3300046474 Bacteria 7791
174 Ga0495584_0000029 3300046491 Bacteria 105850
175 Ga0495584_0001997 3300046491 Bacteria 11733
176 Ga0495584_0014915 3300046491 Bacteria 3959
177 Ga0495585_0000221 3300046492 Bacteria 59316
178 Ga0495585_0003214 3300046492 Bacteria 11151
179 Ga0495585_0010743 3300046492 Bacteria 5438
180 Ga0495585_0027704 3300046492 Bacteria 3233
181 Ga0495596_0005935 3300046500 Bacteria 5696
182 Ga0495596_0043494 3300046500 Bacteria 1770
183 Ga0495607_0002120 3300046501 Bacteria 16568
184 Ga0495607_0027243 3300046501 Bacteria 3536
185 Ga0495607_0031869 3300046501 Bacteria 3224
186 Ga0495607_0038692 3300046501 Bacteria 2855
187 Ga0495583_0000378 3300046506 Bacteria 69104
188 Ga0495583_0001070 3300046506 Bacteria 30573
189 Ga0495583_0003300 3300046506 Bacteria 12506
190 Ga0495583_0004726 3300046506 Bacteria 9579
191 Ga0495583_0016803 3300046506 Bacteria 3913
192 Ga0495583_0016862 3300046506 Bacteria 3902
193 Ga0495583_0025213 3300046506 Bacteria 2974
194 Ga0495583_0046511 3300046506 Bacteria 2000
195 Ga0495606_0002081 3300046507 Bacteria 24424
196 Ga0495606_0019880 3300046507 Bacteria 4973
197 Ga0495606_0024866 3300046507 Bacteria 4303
198 Ga0495606_0042714 3300046507 Bacteria 3030
199 Ga0495606_0047527 3300046507 Bacteria 2828
200 Ga0495606_0054511 3300046507 Bacteria 2589
201 Ga0495606_0057260 3300046507 Bacteria 2511
202 Ga0495606_0070778 3300046507 Bacteria 2199
203 Ga0495606_0076203 3300046507 Bacteria 2097
204 Ga0495610_0000420 3300046512 Bacteria 43578
205 Ga0495610_0004903 3300046512 Bacteria 9722
206 Ga0495610_0012259 3300046512 Bacteria 5174
207 Ga0495610_0021412 3300046512 Bacteria 3557
208 Ga0495616_0000282 3300046513 Bacteria 41088
209 Ga0495616_0008218 3300046513 Bacteria 6196
210 Ga0495616_0041127 3300046513 Bacteria 2359
211 Ga0495620_0002917 3300046515 Bacteria 9822
212 Ga0495620_0018298 3300046515 Bacteria 3472
213 Ga0495631_0000737 3300046518 Bacteria 21033
214 Ga0495631_0002653 3300046518 Bacteria 9973
215 Ga0495631_0021948 3300046518 Bacteria 2970
216 Ga0495631_0030881 3300046518 Bacteria 2428
217 Ga0495632_0000530 3300046519 Bacteria 36061
218 Ga0495632_0003692 3300046519 Bacteria 10734
219 Ga0495632_0008173 3300046519 Bacteria 6463
220 Ga0495632_0014571 3300046519 Bacteria 4442
221 Ga0495632_0069664 3300046519 Bacteria 1693
222 Ga0495637_0000008 3300046520 Bacteria 404658
223 Ga0495637_0001375 3300046520 Bacteria 14567
224 Ga0495643_0009641 3300046522 Bacteria 5984
225 Ga0495643_0035915 3300046522 Bacteria 2726
226 Ga0495643_0042851 3300046522 Bacteria 2465
227 Ga0495643_0069041 3300046522 Bacteria 1858
228 Ga0495644_0013173 3300046523 Bacteria 3177
229 Ga0495648_0006040 3300046524 Bacteria 9940
230 Ga0495648_0044131 3300046524 Bacteria 2786
231 Ga0495648_0089069 3300046524 Bacteria 1733
232 Ga0495642_0002541 3300046528 Bacteria 7382
233 Ga0495642_0003697 3300046528 Bacteria 6002
234 Ga0495609_0004238 3300046538 Bacteria 7922
235 Ga0495609_0024659 3300046538 Bacteria 2758
236 Ga0495597_0015707 3300046542 Bacteria 3582
237 Ga0495622_0003965 3300046557 Bacteria 6910
238 Ga0495633_0000874 3300046558 Bacteria 26052
239 Ga0495633_0004611 3300046558 Bacteria 8684
240 Ga0495633_0028508 3300046558 Bacteria 2720
241 Ga0495656_0013478 3300046615 Bacteria 3044
242 Ga0495668_0005360 3300046616 Bacteria 8741
243 Ga0495668_0018397 3300046616 Bacteria 4037
244 Ga0495668_0032846 3300046616 Bacteria 2918
245 Ga0495668_0066684 3300046616 Bacteria 1980
246 Ga0495611_0001733 3300046648 Bacteria 10560
247 Ga0495611_0011346 3300046648 Bacteria 3777
248 Ga0495625_0013343 3300046660 Bacteria 6605
249 Ga0495625_0114440 3300046660 Bacteria 1841
250 Ga0495661_0000049 3300046665 Bacteria 144060
251 Ga0495661_0024065 3300046665 Bacteria 3944
252 Ga0495661_0144677 3300046665 Bacteria 1289
253 Ga0495588_0014780 3300046674 Bacteria 3744
254 Ga0495588_0033381 3300046674 Bacteria 2599
255 Ga0495669_0001448 3300046684 Bacteria 9794
256 Ga0495671_0076098 3300046692 Bacteria 1646
257 Ga0495649_0000071 3300046694 Bacteria 89386
258 Ga0495649_0002364 3300046694 Bacteria 13344
259 Ga0495649_0008289 3300046694 Bacteria 6257
260 Ga0495589_0001477 3300046794 Bacteria 13524
261 Ga0495589_0002349 3300046794 Bacteria 10618
262 Ga0495660_0001412 3300046810 Bacteria 16457
263 Ga0495660_0010951 3300046810 Bacteria 5271
264 Ga0495660_0026151 3300046810 Bacteria 3310
265 Ga0495604_0052769 3300047317 Bacteria 3146
266 Ga0495672_0000033 3300047320 Bacteria 291992
267 Ga0495672_0019867 3300047320 Bacteria 4418
268 Ga0495683_0000168 3300047323 Bacteria 63828
269 Ga0495683_0063750 3300047323 Bacteria 1820
270 Ga0495687_001452 3300047443 Bacteria 21757
271 Ga0495677_0000242 3300047445 Bacteria 24158
272 Ga0495677_0004949 3300047445 Bacteria 5080
273 Ga0495677_0009106 3300047445 Bacteria 3669
274 Ga0495679_011960 3300047446 Bacteria 3330
275 Ga0495679_018996 3300047446 Bacteria 2424
276 Ga0495679_032389 3300047446 Bacteria 1676
277 Ga0495685_000553 3300047447 Bacteria 11583
278 Ga0495681_0013510 3300047470 Bacteria 4732
279 Ga0495681_0028554 3300047470 Bacteria 2867
280 Ga0495686_0000654 3300047472 Bacteria 47357
281 Ga0495686_0009274 3300047472 Bacteria 7107
282 Ga0495686_0011547 3300047472 Bacteria 6220
283 Ga0495626_0002361 3300048091 Bacteria 13240
284 Ga0495626_0002442 3300048091 Bacteria 12899
285 Ga0495626_0003408 3300048091 Bacteria 10220
286 Ga0495626_0004742 3300048091 Bacteria 8219
287 Ga0495626_0012827 3300048091 Bacteria 4375
288 Ga0495626_0031146 3300048091 Bacteria 2568
289 Ga0495626_0048539 3300048091 Bacteria 1969
290 Ga0496100_0030967 3300048903 Bacteria 3322
291 Ga0496100_0043917 3300048903 Bacteria 2860
292 Ga0496101_0066028 3300048904 Bacteria 2638
293 Ga0496101_0206808 3300048904 Bacteria 1519
294 Ga0496102_0028537 3300048905 Bacteria 4985
295 Ga0496103_0007645 3300048906 Bacteria 6429
296 Ga0496109_0024987 3300048912 Bacteria 5318
297 Ga0496113_0023233 3300048916 Bacteria 4396
298 Ga0496116_0004348 3300048919 Bacteria 13548
299 Ga0496116_0005337 3300048919 Bacteria 11976
300 Ga0496116_0011026 3300048919 Bacteria 7519
301 Ga0496116_0025867 3300048919 Bacteria 4305
302 Ga0496116_0025989 3300048919 Bacteria 4291
303 Ga0496116_0027115 3300048919 Bacteria 4174
304 Ga0496116_0028682 3300048919 Bacteria 4027
305 Ga0496116_0043722 3300048919 Bacteria 3049
306 Ga0496117_0001380 3300048920 Bacteria 35320
307 Ga0496117_0001790 3300048920 Bacteria 29267
308 Ga0496117_0005361 3300048920 Bacteria 13507
309 Ga0496117_0011328 3300048920 Bacteria 7994
310 Ga0496117_0016642 3300048920 Bacteria 6190
311 Ga0496117_0036747 3300048920 Bacteria 3660
312 Ga0496118_0005583 3300048921 Bacteria 14229
313 Ga0496118_0008765 3300048921 Bacteria 10372
314 Ga0496118_0015493 3300048921 Bacteria 7054
315 Ga0496118_0020926 3300048921 Bacteria 5783
316 Ga0496118_0057424 3300048921 Bacteria 2917
317 Ga0496119_0031929 3300048922 Bacteria 3518
318 Ga0496119_0041748 3300048922 Bacteria 2917
319 Ga0496119_0051173 3300048922 Bacteria 2541
320 Ga0496119_0098476 3300048922 Bacteria 1646
321 Ga0496120_0008346 3300048923 Bacteria 7536
322 Ga0496121_0000001 3300048924 Bacteria 1830318
323 Ga0496121_0000897 3300048924 Bacteria 53790
324 Ga0496121_0003845 3300048924 Bacteria 20886
325 Ga0496121_0003993 3300048924 Bacteria 20349
326 Ga0496121_0024884 3300048924 Bacteria 5707
327 Ga0496122_0000321 3300048925 Bacteria 105353
328 Ga0496122_0001753 3300048925 Bacteria 33345
329 Ga0496122_0005948 3300048925 Bacteria 14284
330 Ga0496122_0012997 3300048925 Bacteria 8207
331 Ga0496122_0019043 3300048925 Bacteria 6297
332 Ga0496122_0026877 3300048925 Bacteria 4942
333 Ga0496122_0028565 3300048925 Bacteria 4727
334 Ga0496122_0099530 3300048925 Bacteria 1948
335 Ga0496122_0124217 3300048925 Bacteria 1656
336 Ga0496123_0000454 3300048926 Bacteria 72735
337 Ga0496123_0003014 3300048926 Bacteria 19454
338 Ga0496123_0003705 3300048926 Bacteria 16808
339 Ga0496123_0009997 3300048926 Bacteria 8453
340 Ga0496123_0029238 3300048926 Bacteria 4063
341 Ga0496123_0044505 3300048926 Bacteria 3035
342 Ga0496123_0098177 3300048926 Bacteria 1713
343 Ga0496123_0103705 3300048926 Bacteria 1646
344 Ga0496124_0000558 3300048927 Bacteria 63070
345 Ga0496124_0001760 3300048927 Bacteria 30205
346 Ga0496124_0013038 3300048927 Bacteria 8145
347 Ga0496124_0017056 3300048927 Bacteria 6867
348 Ga0496124_0044517 3300048927 Bacteria 3807
349 Ga0496124_0068102 3300048927 Bacteria 2960
350 Ga0496124_0110958 3300048927 Bacteria 2207
351 Ga0496124_0181628 3300048927 Bacteria 1618
352 Ga0496125_0000001 3300048928 Bacteria 1766138
353 Ga0496125_0004347 3300048928 Bacteria 16436
354 Ga0496125_0007832 3300048928 Bacteria 11292
355 Ga0496125_0008046 3300048928 Bacteria 11130
356 Ga0496126_0000378 3300048929 Bacteria 92187
357 Ga0496126_0037048 3300048929 Bacteria 4555
358 Ga0496126_0050621 3300048929 Bacteria 3784
359 Ga0496126_0203304 3300048929 Bacteria 1671
360 Ga0495678_000024 3300049459 Bacteria 229034
361 Ga0495678_000061 3300049459 Bacteria 142649
362 Ga0495678_004320 3300049459 Bacteria 8277
363 Ga0495678_043663 3300049459 Bacteria 1778
364 Ga0495678_050131 3300049459 Bacteria 1620
365 Ga0495682_0000130 3300049460 Bacteria 65523
366 Ga0495682_0003743 3300049460 Bacteria 6693
367 Ga0501032_0036346 3300049569 Bacteria 3362
368 Ga0501032_0131638 3300049569 Bacteria 1650
369 Ga0501034_0097061 3300049571 Bacteria 2943
370 Ga0501038_0096048 3300049574 Bacteria 2475
371 Ga0501043_0039403 3300049579 Bacteria 3713
372 Ga0501046_0039504 3300049580 Bacteria 3778
373 Ga0501044_0027986 3300049823 Bacteria 5949
374 nmdc:mga03683_47521_c1 3300050489 Bacteria 1781
375 nmdc:mga00v17_3351_c1 3300050491 Bacteria 8270
376 nmdc:mga00v17_8548_c1 3300050491 Bacteria 5510
377 nmdc:mga0k408_14414_c1 3300050493 Bacteria 4355
378 Ga0495655_0014937 3300053083 Bacteria 1640
379 Ga0495619_0071860 3300053085 Bacteria 2316
380 Ga0500569_000477 3300053109 Bacteria 6620
381 Ga0500569_015641 3300053109 Bacteria 1904
382 Ga0500608_013911 3300053122 Bacteria 3578
383 Ga0500618_000926 3300053125 Bacteria 15086
384 Ga0500618_004870 3300053125 Bacteria 4185
385 Ga0500658_0006961 3300053134 Bacteria 4185
386 Ga0500658_0009055 3300053134 Bacteria 3675
387 Ga0500568_0001236 3300053139 Bacteria 16971
388 Ga0500568_0003011 3300053139 Bacteria 9633
389 Ga0500590_002185 3300053148 Bacteria 8531
390 Ga0500616_0000503 3300053153 Bacteria 49936
391 Ga0500620_045515 3300053155 Bacteria 1455
392 Ga0500622_0003044 3300053156 Bacteria 11581
393 Ga0500633_0000526 3300053160 Bacteria 6171
394 Ga0500633_0028604 3300053160 Bacteria 1776
395 Ga0501082_0031127 3300060353 Bacteria 4599
396 2509367556 2509276018 Bacteria 6910194
397 2509388847 2509276021 Bacteria 7634384
398 2509444433 2509276033 Bacteria 7180565
399 2510135822 2510065019 Bacteria 6903379
400 2510897305 2510461076 Bacteria 8618824
401 2511185765 2510917028 Bacteria 6185411
402 2511194114 2510917030 Bacteria 7460662
403 2511392391 2511231027 Bacteria 5013807
404 2512959023 2512875024 Bacteria 7195110
405 2513570988 2513237084 Bacteria 7231967
406 2513574809 2513237085 Bacteria 7695351
407 2513595376 2513237088 Bacteria 6927906
408 2513634060 2513237093 Bacteria 7545552
409 2513707428 2513237103 Bacteria 7647401
410 2513866520 2513237138 Bacteria 7368160
411 2513911367 2513237144 Bacteria 7530820
412 2513924437 2513237146 Bacteria 7166346
413 2514022188 2513237162 Bacteria 7468464
414 2514038302 2513237164 Bacteria 7563725
415 2515115031 2515075009 Bacteria 7288508
416 2515633923 2515154113 Bacteria 7807172
417 2515641258 2515154114 Bacteria 7848616
418 2515659737 2515154116 Bacteria 7552979
419 2515740995 2515154134 Bacteria 7220242
420 2517038617 2516653077 Bacteria 7555578
421 2517078873 2516653085 Bacteria 7346596
422 2517097660 2517093000 Bacteria 7412387
423 2517409092 2517287029 Bacteria 6905599
424 2530648207 2529292951 Bacteria 6916614
425 2535484317 2534681786 Bacteria 3308809
426 2535514720 2534681796 Bacteria 7146037
427 2585201133 2582581294 Bacteria 6626667
428 2585223406 2582581298 Bacteria 7315509
429 2585232422 2582581299 Bacteria 6518058
430 2585256264 2582581304 Bacteria 5831370
431 2585332694 2582581316 Bacteria 7774528
432 2585398942 2582581867 Bacteria 7184437
433 2585523794 2585427526 Bacteria 7258840
434 2585535410 2585427527 Bacteria 7273426
435 2585541809 2585427528 Bacteria 6842387
436 2585545998 2585427529 Bacteria 7395659
437 2585556797 2585427530 Bacteria 7383882
438 2585818937 2585427590 Bacteria 6824633
439 2585840543 2585427593 Bacteria 7141551
440 2585843863 2585427594 Bacteria 6180594
441 2599419601 2599185170 Bacteria 7295545
442 2600197302 2599185352 Bacteria 7228948
443 2616293804 2615840624 Bacteria 6557588
444 2616308067 2615840626 Bacteria 7921970
445 2617381291 2617270742 Bacteria 6808054
446 2643804955 2643221557 Bacteria 7184309
447 2644004563 2643221599 Bacteria 6292121
448 2644065799 2643221610 Bacteria 7480339
449 2644104427 2643221618 Bacteria 7717186
450 2644129146 2643221623 Bacteria 5239945
451 2644147477 2643221626 Bacteria 8069654
452 2644196926 2643221634 Bacteria 6705461
453 2644209168 2643221637 Bacteria 5345260
454 2644237530 2643221643 Bacteria 5749658
455 2644313420 2643221655 Bacteria 7722067
456 2644331575 2643221659 Bacteria 7890716
457 2644376906 2643221668 Bacteria 7306521
458 2644417691 2643221675 Bacteria 7473456
459 2644453795 2643221680 Bacteria 7473610
460 2644498280 2643221689 Bacteria 6042950
461 2644541739 2643221698 Bacteria 7756764
462 2644613045 2643221712 Bacteria 7729434
463 2644652642 2643221718 Bacteria 5345506
464 2644677685 2643221723 Bacteria 7095460
465 2644688430 2643221726 Bacteria 7455827
466 2719183486 2718217882 Bacteria 6556348
467 2719388230 2718217927 Bacteria 6972593
468 2719667850 2718217997 Bacteria 6740740
469 2719734203 2718218009 Bacteria 6478651
470 2720494270 2718218199 Bacteria 6740745
471 2720615733 2718218232 Bacteria 6720332
472 2720622518 2718218233 Bacteria 6662049
473 2720633888 2718218235 Bacteria 6630699
474 2720777572 2718218269 Bacteria 6906114
475 2721149598 2718218363 Bacteria 6524337
476 2721161000 2718218365 Bacteria 6274507
477 2721166435 2718218366 Bacteria 6425255
478 2721401867 2718218423 Bacteria 6438183
479 2722842605 2721755514 Bacteria 6424414
480 2723029172 2721755556 Bacteria 6745503
481 2723562807 2721755684 Bacteria 6859907
482 2723569479 2721755685 Bacteria 6704835
483 2724040681 2721755809 Bacteria 6438790
484 2724046959 2721755810 Bacteria 6479005
485 2724092179 2721755819 Bacteria 6906405
486 2724106744 2721755822 Bacteria 6726041
487 2724112552 2721755823 Bacteria 6752556
488 2725946607 2724679232 Bacteria 7646494
489 2730110108 2728369352 Bacteria 6745171
490 2730166721 2728369365 Bacteria 6555560
491 2730300632 2728369397 Bacteria 6274511
492 2738800935 2738541293 Bacteria 7065685
493 2739038876 2738541333 Bacteria 7106503
494 2739308242 2738543024 Bacteria 5603683
495 2753358881 2751185800 Bacteria 5467370
496 2756675967 2756170246 Bacteria 7451806
497 2758641115 2758568016 Bacteria 5645291
498 2766063309 2765235942 Bacteria 7445910
499 2776269930 2775506902 Bacteria 6208009
500 2776281047 2775506904 Bacteria 5954060
501 2776915160 2775507049 Bacteria 6284736
502 2793296759 2791355256 Bacteria 6798008
503 2793314069 2791355259 Bacteria 7254731
504 2793322357 2791355260 Bacteria 6598818
505 2793328938 2791355261 Bacteria 6661293
506 2793336746 2791355262 Bacteria 6774204
507 2793341184 2791355263 Bacteria 6872478
508 2793349524 2791355264 Bacteria 6429314
509 2793352626 2791355265 Bacteria 6539969
510 2793358371 2791355266 Bacteria 7116587
511 2793365482 2791355267 Bacteria 7222458
512 2805928220 2802429605 Bacteria 6875453
513 2805935571 2802429606 Bacteria 6346811
514 2806046622 2802429633 Bacteria 7341974
515 2806051383 2802429634 Bacteria 7083200
516 2806059372 2802429635 Bacteria 7650140
517 2806066665 2802429636 Bacteria 7597525
518 2806073722 2802429637 Bacteria 7067217
519 2819640996 2818991453 Bacteria 7181617
520 2838020670 2838016132 Bacteria 6577831
521 2838026363 2838022645 Bacteria 6494267
522 2838039864 2838035591 Bacteria 7166484
523 2838044716 2838042994 Bacteria 6046894
524 2838053175 2838048938 Bacteria 6044578
525 2838065810 2838061910 Bacteria 6794874
526 2838070678 2838068647 Bacteria 6208656
527 2838664148 2838661181 Bacteria 7385261
528 2838674932 2838668709 Bacteria 6671819
529 2838680174 2838680041 Bacteria 6545511
530 2838689695 2838686498 Bacteria 7807632
531 2838695795 2838694306 Bacteria 6853137
532 2838707263 2838701080 Bacteria 6669771
533 2838709170 2838707686 Bacteria 6619912
534 2838731610 2838729681 Bacteria 7400765
535 2838744551 2838742623 Bacteria 7396178
536 2839995207 2839993093 Bacteria 5512535
537 2840765665 2840764183 Bacteria 6358399
538 2841853091 2841851746 Bacteria 7532261
539 2841868963 2841864319 Bacteria 6742987
540 2842079594 2842077413 Bacteria 6508645
541 2842112593 2842110456 Bacteria 7656360
542 2842120212 2842118031 Bacteria 7033875
543 2842151940 2842146304 Bacteria 5957337
544 2842160418 2842156927 Bacteria 6894975
545 2842165602 2842163707 Bacteria 6916235
546 2842183916 2842180545 Bacteria 6888678
547 2842196229 2842192696 Bacteria 6147454
548 2842202124 2842198810 Bacteria 6608673
549 2842209063 2842205361 Bacteria 6340321
550 2842219267 2842217011 Bacteria 7497767
551 2842231497 2842229732 Bacteria 7475766
552 2842238581 2842237096 Bacteria 6620661
553 2842246033 2842243621 Bacteria 7421798
554 2842257106 2842250916 Bacteria 6579627
555 2842260411 2842257432 Bacteria 7401195
556 2842268302 2842264693 Bacteria 6472963
557 2842273821 2842271015 Bacteria 7807131
558 2842282247 2842278818 Bacteria 6340002
559 2842286426 2842285085 Bacteria 6011953
560 2842293255 2842291075 Bacteria 7076806
561 2842308951 2842304105 Bacteria 7023636
562 2842312375 2842311132 Bacteria 6616990
563 2842321953 2842317721 Bacteria 6793725
564 2842344495 2842341865 Bacteria 7003929
565 2842367535 2842363717 Bacteria 6844742
566 2842370636 2842370503 Bacteria 7038661
567 2842379652 2842377471 Bacteria 7140707
568 2842386723 2842384541 Bacteria 7057858
569 2842397696 2842395702 Bacteria 6780583
570 2842404021 2842402390 Bacteria 6681310
571 2842410276 2842409023 Bacteria 6687331
572 2842416924 2842415677 Bacteria 6596907
573 2842424293 2842422224 Bacteria 6239196
574 2842432274 2842428310 Bacteria 6767288
575 2842438578 2842434925 Bacteria 6502746
576 2842445208 2842441272 Bacteria 6769273
577 2842452796 2842447887 Bacteria 6754142
578 2842466391 2842462802 Bacteria 6588055
579 2842473211 2842469257 Bacteria 6752936
580 2842485598 2842482326 Bacteria 7212537
581 2842494681 2842489311 Bacteria 6620893
582 2842499859 2842495871 Bacteria 6820686
583 2842874755 2842871566 Bacteria 4827117
584 2844014021 2844009547 Bacteria 6728125
585 2844168937 2844163670 Bacteria 7266046
586 2844456442 2844454524 Bacteria 7952546
587 2854916039 2854911287 Bacteria 5582813
588 2856331372 2856328259 Bacteria 6528202
589 2857522038 2857516855 Bacteria 7787325
590 2869249184 2869242130 Bacteria 6609239
591 2869255002 2869249662 Bacteria 6868783
592 2869264086 2869256925 Bacteria 6981691
593 2869265932 2869264136 Bacteria 6880765
594 2869272415 2869271264 Bacteria 6908218
595 2871452242 2871451962 Bacteria 7336357
596 2871463210 2871459585 Bacteria 6866887
597 2871468382 2871466892 Bacteria 6923287
598 2874116175 2874109183 Bacteria 6517025
599 2874123194 2874116593 Bacteria 6674494
600 2874164363 2874162495 Bacteria 6174670
601 2876392453 2876386047 Bacteria 6698674
602 2876405919 2876399893 Bacteria 6927900
603 2876407223 2876406927 Bacteria 6191900
604 2876427520 2876420981 Bacteria 6687741
605 2878777377 2878774303 Bacteria 6108671
606 2878788431 2878781027 Bacteria 6834456
607 2891374777 2891373044 Bacteria 5202277
608 2894654043 2894652903 Bacteria 4587256
609 2899804058 2899803654 Bacteria 5577784
610 2903516464 2903513507 Bacteria 6344008
611 2904583299 2904578770 Bacteria 5302906
612 2906370634 2906363423 Bacteria 6856682
613 2906371660 2906370794 Bacteria 6881062
614 2906390593 2906386501 Bacteria 5977019
615 2906395354 2906393657 Bacteria 6790866
616 2906401802 2906401398 Bacteria 6693206
617 2906412189 2906408224 Bacteria 6162342
618 2915651380 2915650412 Bacteria 4288180
619 2919101716 2919100787 Bacteria 7710546
620 2919413367 2919408235 Bacteria 6149349
621 2920826865 2920822456 Bacteria 6897201
622 2922151393 2922151315 Bacteria 6902399
623 2922174524 2922172374 Bacteria 6167644
624 2922184959 2922178524 Bacteria 6025201
625 2923556330 2923556063 Bacteria 6793593
626 2924739443 2924733363 Bacteria 7574837
627 2924744379 2924741084 Bacteria 6661321
628 2924753965 2924748358 Bacteria 6154725
629 2928523083 2928521798 Bacteria 4960112
630 2929139769 2929138655 Bacteria 5810547
631 2933023501 2933016740 Bacteria 6355406
632 2933575395 2933570622 Bacteria 7023390
633 2933588518 2933586486 Bacteria 7667493
634 2933601482 2933599457 Bacteria 5858799
635 2935896315 2935894831 Bacteria 6620579
636 2935902479 2935901341 Bacteria 7341747
637 2936369363 2936367885 Bacteria 7324495
638 2936380059 2936375103 Bacteria 6652732
639 2936385701 2936381700 Bacteria 7006523
640 2937863422 2937861824 Bacteria 6660327
641 2937988164 2937980651 Bacteria 6517427
642 2941504171 2941499720 Bacteria 7599444
643 2954013552 2954011201 Bacteria 4762601
644 2958067700 2958064165 Bacteria 7158582
645 2958144052 2958137437 Bacteria 6050276
646 2958163159 2958158011 Bacteria 6058449
647 2961140762 2961136820 Bacteria 6775228
648 2961184596 2961183825 Bacteria 6688536
649 2965026430 2965025482 Bacteria 6532201
650 2965041617 2965040258 Bacteria 6855979
651 2965053317 2965047637 Bacteria 6623551
652 2965091129 2965089291 Bacteria 6866420
653 2965113905 2965110997 Bacteria 6693150
654 2970495618 2970489779 Bacteria 6517260
655 2970517696 2970510686 Bacteria 7006402
656 2970533002 2970532167 Bacteria 6553173
657 2970549355 2970547951 Bacteria 6931819
658 2970619572 2970619444 Bacteria 6986144
659 2970633621 2970627176 Bacteria 6680862
660 2977857088 2977851361 Bacteria 6694324
661 2977901936 2977898635 Bacteria 6675551
662 2977913487 2977907340 Bacteria 6577984
663 2977917501 2977915119 Bacteria 6829656
664 2977941368 2977935797 Bacteria 6252826
665 2977951192 2977950692 Bacteria 6893264
666 2979770983 2979764755 Bacteria 6610066
667 2979773772 2979772303 Bacteria 6618277
668 2987651376 2987645492 Bacteria 6117018
669 2989351941 2989349275 Bacteria 6349068
670 2996389937 2996386984 Bacteria 6978667
671 2996888134 2996887358 Bacteria 5795980
672 2996897748 2996893221 Bacteria 5823108
673 3004169205 3004167301 Bacteria 8330599
674 3004235098 3004232784 Bacteria 6662140
675 3004253287 3004248173 Bacteria 6563236
676 3005410783 3005409236 Bacteria 7188837
677 3005422188 3005416602 Bacteria 7064308
678 3005450229 3005445848 Bacteria 6906074
679 3005456516 3005452660 Bacteria 5889319
680 639646223 639633055 Bacteria 7751309
681 649873233 649633066 Bacteria 6690028
682 8002288790 8002285264 Bacteria 6717907
683 8004306642 8004300914 Bacteria 6132239
684 8004317204 8004312739 Bacteria 7444653
685 8004731935 8004727605 Bacteria 6643904
686 8005261314 8005258706 Bacteria 6184835
687 8005278436 8005275841 Bacteria 6929066
688 8005283020 8005282627 Bacteria 6675747
689 8005291498 8005289223 Bacteria 6634003
690 8005305622 8005301065 Bacteria 6614431
691 8005310404 8005307578 Bacteria 7395396
692 8005321467 8005314921 Bacteria 7072929
693 8005322661 8005321885 Bacteria 5795980
694 8005377871 8005376324 Bacteria 6590079
695 8005385165 8005382845 Bacteria 6732062
696 8005399755 8005395548 Bacteria 6806915
697 8005433251 8005430974 Bacteria 6689030
698 8005465728 8005460587 Bacteria 7157962
699 8005489789 8005484373 Bacteria 6297373
700 8005498265 8005497431 Bacteria 6477605
701 8005543390 8005542996 Bacteria 7077758
702 8005560172 8005556819 Bacteria 6908598
703 8005564373 8005563573 Bacteria 7153261
704 8005573925 8005570704 Bacteria 6957481
705 8005619455 8005619151 Bacteria 7030230
706 8005650661 8005645114 Bacteria 6950293
707 8005669674 8005668836 Bacteria 6953162
708 8005683645 8005682033 Bacteria 6726518
709 8005692624 8005688590 Bacteria 6610080
710 8005699701 8005695170 Bacteria 6912330
711 8018132712 8018127388 Bacteria 7351159
712 8018167445 8018163183 Bacteria 7277977
713 8018181913 8018176218 Bacteria 6896178
714 8023684690 8023680758 Bacteria 7729763
715 8024479849 8024479707 Bacteria 6954785
716 8024491717 8024486573 Bacteria 6540512
717 8024506472 8024501048 Bacteria 6427847
718 8056376073 8056375014 Bacteria 7006639
719 8056384182 8056382006 Bacteria 6408074
720 8057879036 8057874678 Bacteria 7494653
721 Ga0496125_0000628
722 JGI25156J39149_1001756
723 JGI25162J39368_1000745
724 JGI25158J39367_1000011
725 JGI25157J39369_1000751
726 JGI25152J39213_1000599
727 JGI25152J39213_1001826
728 JGI25152J39213_1003276
729 JGI25152J39213_1011084
730 JGI25150J39212_1000133
731 JGI25159J45721_1000055
732 JGI25151J46595_10000407
733 JGI25151J46595_10002037
734 JGI25151J46595_10004080
735 JGI25151J46595_10009343
736 JGI25151J46595_10009345
737 JGI25151J46595_10033446
738 JGI25165J46597_1000062
739 JGI25165J46597_1000565
740 JGI25153J46596_10001632
741 JGI25153J46596_10005199
742 JGI25153J46596_10007022
743 JGI25153J46596_10013563
744 JGI25153J46596_10014457
745 JGI25160J50197_1000073
746 JGI25160J50197_1006341
747 JGI25160J50197_1006753
748 JGI25160J50197_1013477
749 JGI25161J50226_1000552
750 JGI25161J50226_1004331
751 Ga0055526_1002109
752 Ga0055526_1011147
753 Ga0055524_1000018
754 Ga0055524_1001554
755 Ga0055524_1002176
756 Ga0055524_1002855
757 Ga0055524_1022697
758 Ga0055524_1028612
759 Ga0055536_1001975
760 Ga0055528_1000564
761 Ga0055528_1000621
762 Ga0055528_1001023
763 Ga0055528_1002560
764 Ga0055540_1000181
765 Ga0055531_10001659
766 Ga0055543_1000073
767 Ga0055543_1000143
768 Ga0055543_1000359
769 Ga0065165_1000198
770 Ga0065165_1007245
771 Ga0065165_1035714
772 Ga0070670_100016926
773 Ga0070668_100077153
774 Ga0070663_100051366
775 Ga0068852_100035157
776 Ga0081455_10092265
777 Ga0075365_10000703
778 Ga0075363_100009792
779 Ga0075367_10009921
780 Ga0075367_10013663
781 Ga0075366_10026990
782 Ga0105251_10003772
783 Ga0105240_10000240
784 Ga0105240_10038269
785 Ga0105248_10133570
786 Ga0105237_10001540
787 Ga0105237_10004482
788 Ga0105238_10003702
789 Ga0123341_1000036
790 Ga0123342_1010346
791 Ga0123342_1027441
792 Ga0105239_10004313
793 Ga0105239_10006341
794 Ga0171463_1002
795 Ga0182008_10092742
796 Ga0183363_1016
797 Ga0209436_100113
798 Ga0209437_100042
799 Ga0207425_1001952
800 Ga0207425_1004033
801 Ga0207425_1011354
802 Ga0209026_1000024
803 Ga0209677_100261
804 Ga0209759_1000057
805 Ga0209129_1000066
806 Ga0209129_1000308
807 Ga0209129_1001184
808 Ga0209129_1001258
809 Ga0209129_1001686
810 Ga0209129_1002211
811 Ga0209233_1000054
812 Ga0209233_1000129
813 Ga0209233_1000203
814 Ga0209673_1000024
815 Ga0209673_1000135
816 Ga0209673_1003504
817 Ga0209673_1003707
818 Ga0209673_1006070
819 Ga0209673_1006097
820 Ga0209673_1007708
821 Ga0209130_1000002
822 Ga0209130_1000153
823 Ga0209130_1004254
824 Ga0209675_1002129
825 Ga0209676_1001074
826 Ga0209025_1000235
827 Ga0209025_1000333
828 Ga0209025_1000377
829 Ga0209025_1000557
830 Ga0209025_1000919
831 Ga0209025_1005917
832 Ga0209025_1033921
833 Ga0209564_1000059
834 Ga0209564_1000138
835 Ga0209564_1000280
836 Ga0209564_1001614
837 Ga0209564_1011683
838 Ga0209564_1013640
839 Ga0209564_1014925
840 Ga0209758_1000788
841 Ga0209758_1001309
842 Ga0209758_1001640
843 Ga0209758_1001755
844 Ga0209758_1002788
845 Ga0209758_1010658
846 Ga0209758_1017141
847 Ga0209758_1047095
848 Ga0209050_1005821
849 Ga0209050_1016034
850 Ga0209256_1000032
851 Ga0209256_1000064
852 Ga0209256_1000667
853 Ga0209256_1001423
854 Ga0209256_1001823
855 Ga0209256_1005914
856 Ga0209256_1011177
857 Ga0207426_1000013
858 Ga0207426_1000280
859 Ga0207426_1000639
860 Ga0207426_1004269
861 Ga0209051_1000228
862 Ga0209051_1003586
863 Ga0209051_1020819
864 Ga0209257_1004075
865 Ga0209257_1007079
866 Ga0207695_10000118
867 Ga0207671_10000954
868 Ga0207650_10010837
869 Ga0207644_10013131
870 Ga0207668_10014150
871 Ga0207678_10051549
872 Ga0268266_10175533
873 Ga0307515_10052903
874 Ga0307513_10153874
875 Ga0307405_10000550
876 Ga0307406_10002809
877 Ga0307412_10000589
878 Ga0395900_0040567
879 Ga0395905_0089142
880 Ga0395905_0112739
881 Ga0439465_0000813
882 Ga0451798_0814783
883 Ga0451843_1425715
884 Ga0495617_030281
885 Ga0495590_0000013
886 Ga0495591_000109
887 Ga0495591_020613
888 Ga0495638_0000715
889 Ga0495650_0019909
890 Ga0495605_0001269
891 Ga0495605_0002031
892 Ga0495605_0002220
893 Ga0495605_0004941
894 Ga0495584_0000029
895 Ga0495584_0001997
896 Ga0495584_0014915
897 Ga0495585_0000221
898 Ga0495585_0003214
899 Ga0495585_0010743
900 Ga0495585_0027704
901 Ga0495596_0005935
902 Ga0495596_0043494
903 Ga0495607_0002120
904 Ga0495607_0027243
905 Ga0495607_0031869
906 Ga0495607_0038692
907 Ga0495583_0000378
908 Ga0495583_0001070
909 Ga0495583_0003300
910 Ga0495583_0004726
911 Ga0495583_0016803
912 Ga0495583_0016862
913 Ga0495583_0025213
914 Ga0495583_0046511
915 Ga0495606_0002081
916 Ga0495606_0019880
917 Ga0495606_0024866
918 Ga0495606_0042714
919 Ga0495606_0047527
920 Ga0495606_0054511
921 Ga0495606_0057260
922 Ga0495606_0070778
923 Ga0495606_0076203
924 Ga0495610_0000420
925 Ga0495610_0004903
926 Ga0495610_0012259
927 Ga0495610_0021412
928 Ga0495616_0000282
929 Ga0495616_0008218
930 Ga0495616_0041127
931 Ga0495620_0002917
932 Ga0495620_0018298
933 Ga0495631_0000737
934 Ga0495631_0002653
935 Ga0495631_0021948
936 Ga0495631_0030881
937 Ga0495632_0000530
938 Ga0495632_0003692
939 Ga0495632_0008173
940 Ga0495632_0014571
941 Ga0495632_0069664
942 Ga0495637_0000008
943 Ga0495637_0001375
944 Ga0495643_0009641
945 Ga0495643_0035915
946 Ga0495643_0042851
947 Ga0495643_0069041
948 Ga0495644_0013173
949 Ga0495648_0006040
950 Ga0495648_0044131
951 Ga0495648_0089069
952 Ga0495642_0002541
953 Ga0495642_0003697
954 Ga0495609_0004238
955 Ga0495609_0024659
956 Ga0495597_0015707
957 Ga0495622_0003965
958 Ga0495633_0000874
959 Ga0495633_0004611
960 Ga0495633_0028508
961 Ga0495656_0013478
962 Ga0495668_0005360
963 Ga0495668_0018397
964 Ga0495668_0032846
965 Ga0495668_0066684
966 Ga0495611_0001733
967 Ga0495611_0011346
968 Ga0495625_0013343
969 Ga0495625_0114440
970 Ga0495661_0000049
971 Ga0495661_0024065
972 Ga0495661_0144677
973 Ga0495588_0014780
974 Ga0495588_0033381
975 Ga0495669_0001448
976 Ga0495671_0076098
977 Ga0495649_0000071
978 Ga0495649_0002364
979 Ga0495649_0008289
980 Ga0495589_0001477
981 Ga0495589_0002349
982 Ga0495660_0001412
983 Ga0495660_0010951
984 Ga0495660_0026151
985 Ga0495604_0052769
986 Ga0495672_0000033
987 Ga0495672_0019867
988 Ga0495683_0000168
989 Ga0495683_0063750
990 Ga0495687_001452
991 Ga0495677_0000242
992 Ga0495677_0004949
993 Ga0495677_0009106
994 Ga0495679_011960
995 Ga0495679_018996
996 Ga0495679_032389
997 Ga0495685_000553
998 Ga0495681_0013510
999 Ga0495681_0028554
1000 Ga0495686_0000654
1001 Ga0495686_0009274
1002 Ga0495686_0011547
1003 Ga0495626_0002361
1004 Ga0495626_0002442
1005 Ga0495626_0003408
1006 Ga0495626_0004742
1007 Ga0495626_0012827
1008 Ga0495626_0031146
1009 Ga0495626_0048539
1010 Ga0496100_0030967
1011 Ga0496100_0043917
1012 Ga0496101_0066028
1013 Ga0496101_0206808
1014 Ga0496102_0028537
1015 Ga0496103_0007645
1016 Ga0496109_0024987
1017 Ga0496113_0023233
1018 Ga0496116_0004348
1019 Ga0496116_0005337
1020 Ga0496116_0011026
1021 Ga0496116_0025867
1022 Ga0496116_0025989
1023 Ga0496116_0027115
1024 Ga0496116_0028682
1025 Ga0496116_0043722
1026 Ga0496117_0001380
1027 Ga0496117_0001790
1028 Ga0496117_0005361
1029 Ga0496117_0011328
1030 Ga0496117_0016642
1031 Ga0496117_0036747
1032 Ga0496118_0005583
1033 Ga0496118_0008765
1034 Ga0496118_0015493
1035 Ga0496118_0020926
1036 Ga0496118_0057424
1037 Ga0496119_0031929
1038 Ga0496119_0041748
1039 Ga0496119_0051173
1040 Ga0496119_0098476
1041 Ga0496120_0008346
1042 Ga0496121_0000001
1043 Ga0496121_0000897
1044 Ga0496121_0003845
1045 Ga0496121_0003993
1046 Ga0496121_0024884
1047 Ga0496122_0000321
1048 Ga0496122_0001753
1049 Ga0496122_0005948
1050 Ga0496122_0012997
1051 Ga0496122_0019043
1052 Ga0496122_0026877
1053 Ga0496122_0028565
1054 Ga0496122_0099530
1055 Ga0496122_0124217
1056 Ga0496123_0000454
1057 Ga0496123_0003014
1058 Ga0496123_0003705
1059 Ga0496123_0009997
1060 Ga0496123_0029238
1061 Ga0496123_0044505
1062 Ga0496123_0098177
1063 Ga0496123_0103705
1064 Ga0496124_0000558
1065 Ga0496124_0001760
1066 Ga0496124_0013038
1067 Ga0496124_0017056
1068 Ga0496124_0044517
1069 Ga0496124_0068102
1070 Ga0496124_0110958
1071 Ga0496124_0181628
1072 Ga0496125_0000001
1073 Ga0496125_0004347
1074 Ga0496125_0007832
1075 Ga0496125_0008046
1076 Ga0496126_0000378
1077 Ga0496126_0037048
1078 Ga0496126_0050621
1079 Ga0496126_0203304
1080 Ga0495678_000024
1081 Ga0495678_000061
1082 Ga0495678_004320
1083 Ga0495678_043663
1084 Ga0495678_050131
1085 Ga0495682_0000130
1086 Ga0495682_0003743
1087 Ga0501032_0036346
1088 Ga0501032_0131638
1089 Ga0501034_0097061
1090 Ga0501038_0096048
1091 Ga0501043_0039403
1092 Ga0501046_0039504
1093 Ga0501044_0027986
1094 nmdc:mga03683_47521_c1
1095 nmdc:mga00v17_3351_c1
1096 nmdc:mga00v17_8548_c1
1097 nmdc:mga0k408_14414_c1
1098 Ga0495655_0014937
1099 Ga0495619_0071860
1100 Ga0500569_000477
1101 Ga0500569_015641
1102 Ga0500608_013911
1103 Ga0500618_000926
1104 Ga0500618_004870
1105 Ga0500658_0006961
1106 Ga0500658_0009055
1107 Ga0500568_0001236
1108 Ga0500568_0003011
1109 Ga0500590_002185
1110 Ga0500616_0000503
1111 Ga0500620_045515
1112 Ga0500622_0003044
1113 Ga0500633_0000526
1114 Ga0500633_0028604
1115 Ga0501082_0031127
1116 2509367556
1117 2509388847
1118 2509444433
1119 2510135822
1120 2510897305
1121 2511185765
1122 2511194114
1123 2511392391
1124 2512959023
1125 2513570988
1126 2513574809
1127 2513595376
1128 2513634060
1129 2513707428
1130 2513866520
1131 2513911367
1132 2513924437
1133 2514022188
1134 2514038302
1135 2515115031
1136 2515633923
1137 2515641258
1138 2515659737
1139 2515740995
1140 2517038617
1141 2517078873
1142 2517097660
1143 2517409092
1144 2530648207
1145 2535484317
1146 2535514720
1147 2585201133
1148 2585223406
1149 2585232422
1150 2585256264
1151 2585332694
1152 2585398942
1153 2585523794
1154 2585535410
1155 2585541809
1156 2585545998
1157 2585556797
1158 2585818937
1159 2585840543
1160 2585843863
1161 2599419601
1162 2600197302
1163 2616293804
1164 2616308067
1165 2617381291
1166 2643804955
1167 2644004563
1168 2644065799
1169 2644104427
1170 2644129146
1171 2644147477
1172 2644196926
1173 2644209168
1174 2644237530
1175 2644313420
1176 2644331575
1177 2644376906
1178 2644417691
1179 2644453795
1180 2644498280
1181 2644541739
1182 2644613045
1183 2644652642
1184 2644677685
1185 2644688430
1186 2719183486
1187 2719388230
1188 2719667850
1189 2719734203
1190 2720494270
1191 2720615733
1192 2720622518
1193 2720633888
1194 2720777572
1195 2721149598
1196 2721161000
1197 2721166435
1198 2721401867
1199 2722842605
1200 2723029172
1201 2723562807
1202 2723569479
1203 2724040681
1204 2724046959
1205 2724092179
1206 2724106744
1207 2724112552
1208 2725946607
1209 2730110108
1210 2730166721
1211 2730300632
1212 2738800935
1213 2739038876
1214 2739308242
1215 2753358881
1216 2756675967
1217 2758641115
1218 2766063309
1219 2776269930
1220 2776281047
1221 2776915160
1222 2793296759
1223 2793314069
1224 2793322357
1225 2793328938
1226 2793336746
1227 2793341184
1228 2793349524
1229 2793352626
1230 2793358371
1231 2793365482
1232 2805928220
1233 2805935571
1234 2806046622
1235 2806051383
1236 2806059372
1237 2806066665
1238 2806073722
1239 2819640996
1240 2838020670
1241 2838026363
1242 2838039864
1243 2838044716
1244 2838053175
1245 2838065810
1246 2838070678
1247 2838664148
1248 2838674932
1249 2838680174
1250 2838689695
1251 2838695795
1252 2838707263
1253 2838709170
1254 2838731610
1255 2838744551
1256 2839995207
1257 2840765665
1258 2841853091
1259 2841868963
1260 2842079594
1261 2842112593
1262 2842120212
1263 2842151940
1264 2842160418
1265 2842165602
1266 2842183916
1267 2842196229
1268 2842202124
1269 2842209063
1270 2842219267
1271 2842231497
1272 2842238581
1273 2842246033
1274 2842257106
1275 2842260411
1276 2842268302
1277 2842273821
1278 2842282247
1279 2842286426
1280 2842293255
1281 2842308951
1282 2842312375
1283 2842321953
1284 2842344495
1285 2842367535
1286 2842370636
1287 2842379652
1288 2842386723
1289 2842397696
1290 2842404021
1291 2842410276
1292 2842416924
1293 2842424293
1294 2842432274
1295 2842438578
1296 2842445208
1297 2842452796
1298 2842466391
1299 2842473211
1300 2842485598
1301 2842494681
1302 2842499859
1303 2842874755
1304 2844014021
1305 2844168937
1306 2844456442
1307 2854916039
1308 2856331372
1309 2857522038
1310 2869249184
1311 2869255002
1312 2869264086
1313 2869265932
1314 2869272415
1315 2871452242
1316 2871463210
1317 2871468382
1318 2874116175
1319 2874123194
1320 2874164363
1321 2876392453
1322 2876405919
1323 2876407223
1324 2876427520
1325 2878777377
1326 2878788431
1327 2891374777
1328 2894654043
1329 2899804058
1330 2903516464
1331 2904583299
1332 2906370634
1333 2906371660
1334 2906390593
1335 2906395354
1336 2906401802
1337 2906412189
1338 2915651380
1339 2919101716
1340 2919413367
1341 2920826865
1342 2922151393
1343 2922174524
1344 2922184959
1345 2923556330
1346 2924739443
1347 2924744379
1348 2924753965
1349 2928523083
1350 2929139769
1351 2933023501
1352 2933575395
1353 2933588518
1354 2933601482
1355 2935896315
1356 2935902479
1357 2936369363
1358 2936380059
1359 2936385701
1360 2937863422
1361 2937988164
1362 2941504171
1363 2954013552
1364 2958067700
1365 2958144052
1366 2958163159
1367 2961140762
1368 2961184596
1369 2965026430
1370 2965041617
1371 2965053317
1372 2965091129
1373 2965113905
1374 2970495618
1375 2970517696
1376 2970533002
1377 2970549355
1378 2970619572
1379 2970633621
1380 2977857088
1381 2977901936
1382 2977913487
1383 2977917501
1384 2977941368
1385 2977951192
1386 2979770983
1387 2979773772
1388 2987651376
1389 2989351941
1390 2996389937
1391 2996888134
1392 2996897748
1393 3004169205
1394 3004235098
1395 3004253287
1396 3005410783
1397 3005422188
1398 3005450229
1399 3005456516
1400 639646223
1401 649873233
1402 8002288790
1403 8004306642
1404 8004317204
1405 8004731935
1406 8005261314
1407 8005278436
1408 8005283020
1409 8005291498
1410 8005305622
1411 8005310404
1412 8005321467
1413 8005322661
1414 8005377871
1415 8005385165
1416 8005399755
1417 8005433251
1418 8005465728
1419 8005489789
1420 8005498265
1421 8005543390
1422 8005560172
1423 8005564373
1424 8005573925
1425 8005619455
1426 8005650661
1427 8005669674
1428 8005683645
1429 8005692624
1430 8005699701
1431 8018132712
1432 8018167445
1433 8018181913
1434 8023684690
1435 8024479849
1436 8024491717
1437 8024506472
1438 8056376073
1439 8056384182
1440 8057879036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8512 33 389
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8409 30 391
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8288 35 391
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8277 34 389
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.81 34 387
ID Description Score Start End Superfamily
af_P76242_7_383_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9315 28 389 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9243 37 221 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9148 37 221 1.20.1250.20
af_P0AA80_9_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.908 33 208 1.20.1250.20
af_Q54W37_27_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9003 33 207 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A317KX19-F1-model_v4 MFS transporter 0.9516 28 389 GO:0005886
GO:0022857
AF-T0C469-F1-model_v4 deleted 0.9421 31 214
AF-A0A0L8MD32-F1-model_v4 Transporter 0.9327 29 388 GO:0016020
GO:0022857
AF-A0A839UDC1-F1-model_v4 CP family cyanate transporter-like MFS transporter 0.9304 36 389 GO:0016020
GO:0022857
AF-A0A7L7MEU8-F1-model_v4 MFS transporter 0.9163 28 389 GO:0016020
GO:0022857

Map